Citrus Sinensis ID: 027309

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-----
MHCEACARKVARALKGFEGVDDITADSKASKVVVKGKTADPIKVCERLQKKSGRKVELISPLPKPPPPDADDQEKKEQQKVEKKEEPPAAITVVLNVRMHCEACAQGLRKRIRKIQGVECVETNLASGQVIVKGVVDPVKLVNDVNKKTRKQASIVKDEEKKQEEKKEGEKKDGGEEAKVDEEKNKQQLDFNINRSEYWATKNYSEFAYAPQIFSDENPNACFVM
cccHHHHHHHHHHHccccccEEEEEEccccEEEEEEEcccHHHHHHHHHHHccccEEEccccccccccccccHHHHHHHHHcccccccccEEEEEEEEcccHHHHHHHHHHHcccccEEEEEEEccccEEEEEEEccHHHHHHHHHHHccccEEEEcccHHHHHHHHHcccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccc
cccHHHHHHHHHHHHcccccEEEEEEccccEEEEEcccccHHHHHHHHHHHccccEEEEccccccccccccccccccccccccccccccEEEEEEEEEEccHHHHHHHHHHHHHccccEEEEEEccccEEEEEEEEcHHHHHHHHHHHHcccEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccHcccccccccEcc
MHCEACARKVARALKgfegvdditadskASKVVVkgktadpiKVCERLQkksgrkvelisplpkppppdaddqEKKEQQKvekkeeppaAITVVLNVRMHCEACAQGLRKRIRKIQGVECVETNlasgqvivkgvvdpvklvndvnkktrkQASIVKDEEKKQEEkkegekkdggeeakvdeeknkqqldfninrseywatknysefayapqifsdenpnacfvm
MHCEACARKVARalkgfegvdditadskaskvvvkgktadpikvcerlqkksgrkvelisplpkppppdaddQEKKEQqkvekkeeppaAITVVLNVRMHCEACAQGLRKRIRKIQGVECVEtnlasgqvivkgvvdpvklvndvnkktrkqasivkdeekkqeekkegekkdggeeakvdeeknkqqldfniNRSEYWATKNYSEFAYAPQIFSDENPNACFVM
MHCEACARKVARALKGFEGVDDITADSKASKVVVKGKTADPIKVCERLQKKSGRKVELISplpkppppdaddqekkeqqkvekkeeppaaITVVLNVRMHCEACAQGLRKRIRKIQGVECVETNLASGQVIVKGVVDPVKLVNDVNKKTRKQASIVkdeekkqeekkegekkdggeeakvdeekNKQQLDFNINRSEYWATKNYSEFAYAPQIFSDENPNACFVM
*******RKVARALKGFEGVDDIT*******VVVK******IKVC********************************************AITVVLNVRMHCEACAQGLRKRIRKIQGVECVETNLASGQVIVKGVVDPVKLVNDV*********************************************FNINRSEYWATKNYSEFAYAPQIFS**********
MHCEACARKVARALKGFEGVDDITADSKASKVVVKGKTADPIKVCERLQKKSGRKVELISPLPKPPPPDADDQEKKEQQKVEKKEEPPAAITVVLNVRMHCEACAQGLRKRIRKIQGVECVETNLASGQVIVKGVVDPVKLVNDVNKKTRKQASI*****************************NKQQLDFNINRSEYWATKNYSEFAYAPQIFSDENPNACFVM
MHCEACARKVARALKGFEGVDDITADSKASKVVVKGKTADPIKVCERLQKKSGRKVELISPLPKPP********************PPAAITVVLNVRMHCEACAQGLRKRIRKIQGVECVETNLASGQVIVKGVVDPVKLVNDVNKKTRK********************************KNKQQLDFNINRSEYWATKNYSEFAYAPQIFSDENPNACFVM
MHCEACARKVARALKGFEGVDDITADSKASKVVVKGKTADPIKVCERLQKKSGRKVELISPLP***********************PPAAITVVLNVRMHCEACAQGLRKRIRKIQGVECVETNLASGQVIVKGVVDPVKLVNDVNKKTRKQASIVKDE******************************DFNINRSEYWATKNYSEFAYAPQIFSDENPNACFVM
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHCEACARKVARALKGFEGVDDITADSKASKVVVKGKTADPIKVCERLQKKSGRKVELISPLPKPPPPDADDQEKKEQQKVEKKEEPPAAITVVLNVRMHCEACAQGLRKRIRKIQGVECVETNLASGQVIVKGVVDPVKLVNDVNKKTRKQASIVKDEEKKQEEKKEGEKKDGGEEAKVDEEKNKQQLDFNINRSEYWATKNYSEFAYAPQIFSDENPNACFVM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query225 2.2.26 [Sep-21-2011]
Q9SZN7153 Heavy metal-associated is no no 0.275 0.405 0.460 1e-07
>sp|Q9SZN7|HIP26_ARATH Heavy metal-associated isoprenylated plant protein 26 OS=Arabidopsis thaliana GN=HIPP26 PE=1 SV=1 Back     alignment and function desciption
 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 40/63 (63%), Gaps = 1/63 (1%)

Query: 1  MHCEACARKVARALKGFEGVDDITADSKASKVVVKGKTADPIKVCERLQKKSGRKVELIS 60
          M CE C RKV R+++G +GV  +T + KA KV V G   DP KV  R+  ++G+KVEL  
Sbjct: 34 MDCEGCERKVRRSVEGMKGVSSVTLEPKAHKVTVVG-YVDPNKVVARMSHRTGKKVELWP 92

Query: 61 PLP 63
           +P
Sbjct: 93 YVP 95
Heavy-metal-binding protein. Binds lead, cadmium and copper. May be involved in heavy-metal transport.
Arabidopsis thaliana (taxid: 3702)

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query225
224139462267 predicted protein [Populus trichocarpa] 0.973 0.820 0.687 5e-70
224089579261 predicted protein [Populus trichocarpa] 0.973 0.839 0.688 1e-69
351723703262 uncharacterized protein LOC100527827 [Gl 0.995 0.854 0.691 4e-62
356555759267 PREDICTED: uncharacterized protein LOC10 0.986 0.831 0.658 1e-59
359496109267 PREDICTED: uncharacterized protein LOC10 0.986 0.831 0.649 2e-59
356522075257 PREDICTED: uncharacterized protein LOC10 0.982 0.859 0.675 6e-59
388511173270 unknown [Medicago truncatula] 1.0 0.833 0.633 3e-58
356532760259 PREDICTED: uncharacterized protein LOC10 1.0 0.868 0.640 4e-58
356532758267 PREDICTED: uncharacterized protein LOC10 1.0 0.842 0.640 4e-58
255634642257 unknown [Glycine max] 0.982 0.859 0.666 1e-57
>gi|224139462|ref|XP_002323124.1| predicted protein [Populus trichocarpa] gi|222867754|gb|EEF04885.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  270 bits (689), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 163/237 (68%), Positives = 191/237 (80%), Gaps = 18/237 (7%)

Query: 1   MHCEACARKVARALKGFEGVDDITADSKASKVVVKGKTADPIKVCERLQKKSGRKVELIS 60
           MHCEACARKVARALKGFEGV+++T DSKASKVVVKGK ADPIKVCERL+KK+GRKVELIS
Sbjct: 37  MHCEACARKVARALKGFEGVEEVTTDSKASKVVVKGKKADPIKVCERLRKKNGRKVELIS 96

Query: 61  PLPKPPPPDADDQEKKEQQK-----VEKKEEPPAAITVVLNVRMHCEACAQGLRKRIRKI 115
           PLPKPP      +E KE+ K      EKK+EPP  +TVVLNVRMHCEACAQ L+KRIRKI
Sbjct: 97  PLPKPP------EENKEENKDPPKEEEKKDEPPPVVTVVLNVRMHCEACAQSLQKRIRKI 150

Query: 116 QGVECVETNLASGQVIVKGVVDPVKLVNDVNKKTRKQASIVKDEEKKQEEKKEGEKKDGG 175
           +GVE VET+LA+GQVIVKGVVDP KLV+DV KKT KQASIVK+EEKK+EEKKE EKK+  
Sbjct: 151 KGVESVETDLANGQVIVKGVVDPSKLVDDVYKKTGKQASIVKNEEKKEEEKKEEEKKEEK 210

Query: 176 EEAKVDEEKNKQQLDF------NINRSEYWATKNYS-EFAYAPQIFSDENPNACFVM 225
           +E K  E+K  ++         +I +SEYW +K YS ++AYAP+ FSDENPNAC +M
Sbjct: 211 KEEKEGEKKEGEEEKEGDDKKPDIKKSEYWPSKYYSDQYAYAPEFFSDENPNACSIM 267

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224089579|ref|XP_002308765.1| predicted protein [Populus trichocarpa] gi|222854741|gb|EEE92288.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|351723703|ref|NP_001238056.1| uncharacterized protein LOC100527827 [Glycine max] gi|255633318|gb|ACU17016.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|356555759|ref|XP_003546197.1| PREDICTED: uncharacterized protein LOC100776967 [Glycine max] Back     alignment and taxonomy information
>gi|359496109|ref|XP_002273672.2| PREDICTED: uncharacterized protein LOC100257542 [Vitis vinifera] gi|297735874|emb|CBI18633.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356522075|ref|XP_003529675.1| PREDICTED: uncharacterized protein LOC100796083 [Glycine max] Back     alignment and taxonomy information
>gi|388511173|gb|AFK43648.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|356532760|ref|XP_003534939.1| PREDICTED: uncharacterized protein LOC100807490 isoform 2 [Glycine max] Back     alignment and taxonomy information
>gi|356532758|ref|XP_003534938.1| PREDICTED: uncharacterized protein LOC100807490 isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|255634642|gb|ACU17683.1| unknown [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query225
TAIR|locus:2163300290 AT5G50740 [Arabidopsis thalian 0.266 0.206 0.7 1.5e-43
TAIR|locus:2167366355 FP3 "farnesylated protein 3" [ 0.266 0.169 0.633 2.8e-41
TAIR|locus:2153969319 AT5G24580 "AT5G24580" [Arabido 0.288 0.203 0.507 3e-28
TAIR|locus:2075497246 AT3G02960 "AT3G02960" [Arabido 0.533 0.487 0.305 5.2e-28
TAIR|locus:2057951 386 AT2G36950 [Arabidopsis thalian 0.253 0.147 0.517 1.8e-27
TAIR|locus:2142614 392 AT5G03380 [Arabidopsis thalian 0.262 0.150 0.433 6.9e-26
TAIR|locus:2018768287 AT1G29000 [Arabidopsis thalian 0.688 0.540 0.273 1.1e-22
TAIR|locus:2046183245 AT2G28090 [Arabidopsis thalian 0.666 0.612 0.283 2.6e-15
TAIR|locus:2121199153 FP6 "farnesylated protein 6" [ 0.253 0.372 0.482 7.9e-14
TAIR|locus:2156927147 HIPP27 "heavy metal associated 0.253 0.387 0.413 6.8e-13
TAIR|locus:2163300 AT5G50740 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 226 (84.6 bits), Expect = 1.5e-43, Sum P(3) = 1.5e-43
 Identities = 42/60 (70%), Positives = 51/60 (85%)

Query:     1 MHCEACARKVARALKGFEGVDDITADSKASKVVVKGKTADPIKVCERLQKKSGRKVELIS 60
             MHCE CA+K+ R LKGFEGV+D+T D K SKVVVKG+ ADP+KV +RLQ+KS R+VELIS
Sbjct:    42 MHCEGCAKKIHRCLKGFEGVEDVTTDCKTSKVVVKGEKADPLKVLQRLQRKSHRQVELIS 101
GO:0005634 "nucleus" evidence=ISM
GO:0005737 "cytoplasm" evidence=ISM
GO:0005886 "plasma membrane" evidence=ISM
GO:0030001 "metal ion transport" evidence=IEA
GO:0046872 "metal ion binding" evidence=IEA;ISS
TAIR|locus:2167366 FP3 "farnesylated protein 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153969 AT5G24580 "AT5G24580" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075497 AT3G02960 "AT3G02960" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2057951 AT2G36950 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2142614 AT5G03380 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2018768 AT1G29000 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046183 AT2G28090 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2121199 FP6 "farnesylated protein 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2156927 HIPP27 "heavy metal associated isoprenylated plant protein 27" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query225
cd0037163 cd00371, HMA, Heavy-metal-associated domain (HMA) 4e-09
pfam0040362 pfam00403, HMA, Heavy-metal-associated domain 1e-06
cd0037163 cd00371, HMA, Heavy-metal-associated domain (HMA) 4e-06
PRK10671 834 PRK10671, copA, copper exporting ATPase; Provision 8e-06
pfam0040362 pfam00403, HMA, Heavy-metal-associated domain 1e-05
>gnl|CDD|238219 cd00371, HMA, Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones Back     alignment and domain information 
 Score = 51.1 bits (123), Expect = 4e-09
 Identities = 13/57 (22%), Positives = 23/57 (40%)

Query: 1  MHCEACARKVARALKGFEGVDDITADSKASKVVVKGKTADPIKVCERLQKKSGRKVE 57
          M C  C  K+ +AL+   GV+ +  D +  K  V+       +      + +G K  
Sbjct: 7  MTCAGCVSKIEKALEKLPGVESVEVDLETGKATVEYDPEVSPEELLEAIEDAGYKAR 63

HMA domain contains two cysteine residues that are important in binding and transfer of metal ions, such as copper, cadmium, cobalt and zinc. In the case of copper, stoichiometry of binding is one Cu+ ion per binding domain. Repeats of the HMA domain in copper chaperone has been associated with Menkes/Wilson disease due to binding of multiple copper ions. Length = 63
>gnl|CDD|215902 pfam00403, HMA, Heavy-metal-associated domain Back     alignment and domain information
>gnl|CDD|238219 cd00371, HMA, Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones Back     alignment and domain information
>gnl|CDD|182635 PRK10671, copA, copper exporting ATPase; Provisional Back     alignment and domain information
>gnl|CDD|215902 pfam00403, HMA, Heavy-metal-associated domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 225
KOG0207 951 consensus Cation transport ATPase [Inorganic ion t 99.38
KOG0207 951 consensus Cation transport ATPase [Inorganic ion t 99.38
PF0040362 HMA: Heavy-metal-associated domain; InterPro: IPR0 99.27
PRK10671 834 copA copper exporting ATPase; Provisional 99.22
COG260871 CopZ Copper chaperone [Inorganic ion transport and 99.08
PF0040362 HMA: Heavy-metal-associated domain; InterPro: IPR0 99.06
KOG160373 consensus Copper chaperone [Inorganic ion transpor 99.04
COG260871 CopZ Copper chaperone [Inorganic ion transport and 98.95
KOG4656 247 consensus Copper chaperone for superoxide dismutas 98.5
KOG160373 consensus Copper chaperone [Inorganic ion transpor 98.32
KOG4656247 consensus Copper chaperone for superoxide dismutas 98.06
PLN02957238 copper, zinc superoxide dismutase 98.02
PRK10671 834 copA copper exporting ATPase; Provisional 97.84
COG2217 713 ZntA Cation transport ATPase [Inorganic ion transp 97.73
PLN02957238 copper, zinc superoxide dismutase 97.4
TIGR0000368 copper ion binding protein. This model describes a 97.4
COG2217 713 ZntA Cation transport ATPase [Inorganic ion transp 97.27
TIGR0000368 copper ion binding protein. This model describes a 96.37
PRK11033 741 zntA zinc/cadmium/mercury/lead-transporting ATPase 95.86
PRK11033 741 zntA zinc/cadmium/mercury/lead-transporting ATPase 94.34
TIGR0205292 MerP mercuric transport protein periplasmic compon 91.54
PRK13748 561 putative mercuric reductase; Provisional 81.96
>KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information 
Probab=99.38  E-value=5.9e-12  Score=116.15  Aligned_cols=132  Identities=25%  Similarity=0.475  Sum_probs=116.7

Q ss_pred             CcchhhHHHHHHHhcCCCCcceEEEEccCCEEEEEec--cCCHHHHHHHHHHhcCCceeecCCCCCCCCCCCChhHHhhh
Q 027309            1 MHCEACARKVARALKGFEGVDDITADSKASKVVVKGK--TADPIKVCERLQKKSGRKVELISPLPKPPPPDADDQEKKEQ   78 (225)
Q Consensus         1 m~C~~C~~~I~~~l~~~~gv~~v~v~~~~~~~~v~~~--~~~~~~i~~~i~~~~g~~~~~~s~~~~~~~~~~~~~~~~~~   78 (225)
                      |+|.+|.+.|++.|+.++|+.++.+.+....+.+.++  ..++..+.+.++ ++||.+.+++.....             
T Consensus        78 mtC~scv~~i~~~l~~~~gv~~~~val~~~~~~v~~dp~v~s~~~~~e~ie-~~gf~a~~i~~~~~~-------------  143 (951)
T KOG0207|consen   78 MTCASCVATIERNLRKIEGVESAVVALSASKAEVIYDPAVTSPDSIAESIE-DLGFSAELIESVNGN-------------  143 (951)
T ss_pred             ceeHHHHHHHHHHhhccCCcceEEEEeeccceeEEECCcccCchhHHHHHH-hcCccceehhcccCC-------------
Confidence            8999999999999999999999999999999999997  368999999999 899999877543221             


Q ss_pred             hcccccCCCCccEEEEEEE-eeeChhHHHHHHHHhhccCCccEEEeecCCCeEEEE---eeCCHHHHHHHHHhhCCCcee
Q 027309           79 QKVEKKEEPPAAITVVLNV-RMHCEACAQGLRKRIRKIQGVECVETNLASGQVIVK---GVVDPVKLVNDVNKKTRKQAS  154 (225)
Q Consensus        79 ~~~~~~~~~~~~~~~~l~v-gm~C~~C~~~i~~~l~~~~GV~~v~v~~~~~~~~V~---g~~~~~~l~~~l~~k~G~~a~  154 (225)
                               . ..++.|.| ||.|.+|..+|+..|.+++||.+.++++.++++.|.   ....+.++.+.|. .+|+.+.
T Consensus       144 ---------~-~~~i~L~v~g~~c~s~~~~ie~~l~~l~gV~~~sv~~~t~~~~V~~~~~~~~pr~i~k~ie-~~~~~~~  212 (951)
T KOG0207|consen  144 ---------S-NQKIYLDVLGMTCASCVSKIESILERLRGVKSFSVSLATDTAIVVYDPEITGPRDIIKAIE-ETGFEAS  212 (951)
T ss_pred             ---------C-CCcEEEEeecccccchhhhhHHHHhhccCeeEEEEeccCCceEEEecccccChHHHHHHHH-hhcccce
Confidence                     1 14789999 999999999999999999999999999999999988   4578999999997 9999876


Q ss_pred             ecc
Q 027309          155 IVK  157 (225)
Q Consensus       155 ~~~  157 (225)
                      +..
T Consensus       213 ~~~  215 (951)
T KOG0207|consen  213 VRP  215 (951)
T ss_pred             eee
Confidence            544

>KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF00403 HMA: Heavy-metal-associated domain; InterPro: IPR006121 Proteins that transport heavy metals in micro-organisms and mammals share similarities in their sequences and structures Back     alignment and domain information
>PRK10671 copA copper exporting ATPase; Provisional Back     alignment and domain information
>COG2608 CopZ Copper chaperone [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF00403 HMA: Heavy-metal-associated domain; InterPro: IPR006121 Proteins that transport heavy metals in micro-organisms and mammals share similarities in their sequences and structures Back     alignment and domain information
>KOG1603 consensus Copper chaperone [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG2608 CopZ Copper chaperone [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG4656 consensus Copper chaperone for superoxide dismutase [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1603 consensus Copper chaperone [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG4656 consensus Copper chaperone for superoxide dismutase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN02957 copper, zinc superoxide dismutase Back     alignment and domain information
>PRK10671 copA copper exporting ATPase; Provisional Back     alignment and domain information
>COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN02957 copper, zinc superoxide dismutase Back     alignment and domain information
>TIGR00003 copper ion binding protein Back     alignment and domain information
>COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00003 copper ion binding protein Back     alignment and domain information
>PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional Back     alignment and domain information
>PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional Back     alignment and domain information
>TIGR02052 MerP mercuric transport protein periplasmic component Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query225
2roe_A66 Solution Structure Of Thermus Thermophilus Hb8 Ttha 3e-04
>pdb|2ROE|A Chain A, Solution Structure Of Thermus Thermophilus Hb8 Ttha1718 Protein In Vitro Length = 66 Back     alignment and structure 
Iteration: 1

 Score = 41.6 bits (96), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 30/53 (56%)
Query: 99  MHCEACAQGLRKRIRKIQGVECVETNLASGQVIVKGVVDPVKLVNDVNKKTRK 151
           M C  C   + K ++K+ GVE VE +L  G+ +V+G  DP  LV  V ++  K
Sbjct: 9   MTCNHCVMAVTKALKKVPGVEKVEVSLEKGEALVEGTADPKALVQAVEEEGYK 61

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query225
2rop_A202 Copper-transporting ATPase 2; wilson protein, mobi 2e-15
2crl_A98 Copper chaperone for superoxide dismutase; SOD1, f 3e-14
2crl_A98 Copper chaperone for superoxide dismutase; SOD1, f 7e-12
2ew9_A149 Copper-transporting ATPase 2; copper trafficking, 3e-12
2ew9_A149 Copper-transporting ATPase 2; copper trafficking, 4e-05
1qup_A222 Superoxide dismutase 1 copper chaperone; two domai 5e-11
1qup_A222 Superoxide dismutase 1 copper chaperone; two domai 7e-11
1p6t_A151 Potential copper-transporting ATPase; COPA, P-type 1e-10
1p6t_A151 Potential copper-transporting ATPase; COPA, P-type 2e-04
3iwl_A68 Copper transport protein ATOX1; beta-alpha-beta-BE 2e-09
3iwl_A68 Copper transport protein ATOX1; beta-alpha-beta-BE 2e-08
1jk9_B 249 CCS, copper chaperone for superoxide dismutase; pr 1e-08
1jk9_B249 CCS, copper chaperone for superoxide dismutase; pr 8e-08
1cc8_A73 Protein (metallochaperone ATX1); copper transport, 5e-08
1cc8_A73 Protein (metallochaperone ATX1); copper transport, 9e-07
2kkh_A95 Putative heavy metal transporter; zinc transport, 3e-07
2roe_A66 Heavy metal binding protein; NMR {Thermus thermoph 4e-07
2roe_A66 Heavy metal binding protein; NMR {Thermus thermoph 3e-04
2k2p_A85 Uncharacterized protein ATU1203; putative metal-bi 1e-06
2k2p_A85 Uncharacterized protein ATU1203; putative metal-bi 2e-04
2g9o_A90 Copper-transporting ATPase 1; menkes disease, solu 5e-06
2ofg_X111 Zinc-transporting ATPase; ferredoxin-like fold, be 5e-06
1kvi_A79 Copper-transporting ATPase 1; menkes, Cu-protein, 1e-05
1aw0_A72 Menkes copper-transporting ATPase; copper-binding 1e-05
3j09_A 723 COPA, copper-exporting P-type ATPase A; copper tra 2e-05
1q8l_A84 Copper-transporting ATPase 1; metal binding protei 3e-05
2l3m_A71 Copper-ION-binding protein; structural genomics, c 4e-05
2qif_A69 Copper chaperone COPZ; tetranuclear Cu(I) cluster; 4e-05
2qif_A69 Copper chaperone COPZ; tetranuclear Cu(I) cluster; 6e-04
1osd_A72 MERP, hypothetical protein MERP; mercury resistanc 4e-05
3cjk_B75 Copper-transporting ATPase 1; HAH1, ATP7B, menkes 5e-05
1y3j_A77 Copper-transporting ATPase 1; ferrodoxin-like fold 6e-05
2xmw_A71 PACS-N, cation-transporting ATPase PACS; hydrolase 9e-05
2ldi_A71 Zinc-transporting ATPase; metal homeostasis, metal 9e-05
2xmm_A64 SSR2857 protein, ATX1; metal transport, copper hom 2e-04
2xmm_A64 SSR2857 protein, ATX1; metal transport, copper hom 4e-04
1yg0_A66 COP associated protein; open-faced beta-sandwich, 2e-04
3dxs_X74 Copper-transporting ATPase RAN1; CXXC motif, ferre 2e-04
1cpz_A68 Protein (COPZ); copper chaperone, metal transport, 2e-04
2kt2_A69 Mercuric reductase; nmera, MERA, HMA domain, mercu 3e-04
1opz_A76 Potential copper-transporting ATPase; mutation, fo 3e-04
1yjr_A75 Copper-transporting ATPase 1; metallochaperone, pr 4e-04
>2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Length = 202 Back     alignment and structure
 Score = 70.8 bits (173), Expect = 2e-15
 Identities = 27/155 (17%), Positives = 51/155 (32%), Gaps = 9/155 (5%)

Query: 1   MHCEACARKVARALKGFEGVDDITADSKASKVVVKGK----TADPIKVCERLQKKSGRKV 56
           MHC++C   +   +    GV  I    +     VK      +   ++           KV
Sbjct: 29  MHCKSCVLNIEENIGQLLGVQSIQVSLENKTAQVKYDPSCTSPVALQRAIEALPPGNFKV 88

Query: 57  ELISPLPKPPPPDADDQEKKEQQKVEKKEEPPAAITVVLNVR-MHCEACAQGLRKRIRKI 115
            L          D             + +      T ++ +  M C +C   +   I ++
Sbjct: 89  SLPDGAE-GSGTDHRSSSSHSPGSPPRNQVQGTCSTTLIAIAGMTCASCVHSIEGMISQL 147

Query: 116 QGVECVETNLASGQVIVK---GVVDPVKLVNDVNK 147
           +GV+ +  +LA G   V     V+ P +L   +  
Sbjct: 148 EGVQQISVSLAEGTATVLYNPAVISPEELRAAIED 182
>2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 98 Back     alignment and structure
>2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 98 Back     alignment and structure
>2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} Length = 149 Back     alignment and structure
>2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} Length = 149 Back     alignment and structure
>1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Length = 222 Back     alignment and structure
>1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Length = 222 Back     alignment and structure
>1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A Length = 151 Back     alignment and structure
>1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A Length = 151 Back     alignment and structure
>3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A Length = 68 Back     alignment and structure
>3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A Length = 68 Back     alignment and structure
>1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Length = 249 Back     alignment and structure
>1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Length = 249 Back     alignment and structure
>1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A Length = 73 Back     alignment and structure
>1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A Length = 73 Back     alignment and structure
>2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana} Length = 95 Back     alignment and structure
>2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A Length = 66 Back     alignment and structure
>2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A Length = 66 Back     alignment and structure
>2k2p_A Uncharacterized protein ATU1203; putative metal-binding domain ATU1203, ontario centre for ST proteomics, structural genomics; NMR {Agrobacterium tumefaciens str} Length = 85 Back     alignment and structure
>2k2p_A Uncharacterized protein ATU1203; putative metal-binding domain ATU1203, ontario centre for ST proteomics, structural genomics; NMR {Agrobacterium tumefaciens str} Length = 85 Back     alignment and structure
>2g9o_A Copper-transporting ATPase 1; menkes disease, solution structure, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} PDB: 2ga7_A Length = 90 Back     alignment and structure
>1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A Length = 79 Back     alignment and structure
>1aw0_A Menkes copper-transporting ATPase; copper-binding domain, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 2aw0_A Length = 72 Back     alignment and structure
>3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Length = 723 Back     alignment and structure
>1q8l_A Copper-transporting ATPase 1; metal binding protein; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1s6o_A 1s6u_A Length = 84 Back     alignment and structure
>2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis} Length = 71 Back     alignment and structure
>2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A Length = 69 Back     alignment and structure
>2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A Length = 69 Back     alignment and structure
>1osd_A MERP, hypothetical protein MERP; mercury resistance, metal binding protein, perisplasm, structural genomics; 2.00A {Cupriavidus metallidurans} SCOP: d.58.17.1 PDB: 1afi_A 1afj_A 2hqi_A Length = 72 Back     alignment and structure
>3cjk_B Copper-transporting ATPase 1; HAH1, ATP7B, menkes disease, metal homeostasis, chaperone, ION transport, metal- binding, alternative splicing; 1.80A {Homo sapiens} PDB: 2k1r_A Length = 75 Back     alignment and structure
>1y3j_A Copper-transporting ATPase 1; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta structure, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1y3k_A Length = 77 Back     alignment and structure
>2xmw_A PACS-N, cation-transporting ATPase PACS; hydrolase, Cu(I)-binding, trafficking; 1.80A {Synechocystis SP} PDB: 2gcf_A Length = 71 Back     alignment and structure
>2ldi_A Zinc-transporting ATPase; metal homeostasis, metallochaperones, hydrolase; NMR {Synechocystis SP} Length = 71 Back     alignment and structure
>2xmm_A SSR2857 protein, ATX1; metal transport, copper homeostasis, chaperone, P-type atpas; 1.65A {Synechocystis SP} PDB: 2xmv_A 1sb6_A 2xmj_A 2xmk_A 2xmt_A 2xmu_A Length = 64 Back     alignment and structure
>2xmm_A SSR2857 protein, ATX1; metal transport, copper homeostasis, chaperone, P-type atpas; 1.65A {Synechocystis SP} PDB: 2xmv_A 1sb6_A 2xmj_A 2xmk_A 2xmt_A 2xmu_A Length = 64 Back     alignment and structure
>1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, Met transport; NMR {Helicobacter pylori} Length = 66 Back     alignment and structure
>3dxs_X Copper-transporting ATPase RAN1; CXXC motif, ferredoxin-like fold, ATP- binding, ethylene signaling pathway, hydrolase, ION transport; 1.70A {Arabidopsis thaliana} Length = 74 Back     alignment and structure
>1cpz_A Protein (COPZ); copper chaperone, metal transport, gene regulation; NMR {Enterococcus hirae} SCOP: d.58.17.1 Length = 68 Back     alignment and structure
>2kt2_A Mercuric reductase; nmera, MERA, HMA domain, mercuric resist metal-binding, oxidoreductase; NMR {Pseudomonas aeruginosa} PDB: 2kt3_A Length = 69 Back     alignment and structure
>1opz_A Potential copper-transporting ATPase; mutation, folding, abbab fold, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 1oq3_A 1oq6_A Length = 76 Back     alignment and structure
>1yjr_A Copper-transporting ATPase 1; metallochaperone, protein-protein interaction, copper(I), metal homeostasis, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1yjt_A 1yju_A 1yjv_A Length = 75 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query225
2ew9_A149 Copper-transporting ATPase 2; copper trafficking, 99.8
1p6t_A151 Potential copper-transporting ATPase; COPA, P-type 99.76
2rop_A202 Copper-transporting ATPase 2; wilson protein, mobi 99.72
3iwl_A68 Copper transport protein ATOX1; beta-alpha-beta-BE 99.4
4a4j_A69 Pacszia, cation-transporting ATPase PACS; hydrolas 99.29
3dxs_X74 Copper-transporting ATPase RAN1; CXXC motif, ferre 99.27
3fry_A73 Probable copper-exporting P-type ATPase A; transpo 99.2
1cc8_A73 Protein (metallochaperone ATX1); copper transport, 99.19
3iwl_A68 Copper transport protein ATOX1; beta-alpha-beta-BE 99.11
2xmm_A64 SSR2857 protein, ATX1; metal transport, copper hom 99.07
2crl_A98 Copper chaperone for superoxide dismutase; SOD1, f 99.07
2roe_A66 Heavy metal binding protein; NMR {Thermus thermoph 99.04
3dxs_X74 Copper-transporting ATPase RAN1; CXXC motif, ferre 99.03
4a4j_A69 Pacszia, cation-transporting ATPase PACS; hydrolas 99.02
2l3m_A71 Copper-ION-binding protein; structural genomics, c 99.01
2xmw_A71 PACS-N, cation-transporting ATPase PACS; hydrolase 99.01
1osd_A72 MERP, hypothetical protein MERP; mercury resistanc 98.99
2g9o_A90 Copper-transporting ATPase 1; menkes disease, solu 98.99
2k2p_A85 Uncharacterized protein ATU1203; putative metal-bi 98.98
3cjk_B75 Copper-transporting ATPase 1; HAH1, ATP7B, menkes 98.98
1aw0_A72 Menkes copper-transporting ATPase; copper-binding 98.97
1cc8_A73 Protein (metallochaperone ATX1); copper transport, 98.97
1kvi_A79 Copper-transporting ATPase 1; menkes, Cu-protein, 98.96
1mwy_A73 ZNTA; open-faced beta-sandwich fold, beta-alpha-be 98.95
1cpz_A68 Protein (COPZ); copper chaperone, metal transport, 98.95
2qif_A69 Copper chaperone COPZ; tetranuclear Cu(I) cluster; 98.94
1q8l_A84 Copper-transporting ATPase 1; metal binding protei 98.94
2kt2_A69 Mercuric reductase; nmera, MERA, HMA domain, mercu 98.94
1y3j_A77 Copper-transporting ATPase 1; ferrodoxin-like fold 98.93
1fvq_A72 Copper-transporting ATPase; APO-CCC2A, hydrolase; 98.92
3fry_A73 Probable copper-exporting P-type ATPase A; transpo 98.91
2kyz_A67 Heavy metal binding protein; structural genomics, 98.91
1opz_A76 Potential copper-transporting ATPase; mutation, fo 98.89
1yg0_A66 COP associated protein; open-faced beta-sandwich, 98.87
2ldi_A71 Zinc-transporting ATPase; metal homeostasis, metal 98.85
1yjr_A75 Copper-transporting ATPase 1; metallochaperone, pr 98.85
2crl_A98 Copper chaperone for superoxide dismutase; SOD1, f 98.84
1jww_A80 Potential copper-transporting ATPase; beta-alpha-b 98.83
2kkh_A95 Putative heavy metal transporter; zinc transport, 98.83
2ofg_X111 Zinc-transporting ATPase; ferredoxin-like fold, be 98.82
2kt2_A69 Mercuric reductase; nmera, MERA, HMA domain, mercu 98.76
1cpz_A68 Protein (COPZ); copper chaperone, metal transport, 98.76
2g9o_A90 Copper-transporting ATPase 1; menkes disease, solu 98.75
2xmw_A71 PACS-N, cation-transporting ATPase PACS; hydrolase 98.74
1aw0_A72 Menkes copper-transporting ATPase; copper-binding 98.74
1osd_A72 MERP, hypothetical protein MERP; mercury resistanc 98.74
2roe_A66 Heavy metal binding protein; NMR {Thermus thermoph 98.73
2l3m_A71 Copper-ION-binding protein; structural genomics, c 98.72
3cjk_B75 Copper-transporting ATPase 1; HAH1, ATP7B, menkes 98.72
2ofg_X111 Zinc-transporting ATPase; ferredoxin-like fold, be 98.7
2xmm_A64 SSR2857 protein, ATX1; metal transport, copper hom 98.7
1yg0_A66 COP associated protein; open-faced beta-sandwich, 98.69
1kvi_A79 Copper-transporting ATPase 1; menkes, Cu-protein, 98.68
1qup_A222 Superoxide dismutase 1 copper chaperone; two domai 98.68
1mwy_A73 ZNTA; open-faced beta-sandwich fold, beta-alpha-be 98.68
2qif_A69 Copper chaperone COPZ; tetranuclear Cu(I) cluster; 98.65
2k2p_A85 Uncharacterized protein ATU1203; putative metal-bi 98.65
1q8l_A84 Copper-transporting ATPase 1; metal binding protei 98.63
1fvq_A72 Copper-transporting ATPase; APO-CCC2A, hydrolase; 98.63
2aj0_A71 Probable cadmium-transporting ATPase; ferrodoxin-l 98.61
1y3j_A77 Copper-transporting ATPase 1; ferrodoxin-like fold 98.59
1yjr_A75 Copper-transporting ATPase 1; metallochaperone, pr 98.59
1jk9_B 249 CCS, copper chaperone for superoxide dismutase; pr 98.57
1opz_A76 Potential copper-transporting ATPase; mutation, fo 98.56
2ldi_A71 Zinc-transporting ATPase; metal homeostasis, metal 98.56
2ew9_A149 Copper-transporting ATPase 2; copper trafficking, 98.55
1p6t_A151 Potential copper-transporting ATPase; COPA, P-type 98.51
2kyz_A67 Heavy metal binding protein; structural genomics, 98.51
1jww_A80 Potential copper-transporting ATPase; beta-alpha-b 98.49
2kkh_A95 Putative heavy metal transporter; zinc transport, 98.47
1qup_A222 Superoxide dismutase 1 copper chaperone; two domai 98.43
2rop_A202 Copper-transporting ATPase 2; wilson protein, mobi 98.37
1jk9_B249 CCS, copper chaperone for superoxide dismutase; pr 98.28
3j09_A 723 COPA, copper-exporting P-type ATPase A; copper tra 98.11
2aj0_A71 Probable cadmium-transporting ATPase; ferrodoxin-l 98.08
3j09_A 723 COPA, copper-exporting P-type ATPase A; copper tra 97.81
>2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} Back     alignment and structure
Probab=99.80  E-value=2.4e-18  Score=128.96  Aligned_cols=130  Identities=19%  Similarity=0.428  Sum_probs=111.2

Q ss_pred             CcchhhHHHHHHHhcCCCCcceEEEEccCCEEEEEec--cCCHHHHHHHHHHhcCCceeecCCCCCCCCCCCChhHHhhh
Q 027309            1 MHCEACARKVARALKGFEGVDDITADSKASKVVVKGK--TADPIKVCERLQKKSGRKVELISPLPKPPPPDADDQEKKEQ   78 (225)
Q Consensus         1 m~C~~C~~~I~~~l~~~~gv~~v~v~~~~~~~~v~~~--~~~~~~i~~~i~~~~g~~~~~~s~~~~~~~~~~~~~~~~~~   78 (225)
                      |+|++|+..|++.|..++||..+.+++..+++.+.++  ..+...+...++ .+||.+.++....               
T Consensus        13 m~C~~C~~~ie~~l~~~~gv~~~~v~~~~~~~~v~~~~~~~~~~~i~~~i~-~~G~~~~~~~~~~---------------   76 (149)
T 2ew9_A           13 MTCASCVSNIERNLQKEAGVLSVLVALMAGKAEIKYDPEVIQPLEIAQFIQ-DLGFEAAVMEDYA---------------   76 (149)
T ss_dssp             CCSSSHHHHHHHHHHTTSSCCCEEEETTTTEEEEEECTTTCCHHHHHHHHH-HHTCEEEECSCSC---------------
T ss_pred             eecHHHHHHHHHHHhcCCCcEEEEEEecCCEEEEEEcCCCCCHHHHHHHHh-cCCCceEeecccc---------------
Confidence            8999999999999999999999999999999999875  256788999998 8999887543210               


Q ss_pred             hcccccCCCCccEEEEEEE-eeeChhHHHHHHHHhhccCCccEEEeecCCCeEEEEe---eCCHHHHHHHHHhhCCCcee
Q 027309           79 QKVEKKEEPPAAITVVLNV-RMHCEACAQGLRKRIRKIQGVECVETNLASGQVIVKG---VVDPVKLVNDVNKKTRKQAS  154 (225)
Q Consensus        79 ~~~~~~~~~~~~~~~~l~v-gm~C~~C~~~i~~~l~~~~GV~~v~v~~~~~~~~V~g---~~~~~~l~~~l~~k~G~~a~  154 (225)
                               .....+.|.| ||+|.+|+.+|++.|.+++||.++.+++..++++|..   .+++..|.+.|. ++||.+.
T Consensus        77 ---------~~~~~~~~~v~gm~C~~C~~~ie~~l~~~~gv~~~~v~~~~~~~~v~~~~~~~~~~~i~~~i~-~~Gy~~~  146 (149)
T 2ew9_A           77 ---------GSDGNIELTITGMTCASCVHNIESKLTRTNGITYASVALATSKALVKFDPEIIGPRDIIKIIE-EIGFHAS  146 (149)
T ss_dssp             ---------CSSSEEEEEEESCCSHHHHHHHHHHHHHSSSCCEEEEETTTTEEEEECCTTTSCHHHHHHHHH-HHTCEEE
T ss_pred             ---------cccceeEEEEEeccCHHHHHHHHHHHhcCCCeEEEEEEcCCCEEEEEECCCCCCHHHHHHHHH-hCCCceE
Confidence                     0113678999 9999999999999999999999999999999999982   357889999997 9999876


Q ss_pred             ec
Q 027309          155 IV  156 (225)
Q Consensus       155 ~~  156 (225)
                      ++
T Consensus       147 ~~  148 (149)
T 2ew9_A          147 LA  148 (149)
T ss_dssp             CC
T ss_pred             ec
Confidence            53
>1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A Back     alignment and structure
>2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Back     alignment and structure
>3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} SCOP: d.58.17.1 PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A Back     alignment and structure
>4a4j_A Pacszia, cation-transporting ATPase PACS; hydrolase, copper homeostasis, zinc homeostasis, ATX1, metal-transporting atpases; 1.25A {Synechocystis} PDB: 4a48_A 2gcf_A 2xmw_A Back     alignment and structure
>3dxs_X Copper-transporting ATPase RAN1; CXXC motif, ferredoxin-like fold, ATP- binding, ethylene signaling pathway, hydrolase, ION transport; 1.70A {Arabidopsis thaliana} SCOP: d.58.17.0 Back     alignment and structure
>3fry_A Probable copper-exporting P-type ATPase A; transport protein, metal binding domain, domain SWAP, ATP-BI cell membrane, copper transport; HET: CIT; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A Back     alignment and structure
>3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} SCOP: d.58.17.1 PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A Back     alignment and structure
>2xmm_A SSR2857 protein, ATX1; metal transport, copper homeostasis, chaperone, P-type atpas; 1.65A {Synechocystis SP} PDB: 2xmv_A 1sb6_A 2xmj_A 2xmk_A 2xmt_A 2xmu_A Back     alignment and structure
>2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A Back     alignment and structure
>3dxs_X Copper-transporting ATPase RAN1; CXXC motif, ferredoxin-like fold, ATP- binding, ethylene signaling pathway, hydrolase, ION transport; 1.70A {Arabidopsis thaliana} SCOP: d.58.17.0 Back     alignment and structure
>4a4j_A Pacszia, cation-transporting ATPase PACS; hydrolase, copper homeostasis, zinc homeostasis, ATX1, metal-transporting atpases; 1.25A {Synechocystis} PDB: 4a48_A 2gcf_A 2xmw_A Back     alignment and structure
>2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis} Back     alignment and structure
>2xmw_A PACS-N, cation-transporting ATPase PACS; hydrolase, Cu(I)-binding, trafficking; 1.80A {Synechocystis SP} PDB: 2gcf_A Back     alignment and structure
>1osd_A MERP, hypothetical protein MERP; mercury resistance, metal binding protein, perisplasm, structural genomics; 2.00A {Cupriavidus metallidurans} SCOP: d.58.17.1 PDB: 1afi_A 1afj_A 2hqi_A Back     alignment and structure
>2g9o_A Copper-transporting ATPase 1; menkes disease, solution structure, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} PDB: 2ga7_A Back     alignment and structure
>2k2p_A Uncharacterized protein ATU1203; putative metal-binding domain ATU1203, ontario centre for ST proteomics, structural genomics; NMR {Agrobacterium tumefaciens str} Back     alignment and structure
>3cjk_B Copper-transporting ATPase 1; HAH1, ATP7B, menkes disease, metal homeostasis, chaperone, ION transport, metal- binding, alternative splicing; 1.80A {Homo sapiens} PDB: 2k1r_A Back     alignment and structure
>1aw0_A Menkes copper-transporting ATPase; copper-binding domain, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 2aw0_A Back     alignment and structure
>1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A Back     alignment and structure
>1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A Back     alignment and structure
>1mwy_A ZNTA; open-faced beta-sandwich fold, beta-alpha-beta-BETA-alpha- beta, hydrolase; NMR {Escherichia coli} SCOP: d.58.17.1 PDB: 1mwz_A Back     alignment and structure
>1cpz_A Protein (COPZ); copper chaperone, metal transport, gene regulation; NMR {Enterococcus hirae} SCOP: d.58.17.1 Back     alignment and structure
>2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A Back     alignment and structure
>1q8l_A Copper-transporting ATPase 1; metal binding protein; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1s6o_A 1s6u_A Back     alignment and structure
>2kt2_A Mercuric reductase; nmera, MERA, HMA domain, mercuric resist metal-binding, oxidoreductase; NMR {Pseudomonas aeruginosa} PDB: 2kt3_A Back     alignment and structure
>1y3j_A Copper-transporting ATPase 1; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta structure, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1y3k_A Back     alignment and structure
>1fvq_A Copper-transporting ATPase; APO-CCC2A, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1fvs_A 2ggp_B Back     alignment and structure
>3fry_A Probable copper-exporting P-type ATPase A; transport protein, metal binding domain, domain SWAP, ATP-BI cell membrane, copper transport; HET: CIT; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>2kyz_A Heavy metal binding protein; structural genomics, PSI-biology, protein structure initiative, joint for structural genomics, JCSG; NMR {Thermotoga maritima} Back     alignment and structure
>1opz_A Potential copper-transporting ATPase; mutation, folding, abbab fold, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 1oq3_A 1oq6_A Back     alignment and structure
>1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, Met transport; NMR {Helicobacter pylori} Back     alignment and structure
>2ldi_A Zinc-transporting ATPase; metal homeostasis, metallochaperones, hydrolase; NMR {Synechocystis SP} Back     alignment and structure
>1yjr_A Copper-transporting ATPase 1; metallochaperone, protein-protein interaction, copper(I), metal homeostasis, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1yjt_A 1yju_A 1yjv_A Back     alignment and structure
>2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jww_A Potential copper-transporting ATPase; beta-alpha-beta-BETA-alpha-beta, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 2voy_A 1kqk_A Back     alignment and structure
>2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana} Back     alignment and structure
>2kt2_A Mercuric reductase; nmera, MERA, HMA domain, mercuric resist metal-binding, oxidoreductase; NMR {Pseudomonas aeruginosa} PDB: 2kt3_A Back     alignment and structure
>1cpz_A Protein (COPZ); copper chaperone, metal transport, gene regulation; NMR {Enterococcus hirae} SCOP: d.58.17.1 Back     alignment and structure
>2g9o_A Copper-transporting ATPase 1; menkes disease, solution structure, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} PDB: 2ga7_A Back     alignment and structure
>2xmw_A PACS-N, cation-transporting ATPase PACS; hydrolase, Cu(I)-binding, trafficking; 1.80A {Synechocystis SP} PDB: 2gcf_A Back     alignment and structure
>1aw0_A Menkes copper-transporting ATPase; copper-binding domain, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 2aw0_A Back     alignment and structure
>1osd_A MERP, hypothetical protein MERP; mercury resistance, metal binding protein, perisplasm, structural genomics; 2.00A {Cupriavidus metallidurans} SCOP: d.58.17.1 PDB: 1afi_A 1afj_A 2hqi_A Back     alignment and structure
>2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A Back     alignment and structure
>2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis} Back     alignment and structure
>3cjk_B Copper-transporting ATPase 1; HAH1, ATP7B, menkes disease, metal homeostasis, chaperone, ION transport, metal- binding, alternative splicing; 1.80A {Homo sapiens} PDB: 2k1r_A Back     alignment and structure
>2xmm_A SSR2857 protein, ATX1; metal transport, copper homeostasis, chaperone, P-type atpas; 1.65A {Synechocystis SP} PDB: 2xmv_A 1sb6_A 2xmj_A 2xmk_A 2xmt_A 2xmu_A Back     alignment and structure
>1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, Met transport; NMR {Helicobacter pylori} Back     alignment and structure
>1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A Back     alignment and structure
>1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Back     alignment and structure
>1mwy_A ZNTA; open-faced beta-sandwich fold, beta-alpha-beta-BETA-alpha- beta, hydrolase; NMR {Escherichia coli} SCOP: d.58.17.1 PDB: 1mwz_A Back     alignment and structure
>2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A Back     alignment and structure
>2k2p_A Uncharacterized protein ATU1203; putative metal-binding domain ATU1203, ontario centre for ST proteomics, structural genomics; NMR {Agrobacterium tumefaciens str} Back     alignment and structure
>1q8l_A Copper-transporting ATPase 1; metal binding protein; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1s6o_A 1s6u_A Back     alignment and structure
>1fvq_A Copper-transporting ATPase; APO-CCC2A, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1fvs_A 2ggp_B Back     alignment and structure
>2aj0_A Probable cadmium-transporting ATPase; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta, metal binding protein, hydrolase; NMR {Listeria monocytogenes} PDB: 2aj1_A Back     alignment and structure
>1y3j_A Copper-transporting ATPase 1; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta structure, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1y3k_A Back     alignment and structure
>1yjr_A Copper-transporting ATPase 1; metallochaperone, protein-protein interaction, copper(I), metal homeostasis, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1yjt_A 1yju_A 1yjv_A Back     alignment and structure
>1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Back     alignment and structure
>1opz_A Potential copper-transporting ATPase; mutation, folding, abbab fold, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 1oq3_A 1oq6_A Back     alignment and structure
>2ldi_A Zinc-transporting ATPase; metal homeostasis, metallochaperones, hydrolase; NMR {Synechocystis SP} Back     alignment and structure
>2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} Back     alignment and structure
>1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A Back     alignment and structure
>2kyz_A Heavy metal binding protein; structural genomics, PSI-biology, protein structure initiative, joint for structural genomics, JCSG; NMR {Thermotoga maritima} Back     alignment and structure
>1jww_A Potential copper-transporting ATPase; beta-alpha-beta-BETA-alpha-beta, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 2voy_A 1kqk_A Back     alignment and structure
>2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana} Back     alignment and structure
>1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Back     alignment and structure
>2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Back     alignment and structure
>1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Back     alignment and structure
>3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Back     alignment and structure
>2aj0_A Probable cadmium-transporting ATPase; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta, metal binding protein, hydrolase; NMR {Listeria monocytogenes} PDB: 2aj1_A Back     alignment and structure
>3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 225
d1qupa272 d.58.17.1 (A:2-73) Copper chaperone for superoxide 2e-10
d1qupa272 d.58.17.1 (A:2-73) Copper chaperone for superoxide 7e-07
d1fe0a_66 d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX 1e-07
d1fe0a_66 d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX 1e-06
d1cc8a_72 d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX 1e-07
d1cc8a_72 d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX 1e-04
d1osda_72 d.58.17.1 (A:) Mercuric ion binding protein MerP { 2e-07
d1osda_72 d.58.17.1 (A:) Mercuric ion binding protein MerP { 4e-05
d2ggpb172 d.58.17.1 (B:1-72) Copper transporter domain ccc2a 3e-07
d2ggpb172 d.58.17.1 (B:1-72) Copper transporter domain ccc2a 3e-05
d1sb6a_64 d.58.17.1 (A:) Copper chaperone {Synechocystis sp. 3e-07
d1sb6a_64 d.58.17.1 (A:) Copper chaperone {Synechocystis sp. 5e-05
d1kvja_79 d.58.17.1 (A:) Menkes copper-transporting ATPase { 1e-06
d1kvja_79 d.58.17.1 (A:) Menkes copper-transporting ATPase { 9e-06
d2aw0a_72 d.58.17.1 (A:) Menkes copper-transporting ATPase { 2e-06
d2aw0a_72 d.58.17.1 (A:) Menkes copper-transporting ATPase { 8e-05
d1p6ta172 d.58.17.1 (A:1-72) Potential copper-translocating 3e-06
d1p6ta172 d.58.17.1 (A:1-72) Potential copper-translocating 9e-05
d1mwza_73 d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, 4e-06
d1mwza_73 d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, 1e-05
d1cpza_68 d.58.17.1 (A:) Copper chaperone {Enterococcus hira 9e-06
d1cpza_68 d.58.17.1 (A:) Copper chaperone {Enterococcus hira 1e-04
d2qifa169 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subt 2e-05
d2qifa169 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subt 3e-04
d1q8la_84 d.58.17.1 (A:) Menkes copper-transporting ATPase { 7e-05
d1p6ta279 d.58.17.1 (A:73-151) Potential copper-translocatin 1e-04
d1p6ta279 d.58.17.1 (A:73-151) Potential copper-translocatin 3e-04
>d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: HMA, heavy metal-associated domain
family: HMA, heavy metal-associated domain
domain: Copper chaperone for superoxide dismutase, N-terminal domain
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score = 52.9 bits (127), Expect = 2e-10
 Identities = 13/65 (20%), Positives = 29/65 (44%), Gaps = 1/65 (1%)

Query: 91  ITVVLNVRMHCEACAQGLRKRIRKIQGVECVETNLASGQVIVKGVVDPVKLVNDVNKKTR 150
                 + MHCE C   ++  ++ + G+  +  ++    + V+  V P  ++N + +   
Sbjct: 6   YEATYAIPMHCENCVNDIKACLKNVPGINSLNFDIEQQIMSVESSVAPSTIINTL-RNCG 64

Query: 151 KQASI 155
           K A I
Sbjct: 65  KDAII 69
>d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 Back     information, alignment and structure
>d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} Length = 66 Back     information, alignment and structure
>d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} Length = 66 Back     information, alignment and structure
>d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 Back     information, alignment and structure
>d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 Back     information, alignment and structure
>d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} Length = 72 Back     information, alignment and structure
>d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} Length = 72 Back     information, alignment and structure
>d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 Back     information, alignment and structure
>d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 Back     information, alignment and structure
>d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} Length = 64 Back     information, alignment and structure
>d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} Length = 64 Back     information, alignment and structure
>d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Length = 72 Back     information, alignment and structure
>d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Length = 72 Back     information, alignment and structure
>d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 73 Back     information, alignment and structure
>d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 73 Back     information, alignment and structure
>d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} Length = 68 Back     information, alignment and structure
>d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} Length = 68 Back     information, alignment and structure
>d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} Length = 69 Back     information, alignment and structure
>d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} Length = 69 Back     information, alignment and structure
>d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Length = 79 Back     information, alignment and structure
>d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Length = 79 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query225
d1fe0a_66 ATX1 metallochaperone protein (ATOX1) {Human (Homo 99.55
d1qupa272 Copper chaperone for superoxide dismutase, N-termi 99.52
d1cc8a_72 ATX1 metallochaperone protein (ATOX1) {Baker's yea 99.52
d2ggpb172 Copper transporter domain ccc2a {Baker's yeast (Sa 99.49
d1cpza_68 Copper chaperone {Enterococcus hirae [TaxId: 1354] 99.45
d1sb6a_64 Copper chaperone {Synechocystis sp. pcc 6803, Scat 99.44
d2aw0a_72 Menkes copper-transporting ATPase {Human (Homo sap 99.44
d1kvja_79 Menkes copper-transporting ATPase {Human (Homo sap 99.43
d1osda_72 Mercuric ion binding protein MerP {Ralstonia metal 99.43
d2qifa169 Copper chaperone {Bacillus subtilis, CopZ [TaxId: 99.41
d1q8la_84 Menkes copper-transporting ATPase {Human (Homo sap 99.38
d1p6ta172 Potential copper-translocating P-type ATPase CopA 99.37
d1p6ta279 Potential copper-translocating P-type ATPase CopA 99.36
d1mwza_73 Metal ion-transporting ATPase ZntA, N-terminal dom 99.33
d1cpza_68 Copper chaperone {Enterococcus hirae [TaxId: 1354] 99.32
d2ggpb172 Copper transporter domain ccc2a {Baker's yeast (Sa 99.3
d1qupa272 Copper chaperone for superoxide dismutase, N-termi 99.29
d1fe0a_66 ATX1 metallochaperone protein (ATOX1) {Human (Homo 99.27
d2aw0a_72 Menkes copper-transporting ATPase {Human (Homo sap 99.25
d1osda_72 Mercuric ion binding protein MerP {Ralstonia metal 99.22
d1kvja_79 Menkes copper-transporting ATPase {Human (Homo sap 99.21
d1cc8a_72 ATX1 metallochaperone protein (ATOX1) {Baker's yea 99.2
d2qifa169 Copper chaperone {Bacillus subtilis, CopZ [TaxId: 99.19
d1sb6a_64 Copper chaperone {Synechocystis sp. pcc 6803, Scat 99.17
d1p6ta172 Potential copper-translocating P-type ATPase CopA 99.15
d1p6ta279 Potential copper-translocating P-type ATPase CopA 99.15
d1q8la_84 Menkes copper-transporting ATPase {Human (Homo sap 99.15
d1mwza_73 Metal ion-transporting ATPase ZntA, N-terminal dom 99.13
>d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: HMA, heavy metal-associated domain
family: HMA, heavy metal-associated domain
domain: ATX1 metallochaperone protein (ATOX1)
species: Human (Homo sapiens), HAH1 [TaxId: 9606]

Probab=99.55  E-value=1.2e-14  Score=92.64  Aligned_cols=64  Identities=23%  Similarity=0.400  Sum_probs=60.3

Q ss_pred             EEEEEEeeeChhHHHHHHHHhhccCCccEEEeecCCCeEEEEeeCCHHHHHHHHHhhCCCceeecc
Q 027309           92 TVVLNVRMHCEACAQGLRKRIRKIQGVECVETNLASGQVIVKGVVDPVKLVNDVNKKTRKQASIVK  157 (225)
Q Consensus        92 ~~~l~vgm~C~~C~~~i~~~l~~~~GV~~v~v~~~~~~~~V~g~~~~~~l~~~l~~k~G~~a~~~~  157 (225)
                      ++.|+|+|+|.+|+.+|+++|.+++|+ ++.+|+.+++++|.+..+++.|++.|+ ++||.|.++.
T Consensus         2 k~ef~V~M~C~~C~~~I~~aL~~~~gv-~v~v~~~~~~v~V~~~~~~~~i~~~I~-~~Gy~a~lig   65 (66)
T d1fe0a_           2 KHEFSVDMTCGGCAEAVSRVLNKLGGV-KYDIDLPNKKVCIESEHSMDTLLATLK-KTGKTVSYLG   65 (66)
T ss_dssp             EEEEEECCCSHHHHHHHHHHHHHHCSE-EEEEETTTTEEEEEESSCHHHHHHHHH-TTTSCEEEEE
T ss_pred             CEEEEEccCchHHHHHHHHHHhcCCCc-EEEEEcCCCEEEEEeeCCHHHHHHHHH-HhCCeEEEee
Confidence            478999999999999999999999998 699999999999999999999999997 9999998874
>d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} Back     information, alignment and structure
>d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} Back     information, alignment and structure
>d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} Back     information, alignment and structure
>d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} Back     information, alignment and structure
>d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} Back     information, alignment and structure
>d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} Back     information, alignment and structure
>d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} Back     information, alignment and structure
>d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} Back     information, alignment and structure
>d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} Back     information, alignment and structure
>d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure