Citrus Sinensis ID: 027329

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-----

MSFFTYFLIFFLFISLSSLTSTHGATFEIRNNCPFTVWAAAVPGGGRQLIRGQTWTINVNPGTKQARIWARTKCTFNAEGRGRCETGDCNGLLQCQAYGAPPNTLAEYTLNQFNNLDFYDISLVDGFNVPMDFSPLSGIRCRGIRCAADITGQCPNELRAPGGCNNPCTVFKTDQYCCNSGKCVPTNFSKFFKQRCPNAYSYPKDDQTSTFTCPGGTNYKVTFCP

cccHHHHHHHHHHHHHHHHcccccCEEEEEccccccEEcEECccccccccccccEEEECccccccEEEEccccccccccccccccccccccccccccccccccccEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccccccEEccccccEEEEEcc

**FFTYFLIFFLFISLSSLTSTHGATFEIRNNCPFTVWAAAVPGGGRQLIRGQTWTINVNPGTKQARIWARTKCTFNAEGRGRCETGDCNGLLQCQAYGAPPNTLAEYTLNQFNNLDFYDISLVDGFNVPMDFSPLSGIRCRGIRCAADITGQCPNELRAPGGCNNPCTVFKTDQYCCNSGKCVPTNFSKFFKQRCPNAYSYPKDDQTSTFTCPGGTNYKVTFCP

xxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

SSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Thaumatin-like protein	Has antifungal activity.	probable	P81370
Osmotin-like protein OSM34		probable	P50700
Thaumatin-like protein 1 (Fragment)		probable	G5DC91

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1AUN, chain A
Confidence level:very confident
Coverage over the Query: 24-225
View the alignment between query and template
View the model in PyMOL