Citrus Sinensis ID: 027381


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220----
MKVIQFLIGFALLALASSLASATDPGHLQDVCVAINDPKDGVFVNGKFCKDPKLARAEDFFFSGLGKPGNTANRLGVDETDANVEQIPGLNTLGISAFRIDYAPYGQRPPHIHPRASEIFLVLEGTLYVGFVTSDQLNNTLIAKVLNKGDVFVFPQGLIHFQFNIGKTNAAAYSALNSQFPGEVTIADTVFGANPSINPDFLGKAFQLDPKIVKDLQNKFINGN
ccHHHHHHHHHHHHHHHHHHHcccccccccEEEcccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccccccccCEEEEEEEcccccccccccccccEEEEEEEEEEEEEEEEccccccEEEEEEEEcccEEEEccccCEEEEEcccccEEEEEEEcccccccHHHHHHHHcccccccHHHHHHHccccHHHHHHHHHHccccc
**VIQFLIGFALLALASSLASATDPGHLQDVCVAINDPKDGVFVNGKFCKDPKLARAEDFFFSGLGKPGNTANRLGVDETDANVEQIPGLNTLGISAFRIDYAPYGQRPPHIHPRASEIFLVLEGTLYVGFVTSDQLNNTLIAKVLNKGDVFVFPQGLIHFQFNIGKTNAAAYSALNSQFPGEVTIADTVFGANPSINPDFLGKAFQLDPKIVKDLQNKFI***
xxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKVIQFLIGFALLALASSLASATDPGHLQDVCVAINDPKDGVFVNGKFCKDPKLARAEDFFFSGLGKPGNTANRLGVDETDANVEQIPGLNTLGISAFRIDYAPYGQRPPHIHPRASEIFLVLEGTLYVGFVTSDQLNNTLIAKVLNKGDVFVFPQGLIHFQFNIGKTNAAAYSALNSQFPGEVTIADTVFGANPSINPDFLGKAFQLDPKIVKDLQNKFINGN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Putative germin-like protein 2-1 May play a role in plant defense. Probably has no oxalate oxidase activity even if the active site is conserved.probableQ6K5Q0
Germin-like protein subfamily 1 member 14 May play a role in plant defense. Probably has no oxalate oxidase activity even if the active site is conserved.probableQ9FID0
Germin-like protein May be involved in seed germination.probableP45852

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1FI2, chain A
Confidence level:very confident
Coverage over the Query: 23-223
View the alignment between query and template
View the model in PyMOL