Citrus Sinensis ID: 027381

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220----

MKVIQFLIGFALLALASSLASATDPGHLQDVCVAINDPKDGVFVNGKFCKDPKLARAEDFFFSGLGKPGNTANRLGVDETDANVEQIPGLNTLGISAFRIDYAPYGQRPPHIHPRASEIFLVLEGTLYVGFVTSDQLNNTLIAKVLNKGDVFVFPQGLIHFQFNIGKTNAAAYSALNSQFPGEVTIADTVFGANPSINPDFLGKAFQLDPKIVKDLQNKFINGN

ccHHHHHHHHHHHHHHHHHHHcccccccccEEEcccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccccccccEEEEEEEEcccccccccccccccEEEEEEEEEEEEEEEEccccccEEEEEEEEcccEEEEccccEEEEEEcccccEEEEEEEcccccccHHHHHHHHcccccccHHHHHHHccccHHHHHHHHHHccccc

cHHHHHHHHHHHHHHHHHHHHHcccccHHcEEEEEcccccccccccccEccHHHccccccccccccccccccccccEEEEEEcccccHHHcccccEEEEEEEccccEEEEEEcccccEEEEEEEcEEEEEEEccHHHcccEEEEEEEcccEEEEcccccEEEEEcccccEEEEEEEcccccccEEHHHHHHHccccccHHHHHHHHcccHHHHHHHHHHccccc

MKVIQFLIGFALLALASSlasatdpghlqDVCVaindpkdgvfvngkfckdpklaraedfffsglgkpgntanrlgvdetdanveqipglntlgisafridyapygqrpphihprASEIFLVLEGTLYVGFVTSDQLNNTLIAKVlnkgdvfvfpqglihfqfnIGKTNAAAYSAlnsqfpgevtiadtvfganpsinpdflgkafqldpkiVKDLQNKFINGN

MKVIQFLIGFALLALASSLASATDPGHLQDVCVAINDPKDGVFVNGKFCKDPKLARAEDFFfsglgkpgntaNRLGVDETDANVEQIPGLNTLGISAFRIDYAPYGQRPPHIHPRASEIFLVLEGTLYVGFVTSDQLNNTLIAKVLNKGDVFVFPQGLIHFQFNIGKTNAAAYSALNSQFPGEVTIADTVFGANPSINPDFLGKAFQLDPKIVKDLQNKFINGN

MKVIQFLIGFallalasslasaTDPGHLQDVCVAINDPKDGVFVNGKFCKDPKLARAEDFFFSGLGKPGNTANRLGVDETDANVEQIPGLNTLGISAFRIDYAPYGQRPPHIHPRASEIFLVLEGTLYVGFVTSDQLNNTLIAKVLNKGDVFVFPQGLIHFQFNIGKTNAAAYSALNSQFPGEVTIADTVFGANPSINPDFLGKAFQLDPKIVKDLQNKFINGN

**VIQFLIGFALLALASSLASATDPGHLQDVCVAINDPKDGVFVNGKFCKDPKLARAEDFFFSGLGKPGNTANRLGVDETDANVEQIPGLNTLGISAFRIDYAPYGQRPPHIHPRASEIFLVLEGTLYVGFVTSDQLNNTLIAKVLNKGDVFVFPQGLIHFQFNIGKTNAAAYSALNSQFPGEVTIADTVFGANPSINPDFLGKAFQLDPKIVKDLQ*******

*KVIQFLIGFALLALASSLASATDPGHLQDVCVAINDPKDGVFVNGKFCKDPKLARAEDFFFSGLGKPGNTANRLGVDETDANVEQIPGLNTLGISAFRIDYAPYGQRPPHIHPRASEIFLVLEGTLYVGFVTSDQLNNTLIAKVLNKGDVFVFPQGLIHFQFNIGKTNAAAYSALNSQFPGEVTIADTVFGANPSINPDFLGKAFQLDPKIVKDLQNKF****

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

SSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

SSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		224	2.2.26 [Sep-21-2011]
Q9FID0		222	Germin-like protein subfa	yes	no	0.991	1.0	0.653	5e-78
Q9FIC6		221	Germin-like protein subfa	no	no	0.986	1.0	0.662	8e-78
P92997		222	Germin-like protein subfa	no	no	0.991	1.0	0.653	9e-78
Q9FIC9		221	Germin-like protein subfa	no	no	0.986	1.0	0.657	1e-77
Q9FL89		221	Germin-like protein subfa	no	no	0.986	1.0	0.657	3e-77
P92999		222	Germin-like protein subfa	no	no	0.977	0.986	0.631	2e-75
P92996		222	Germin-like protein subfa	no	no	0.977	0.986	0.631	3e-75
Q9FIC8		222	Germin-like protein subfa	no	no	0.977	0.986	0.636	5e-75
Q9SFF9		229	Germin-like protein subfa	no	no	0.964	0.943	0.633	3e-73
Q9FMB0		222	Putative germin-like prot	no	no	0.982	0.990	0.610	4e-72

>sp\|Q9FID0\|GL114_ARATH Germin-like protein subfamily 1 member 14 OS=Arabidopsis thaliana GN=At5g39110 PE=3 SV=1	Back alignment and function desciption

 Score =  290 bits (742), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 145/222 (65%), Positives = 170/222 (76%)

Query: 1   MKVIQFLIGFALLALASSLASATDPGHLQDVCVAINDPKDGVFVNGKFCKDPKLARAEDF 60
           M+  + LI   L AL  S A A DP  LQD CVAI D K+GVFVNGKFCKDPK A+AEDF
Sbjct: 1   MRFSKSLILITLSALVISFAEANDPSPLQDFCVAIGDLKNGVFVNGKFCKDPKQAKAEDF 60

Query: 61  FFSGLGKPGNTANRLGVDETDANVEQIPGLNTLGISAFRIDYAPYGQRPPHIHPRASEIF 120
           F+SGL + G T N++  + T  NV+QIPGLNTLGIS  RIDYAPYGQ PPH HPRA+EI 
Sbjct: 61  FYSGLNQAGTTNNKVKSNVTTVNVDQIPGLNTLGISLVRIDYAPYGQNPPHTHPRATEIL 120

Query: 121 LVLEGTLYVGFVTSDQLNNTLIAKVLNKGDVFVFPQGLIHFQFNIGKTNAAAYSALNSQF 180
           +++EGTLYVGFV+S+Q NN L AKVLN GDVFVFP G+IHFQ NIGKT A A++ L+SQ 
Sbjct: 121 VLVEGTLYVGFVSSNQDNNRLFAKVLNPGDVFVFPIGMIHFQVNIGKTPAVAFAGLSSQN 180

Query: 181 PGEVTIADTVFGANPSINPDFLGKAFQLDPKIVKDLQNKFIN 222
            G +TIADTVFG+ P INPD L +AFQLD  +VKDL+ KF N
Sbjct: 181 AGVITIADTVFGSTPPINPDILAQAFQLDVNVVKDLEAKFKN 222

May play a role in plant defense. Probably has no oxalate oxidase activity even if the active site is conserved.
Arabidopsis thaliana (taxid: 3702)

>sp\|Q9FIC6\|GL117_ARATH Germin-like protein subfamily 1 member 17 OS=Arabidopsis thaliana GN=At5g39150 PE=2 SV=1	Back alignment and function description

>sp\|P92997\|GL113_ARATH Germin-like protein subfamily 1 member 13 OS=Arabidopsis thaliana GN=GLP6 PE=2 SV=2	Back alignment and function description

>sp\|Q9FIC9\|GL115_ARATH Germin-like protein subfamily 1 member 15 OS=Arabidopsis thaliana GN=At5g39120 PE=2 SV=1	Back alignment and function description

>sp\|Q9FL89\|GL119_ARATH Germin-like protein subfamily 1 member 19 OS=Arabidopsis thaliana GN=At5g39180 PE=2 SV=1	Back alignment and function description

>sp\|P92999\|GL118_ARATH Germin-like protein subfamily 1 member 18 OS=Arabidopsis thaliana GN=GLP2A PE=2 SV=2	Back alignment and function description

>sp\|P92996\|GL120_ARATH Germin-like protein subfamily 1 member 20 OS=Arabidopsis thaliana GN=GLP5A PE=1 SV=1	Back alignment and function description

>sp\|Q9FIC8\|GL116_ARATH Germin-like protein subfamily 1 member 16 OS=Arabidopsis thaliana GN=At5g39130 PE=2 SV=1	Back alignment and function description

>sp\|Q9SFF9\|GL17_ARATH Germin-like protein subfamily 1 member 7 OS=Arabidopsis thaliana GN=At3g05950 PE=2 SV=1	Back alignment and function description

>sp\|Q9FMB0\|GL19_ARATH Putative germin-like protein subfamily 1 member 9 OS=Arabidopsis thaliana GN=At5g38910 PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		224
393008685		224	germin-like protein [Citrus limon]	1.0	1.0	0.946	1e-109
225450883		220	PREDICTED: germin-like protein subfamily	0.973	0.990	0.707	2e-83
359487505		221	PREDICTED: germin-like protein subfamily	0.977	0.990	0.698	3e-83
225450885		220	PREDICTED: germin-like protein subfamily	0.973	0.990	0.698	9e-83
296089653		220	unnamed protein product [Vitis vinifera]	0.973	0.990	0.689	2e-81
225450881		220	PREDICTED: germin-like protein subfamily	0.973	0.990	0.694	4e-81
119067548		220	germin-like protein 4 [Vitis vinifera]	0.968	0.986	0.688	6e-81
225450892		220	PREDICTED: germin-like protein subfamily	0.973	0.990	0.689	6e-81
225450887		225	PREDICTED: germin-like protein subfamily	0.991	0.986	0.681	8e-81
296088365		305	unnamed protein product [Vitis vinifera]	0.973	0.714	0.680	5e-80

>gi\|393008685\|gb\|AFN02126.1\| germin-like protein [Citrus limon]	Back alignment and taxonomy information

 Score =  399 bits (1026), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 212/224 (94%), Positives = 216/224 (96%)

Query: 1   MKVIQFLIGFALLALASSLASATDPGHLQDVCVAINDPKDGVFVNGKFCKDPKLARAEDF 60
           MKVIQFLIGFALLALASSLASATDPGHLQDVCVAINDPKDGVFVNGKFCKDPKLARA+ F
Sbjct: 1   MKVIQFLIGFALLALASSLASATDPGHLQDVCVAINDPKDGVFVNGKFCKDPKLARAKYF 60

Query: 61  FFSGLGKPGNTANRLGVDETDANVEQIPGLNTLGISAFRIDYAPYGQRPPHIHPRASEIF 120
           FFSGLGKPGNTANRLGV+ETDANVEQIPGLNTLGIS FRIDYAPYGQRPPHIHPRASEIF
Sbjct: 61  FFSGLGKPGNTANRLGVNETDANVEQIPGLNTLGISPFRIDYAPYGQRPPHIHPRASEIF 120

Query: 121 LVLEGTLYVGFVTSDQLNNTLIAKVLNKGDVFVFPQGLIHFQFNIGKTNAAAYSALNSQF 180
           LVLEGTLYVGFVTSDQLNNTLIAKVLNKG VFVFPQGLIHFQFNIGKTNAAAYSALN QF
Sbjct: 121 LVLEGTLYVGFVTSDQLNNTLIAKVLNKGYVFVFPQGLIHFQFNIGKTNAAAYSALNIQF 180

Query: 181 PGEVTIADTVFGANPSINPDFLGKAFQLDPKIVKDLQNKFINGN 224
           PGE T A+TVFG +PSINPDFLGKAF LDPKIVKDLQNKFINGN
Sbjct: 181 PGEFTPANTVFGTHPSINPDFLGKAFLLDPKIVKDLQNKFINGN 224

Source: Citrus limon

Species: Citrus limon

Genus: Citrus

Family: Rutaceae

Order: Sapindales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|225450883\|ref\|XP_002284334.1\| PREDICTED: germin-like protein subfamily 1 member 14 [Vitis vinifera] gi\|296088371\|emb\|CBI36816.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|359487505\|ref\|XP_002284300.2\| PREDICTED: germin-like protein subfamily 1 member 14 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|225450885\|ref\|XP_002284343.1\| PREDICTED: germin-like protein subfamily 1 member 14 [Vitis vinifera] gi\|296088370\|emb\|CBI36815.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|296089653\|emb\|CBI39472.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|225450881\|ref\|XP_002284320.1\| PREDICTED: germin-like protein subfamily 1 member 14 [Vitis vinifera] gi\|296088372\|emb\|CBI36817.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|119067548\|gb\|ABL60873.1\| germin-like protein 4 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|225450892\|ref\|XP_002284382.1\| PREDICTED: germin-like protein subfamily 1 member 13 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|225450887\|ref\|XP_002280481.1\| PREDICTED: germin-like protein subfamily 1 member 19 [Vitis vinifera] gi\|296088369\|emb\|CBI36814.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|296088365\|emb\|CBI36810.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		224
TAIR\|locus:2177187		221	AT5G39150 [Arabidopsis thalian	0.986	1.0	0.639	7.7e-71
TAIR\|locus:2177157		221	AT5G39120 [Arabidopsis thalian	0.888	0.900	0.688	9.9e-71
TAIR\|locus:2177147		222	AT5G39110 [Arabidopsis thalian	0.991	1.0	0.626	1.6e-70
TAIR\|locus:2157220		221	AT5G39180 [Arabidopsis thalian	0.986	1.0	0.635	3.3e-70
TAIR\|locus:2157200		222	AT5G39160 [Arabidopsis thalian	0.977	0.986	0.609	4.4e-68
TAIR\|locus:2157230		222	GER2 "germin-like protein 2" [	0.977	0.986	0.609	5.6e-68
TAIR\|locus:2177167		222	AT5G39130 [Arabidopsis thalian	0.977	0.986	0.613	9.2e-68
TAIR\|locus:2074514		229	AT3G05950 [Arabidopsis thalian	0.875	0.855	0.644	2e-65
TAIR\|locus:2152317		222	AT5G38910 [Arabidopsis thalian	0.973	0.981	0.591	2e-65
TAIR\|locus:2130020		222	GLP9 "germin-like protein 9" [	0.982	0.990	0.554	7.6e-64

TAIR\|locus:2177187 AT5G39150 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 717 (257.5 bits), Expect = 7.7e-71, P = 7.7e-71
 Identities = 142/222 (63%), Positives = 165/222 (74%)

Query:     1 MKVIQFLIGFXXXXXXXXXXXXTDPGHLQDVCVAINDPKDGVFVNGKFCKDPKLARAEDF 60
             MKV   LI               DP  LQD CVAI+DPK+GVFVNGKFCKDPK A+AEDF
Sbjct:     1 MKVSMSLI-LITLSALVTIAKAYDPSPLQDFCVAIDDPKNGVFVNGKFCKDPKQAKAEDF 59

Query:    61 FFSGLGKPGNTANRLGVDETDANVEQIPGLNTLGISAFRIDYAPYGQRPPHIHPRASEIF 120
             F SGL + G T N++  + T  NV+QIPGLNTLGIS  RIDYAPYGQ PPH HPRA+EI 
Sbjct:    60 FSSGLNQAGITNNKVQSNVTTVNVDQIPGLNTLGISLVRIDYAPYGQNPPHTHPRATEIL 119

Query:   121 LVLEGTLYVGFVTSDQLNNTLIAKVLNKGDVFVFPQGLIHFQFNIGKTNAAAYSALNSQF 180
             +++EGTLYVGFV+S+Q NN L AKVLN GDVFVFP G+IHFQ NIGKT A A++ L+SQ 
Sbjct:   120 VLVEGTLYVGFVSSNQDNNRLFAKVLNPGDVFVFPIGMIHFQVNIGKTPAVAFAGLSSQN 179

Query:   181 PGEVTIADTVFGANPSINPDFLGKAFQLDPKIVKDLQNKFIN 222
              G +TIADTVFG+ P INPD L +AFQLD  +VKDL+ KF N
Sbjct:   180 AGVITIADTVFGSTPPINPDILAQAFQLDVNVVKDLEAKFKN 221

GO:0005576 "extracellular region" evidence=ISM

GO:0008150 "biological_process" evidence=ND

GO:0030145 "manganese ion binding" evidence=IEA

GO:0045735 "nutrient reservoir activity" evidence=IEA

GO:0048046 "apoplast" evidence=IEA

TAIR\|locus:2177157 AT5G39120 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2177147 AT5G39110 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2157220 AT5G39180 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2157200 AT5G39160 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2157230 GER2 "germin-like protein 2" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2177167 AT5G39130 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2074514 AT3G05950 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2152317 AT5G38910 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2130020 GLP9 "germin-like protein 9" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q6K5Q0	GL21_ORYSJ	No assigned EC number	0.6113	0.9285	0.9629	yes	no
Q9FID0	GL114_ARATH	No assigned EC number	0.6531	0.9910	1.0	yes	no
P45852	GLP1_MESCR	No assigned EC number	0.5291	0.9553	0.9184	N/A	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		224
smart00835		146	smart00835, Cupin_1, Cupin	4e-32
pfam00190		139	pfam00190, Cupin_1, Cupin	8e-31
pfam07883		70	pfam07883, Cupin_2, Cupin domain	2e-07
COG1917		131	COG1917, COG1917, Uncharacterized conserved protei	1e-06
COG0662		127	COG0662, {ManC}, Mannose-6-phosphate isomerase [Ca	3e-06

>gnl\|CDD\|214845 smart00835, Cupin_1, Cupin	Back alignment and domain information

 Score =  113 bits (285), Expect = 4e-32
 Identities = 49/133 (36%), Positives = 65/133 (48%), Gaps = 3/133 (2%)

Query: 82  ANVEQIPGLNTLGISAFRIDYAPYGQRPPHIHPRASEIFLVLEGTLYVGFVTSDQLNNTL 141
           A+    P LN LGISA R++  P G  PPH HPRA+E+  V+ G   VG V  +   N +
Sbjct: 17  ADPTNFPALNGLGISAARVNLEPGGMLPPHYHPRATELLYVVRGEGRVGVVDPNG--NKV 74

Query: 142 IAKVLNKGDVFVFPQGLIHFQFNIGKTNAAAYSALNSQFPGEVTIADTVFGANPSINPDF 201
               L +GDVFV PQG  HFQ N G  N   + A N+  P               + P+ 
Sbjct: 75  YDARLREGDVFVVPQGHPHFQVNSGDEN-LEFVAFNTNDPNRRFFLAGRNSVLRGLPPEV 133

Query: 202 LGKAFQLDPKIVK 214
           L  AF +  + V+
Sbjct: 134 LAAAFGVSAEEVR 146

This family represents the conserved barrel domain of the 'cupin' superfamily ('cupa' is the Latin term for a small barrel). This family contains 11S and 7S plant seed storage proteins, and germins. Plant seed storage proteins provide the major nitrogen source for the developing plant. Length = 146

>gnl\|CDD\|215780 pfam00190, Cupin_1, Cupin	Back alignment and domain information

>gnl\|CDD\|219618 pfam07883, Cupin_2, Cupin domain	Back alignment and domain information

>gnl\|CDD\|224829 COG1917, COG1917, Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown]	Back alignment and domain information

>gnl\|CDD\|223734 COG0662, {ManC}, Mannose-6-phosphate isomerase [Carbohydrate transport and metabolism]	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		224
TIGR03404		367	bicupin_oxalic bicupin, oxalate decarboxylase fami	99.96
PLN00212		493	glutelin; Provisional	99.92
TIGR03404		367	bicupin_oxalic bicupin, oxalate decarboxylase fami	99.91
PF00190		144	Cupin_1: Cupin; InterPro: IPR006045 This family re	99.9
smart00835		146	Cupin_1 Cupin. This family represents the conserve	99.85
PLN00212		493	glutelin; Provisional	99.83
COG2140		209	Thermophilic glucose-6-phosphate isomerase and rel	99.79
PF07883		71	Cupin_2: Cupin domain; InterPro: IPR013096 This fa	99.44
COG1917		131	Uncharacterized conserved protein, contains double	99.37
COG0662		127	{ManC} Mannose-6-phosphate isomerase [Carbohydrate	99.37
PRK13290		125	ectC L-ectoine synthase; Reviewed	99.35
PRK04190		191	glucose-6-phosphate isomerase; Provisional	99.3
COG4101		142	Predicted mannose-6-phosphate isomerase [Carbohydr	99.17
COG3837		161	Uncharacterized conserved protein, contains double	99.15
TIGR01479		468	GMP_PMI mannose-1-phosphate guanylyltransferase/ma	99.09
PRK11171		266	hypothetical protein; Provisional	99.08
PRK09943		185	DNA-binding transcriptional repressor PuuR; Provis	99.06
PRK15460		478	cpsB mannose-1-phosphate guanyltransferase; Provis	99.06
PF01050		151	MannoseP_isomer: Mannose-6-phosphate isomerase; In	99.01
TIGR03214		260	ura-cupin putative allantoin catabolism protein. T	98.92
TIGR03214		260	ura-cupin putative allantoin catabolism protein. T	98.91
PRK11171		266	hypothetical protein; Provisional	98.85
PRK13264		177	3-hydroxyanthranilate 3,4-dioxygenase; Provisional	98.65
TIGR03037		159	anthran_nbaC 3-hydroxyanthranilate 3,4-dioxygenase	98.62
PF02041		167	Auxin_BP: Auxin binding protein; InterPro: IPR0005	98.62
PF06560		182	GPI: Glucose-6-phosphate isomerase (GPI); InterPro	98.62
PF11699		85	CENP-C_C: Mif2/CENP-C like; PDB: 2VPV_B.	98.55
TIGR02451		215	anti_sig_ChrR anti-sigma factor, putative, ChrR fa	98.37
PF02311		136	AraC_binding: AraC-like ligand binding domain; Int	98.36
PF03079		157	ARD: ARD/ARD' family; InterPro: IPR004313 The two	98.35
PF12973		91	Cupin_7: ChrR Cupin-like domain; PDB: 3O14_B 2Z2S_	98.34
PRK10371		302	DNA-binding transcriptional regulator MelR; Provis	98.29
PRK15457		233	ethanolamine utilization protein EutQ; Provisional	98.26
COG1791		181	Uncharacterized conserved protein, contains double	98.13
COG4297		163	Uncharacterized protein containing double-stranded	98.0
PRK10296		278	DNA-binding transcriptional regulator ChbR; Provis	97.98
PF05523		131	FdtA: WxcM-like, C-terminal ; InterPro: IPR008894	97.95
PRK13501		290	transcriptional activator RhaR; Provisional	97.94
TIGR02272		335	gentisate_1_2 gentisate 1,2-dioxygenase. This fami	97.91
PF06339		126	Ectoine_synth: Ectoine synthase; InterPro: IPR0104	97.84
TIGR02297		287	HpaA 4-hydroxyphenylacetate catabolism regulatory	97.82
PRK13500		312	transcriptional activator RhaR; Provisional	97.81
KOG2107		179	consensus Uncharacterized conserved protein, conta	97.78
COG3435		351	Gentisate 1,2-dioxygenase [Secondary metabolites b	97.76
PF05899		74	Cupin_3: Protein of unknown function (DUF861); Int	97.75
PRK13503		278	transcriptional activator RhaS; Provisional	97.72
PF06052		151	3-HAO: 3-hydroxyanthranilic acid dioxygenase; Inte	97.65
PRK13502		282	transcriptional activator RhaR; Provisional	97.62
PF14499		251	DUF4437: Domain of unknown function (DUF4437); PDB	97.61
COG3257		264	GlxB Uncharacterized protein, possibly involved in	97.58
COG1898		173	RfbC dTDP-4-dehydrorhamnose 3,5-epimerase and rela	97.34
TIGR02272		335	gentisate_1_2 gentisate 1,2-dioxygenase. This fami	97.21
PF06249		152	EutQ: Ethanolamine utilisation protein EutQ; Inter	97.2
COG4766		176	EutQ Ethanolamine utilization protein [Amino acid	97.1
PF00908		176	dTDP_sugar_isom: dTDP-4-dehydrorhamnose 3,5-epimer	96.9
TIGR01221		176	rmlC dTDP-4-dehydrorhamnose 3,5-epimerase. This en	96.84
PF05995		175	CDO_I: Cysteine dioxygenase type I; InterPro: IPR0	96.74
COG3450		116	Predicted enzyme of the cupin superfamily [General	96.71
PF04209		424	HgmA: homogentisate 1,2-dioxygenase; InterPro: IPR	96.04
COG3435		351	Gentisate 1,2-dioxygenase [Secondary metabolites b	95.94
PF07385		225	DUF1498: Protein of unknown function (DUF1498); In	95.89
PF13621		251	Cupin_8: Cupin-like domain; PDB: 3AL6_C 3AL5_C 2XU	95.68
PRK05341		438	homogentisate 1,2-dioxygenase; Provisional	95.42
TIGR01015		429	hmgA homogentisate 1,2-dioxygenase. Missing in hum	95.38
PLN02658		435	homogentisate 1,2-dioxygenase	95.3
PF08007		319	Cupin_4: Cupin superfamily protein; InterPro: IPR0	95.2
PF02678		107	Pirin: Pirin; InterPro: IPR003829 This entry repre	95.04
PF14499		251	DUF4437: Domain of unknown function (DUF4437); PDB	94.91
PF12852		186	Cupin_6: Cupin	94.46
COG3806		216	ChrR Transcriptional activator [Transcription]	94.26
PF13759		101	2OG-FeII_Oxy_5: Putative 2OG-Fe(II) oxygenase; PDB	94.02
PF02373		114	JmjC: JmjC domain, hydroxylase; InterPro: IPR01312	93.86
COG1741		276	Pirin-related protein [General function prediction	93.83
PF07847		200	DUF1637: Protein of unknown function (DUF1637); In	93.69
KOG3995		279	consensus 3-hydroxyanthranilate oxygenase HAAO [Am	93.68
PRK10572		290	DNA-binding transcriptional regulator AraC; Provis	93.41
PRK12335		287	tellurite resistance protein TehB; Provisional	92.93
PRK09685		302	DNA-binding transcriptional activator FeaR; Provis	92.64
KOG3706		629	consensus Uncharacterized conserved protein [Funct	92.54
PF05118		163	Asp_Arg_Hydrox: Aspartyl/Asparaginyl beta-hydroxyl	92.07
TIGR02466		201	conserved hypothetical protein. This family consis	91.69
COG3822		225	ABC-type sugar transport system, auxiliary compone	91.17
PRK00924		276	5-keto-4-deoxyuronate isomerase; Provisional	90.98
COG5553		191	Predicted metal-dependent enzyme of the double-str	90.79
COG3508		427	HmgA Homogentisate 1,2-dioxygenase [Secondary meta	90.54
PRK10579		94	hypothetical protein; Provisional	89.77
PF06865		94	DUF1255: Protein of unknown function (DUF1255); In	89.63
PRK15131		389	mannose-6-phosphate isomerase; Provisional	89.28
COG3257		264	GlxB Uncharacterized protein, possibly involved in	89.09
PF04962		261	KduI: KduI/IolB family; InterPro: IPR021120 The Kd	88.75
PLN02288		394	mannose-6-phosphate isomerase	88.46
KOG2757		411	consensus Mannose-6-phosphate isomerase [Carbohydr	88.19
PF09313		82	DUF1971: Domain of unknown function (DUF1971); Int	87.8
PF05726		104	Pirin_C: Pirin C-terminal cupin domain; InterPro:	87.4
TIGR00218		302	manA mannose-6-phosphate isomerase, class I. The n	87.17
PRK09391		230	fixK transcriptional regulator FixK; Provisional	86.57
PF11142		63	DUF2917: Protein of unknown function (DUF2917); In	86.46
PF14525		172	AraC_binding_2: AraC-binding-like domain	86.23
COG2850		383	Uncharacterized conserved protein [Function unknow	84.73
PRK11753		211	DNA-binding transcriptional dual regulator Crp; Pr	83.85
PF00027		91	cNMP_binding: Cyclic nucleotide-binding domain; In	81.47

>TIGR03404 bicupin_oxalic bicupin, oxalate decarboxylase family	Back alignment and domain information

Probab=99.96  E-value=1.3e-27  Score=217.82  Aligned_cols=162  Identities=17%  Similarity=0.210  Sum_probs=144.7

Q ss_pred             cccCCCCCCCCCCceeecCCCCCCccCCCCceEEEeccCCCCCcccccEEEEEEEEcCCccCCCccCCCCcEEEEEEecE
Q 027381           47 KFCKDPKLARAEDFFFSGLGKPGNTANRLGVDETDANVEQIPGLNTLGISAFRIDYAPYGQRPPHIHPRASEIFLVLEGT  126 (224)
Q Consensus        47 ~~ck~~~~v~~~df~f~~~~~~~~~~~~~g~~v~~~~~~~~P~l~~~gis~a~v~l~pgg~~~pH~Hp~a~Ei~~Vl~G~  126 (224)
                      .+-+.+..-.++.|+|++...++..  ..|++++.+++.+||+++  ++++++++++||++.++|||++++|++||++|+
T Consensus       201 ~~~~~~~~~~~~~~~~~~~~~~p~~--~~gG~~~~~~~~~~p~~~--~~s~~~~~l~PG~~~~~H~H~~~~E~~yvl~G~  276 (367)
T TIGR03404       201 EAVTGPAGEVPGPFTYHLSEQKPKQ--VPGGTVRIADSTNFPVSK--TIAAAIVTVEPGAMRELHWHPNADEWQYFIQGQ  276 (367)
T ss_pred             ccCcCCCCCCCccEEEEhhhCCcee--cCCceEEEEChhhccCcc--eEEEEEEEECCCCccCCeeCcCCCeEEEEEEEE
Confidence            3445566666778999998887743  567889999999999988  489999999999999999999999999999999


Q ss_pred             EEEEEEecCCCCCeEEEEEeCCCCEEEECCCCeeEEEecCCCcEEEEEEecCCCCcceechhhhhcCCCCCCHHHHHhhc
Q 027381          127 LYVGFVTSDQLNNTLIAKVLNKGDVFVFPQGLIHFQFNIGKTNAAAYSALNSQFPGEVTIADTVFGANPSINPDFLGKAF  206 (224)
Q Consensus       127 ~~v~~~~~~~~g~~~~~~~L~~GDv~~~P~G~~H~~~N~g~~~a~~i~~~~s~~pg~~~~~~~lf~~~p~~~~~vla~~f  206 (224)
                      +++++.+++   ++..++.+++||+++||+|..|+++|.|+++++++++|++..++.+.+++|+..    +|++||+++|
T Consensus       277 ~~~~v~d~~---g~~~~~~l~~GD~~~iP~g~~H~i~N~G~e~l~fL~if~s~~~~~i~l~~~l~~----~p~~vl~~~~  349 (367)
T TIGR03404       277 ARMTVFAAG---GNARTFDYQAGDVGYVPRNMGHYVENTGDETLVFLEVFKADRFADVSLNQWLAL----TPPQLVAAHL  349 (367)
T ss_pred             EEEEEEecC---CcEEEEEECCCCEEEECCCCeEEEEECCCCCEEEEEEECCCCCceeEHHHHHhh----CCHHHHHHHh
Confidence            999998765   344468999999999999999999999999999999999999999999999743    9999999999


Q ss_pred             CCCHHHHHHHhhh
Q 027381          207 QLDPKIVKDLQNK  219 (224)
Q Consensus       207 ~~d~~~v~~l~~~  219 (224)
                      +++++++++|++.
T Consensus       350 ~~~~~~~~~l~~~  362 (367)
T TIGR03404       350 NLDDEVIDSLKKE  362 (367)
T ss_pred             CcCHHHHHhcccc
Confidence            9999999999975

Members of this protein family are defined as bicupins as they have two copies of the cupin domain (pfam00190). Two different known activities for members of this family are oxalate decarboxylase (EC 4.1.1.2) and oxalate oxidase (EC 1.2.3.4), although the latter activity has more often been found in distantly related monocupin (germin) proteins.

>PLN00212 glutelin; Provisional	Back alignment and domain information

>TIGR03404 bicupin_oxalic bicupin, oxalate decarboxylase family	Back alignment and domain information

>PF00190 Cupin_1: Cupin; InterPro: IPR006045 This family represents the conserved barrel domain of the 'cupin' superfamily ('cupa' is the Latin term for a small barrel)	Back alignment and domain information

>smart00835 Cupin_1 Cupin	Back alignment and domain information

>PLN00212 glutelin; Provisional	Back alignment and domain information

>COG2140 Thermophilic glucose-6-phosphate isomerase and related metalloenzymes [Carbohydrate transport and metabolism / General function prediction only]	Back alignment and domain information

>PF07883 Cupin_2: Cupin domain; InterPro: IPR013096 This family represents the conserved barrel domain of the cupin superfamily [] (cupa is the Latin term for a small barrel)	Back alignment and domain information

>COG1917 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown]	Back alignment and domain information

>COG0662 {ManC} Mannose-6-phosphate isomerase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK13290 ectC L-ectoine synthase; Reviewed	Back alignment and domain information

>PRK04190 glucose-6-phosphate isomerase; Provisional	Back alignment and domain information

>COG4101 Predicted mannose-6-phosphate isomerase [Carbohydrate transport and metabolism]	Back alignment and domain information

>COG3837 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown]	Back alignment and domain information

>TIGR01479 GMP_PMI mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase	Back alignment and domain information

>PRK11171 hypothetical protein; Provisional	Back alignment and domain information

>PRK09943 DNA-binding transcriptional repressor PuuR; Provisional	Back alignment and domain information

>PRK15460 cpsB mannose-1-phosphate guanyltransferase; Provisional	Back alignment and domain information

>PF01050 MannoseP_isomer: Mannose-6-phosphate isomerase; InterPro: IPR001538 Mannose-6-phosphate isomerase or phosphomannose isomerase (5	Back alignment and domain information

>TIGR03214 ura-cupin putative allantoin catabolism protein	Back alignment and domain information

>TIGR03214 ura-cupin putative allantoin catabolism protein	Back alignment and domain information

>PRK11171 hypothetical protein; Provisional	Back alignment and domain information

>PRK13264 3-hydroxyanthranilate 3,4-dioxygenase; Provisional	Back alignment and domain information

>TIGR03037 anthran_nbaC 3-hydroxyanthranilate 3,4-dioxygenase	Back alignment and domain information

>PF02041 Auxin_BP: Auxin binding protein; InterPro: IPR000526 Auxin binding protein is located in the lumen of the endoplasmic reticulum (ER)	Back alignment and domain information

>PF06560 GPI: Glucose-6-phosphate isomerase (GPI); InterPro: IPR010551 This entry consists of several bacterial and archaeal glucose-6-phosphate isomerase (GPI) proteins (5	Back alignment and domain information

>PF11699 CENP-C_C: Mif2/CENP-C like; PDB: 2VPV_B	Back alignment and domain information

>TIGR02451 anti_sig_ChrR anti-sigma factor, putative, ChrR family	Back alignment and domain information

>PF02311 AraC_binding: AraC-like ligand binding domain; InterPro: IPR003313 This entry defines the arabinose-binding and dimerisation domain of the bacterial gene regulatory protein AraC	Back alignment and domain information

>PF03079 ARD: ARD/ARD' family; InterPro: IPR004313 The two acireductone dioxygenase enzymes (ARD and ARD', previously known as E-2 and E-2') from Klebsiella pneumoniae share the same amino acid sequence Q9ZFE7 from SWISSPROT, but bind different metal ions: ARD binds Ni2+, ARD' binds Fe2+ []	Back alignment and domain information

>PF12973 Cupin_7: ChrR Cupin-like domain; PDB: 3O14_B 2Z2S_F 2Q1Z_B 3EBR_A	Back alignment and domain information

>PRK10371 DNA-binding transcriptional regulator MelR; Provisional	Back alignment and domain information

>PRK15457 ethanolamine utilization protein EutQ; Provisional	Back alignment and domain information

>COG1791 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown]	Back alignment and domain information

>COG4297 Uncharacterized protein containing double-stranded beta helix domain [Function unknown]	Back alignment and domain information

>PRK10296 DNA-binding transcriptional regulator ChbR; Provisional	Back alignment and domain information

>PF05523 FdtA: WxcM-like, C-terminal ; InterPro: IPR008894 This entry includes FdtA (Q6T1W8 from SWISSPROT) from Aneurinibacillus thermoaerophilus, which has been characterised as a dTDP-6-deoxy-3,4-keto-hexulose isomerase []	Back alignment and domain information

>PRK13501 transcriptional activator RhaR; Provisional	Back alignment and domain information

>TIGR02272 gentisate_1_2 gentisate 1,2-dioxygenase	Back alignment and domain information

>PF06339 Ectoine_synth: Ectoine synthase; InterPro: IPR010462 This family consists of several bacterial ectoine synthase proteins	Back alignment and domain information

>TIGR02297 HpaA 4-hydroxyphenylacetate catabolism regulatory protein HpaA	Back alignment and domain information

>PRK13500 transcriptional activator RhaR; Provisional	Back alignment and domain information

>KOG2107 consensus Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown]	Back alignment and domain information

>COG3435 Gentisate 1,2-dioxygenase [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>PF05899 Cupin_3: Protein of unknown function (DUF861); InterPro: IPR008579 The function of the proteins in this entry are unknown	Back alignment and domain information

>PRK13503 transcriptional activator RhaS; Provisional	Back alignment and domain information

>PF06052 3-HAO: 3-hydroxyanthranilic acid dioxygenase; InterPro: IPR010329 Members of this protein family, from both bacteria and eukaryotes, are the enzyme 3-hydroxyanthranilate 3,4-dioxygenase (1	Back alignment and domain information

>PRK13502 transcriptional activator RhaR; Provisional	Back alignment and domain information

>PF14499 DUF4437: Domain of unknown function (DUF4437); PDB: 2QDR_A	Back alignment and domain information

>COG3257 GlxB Uncharacterized protein, possibly involved in glyoxylate utilization [General function prediction only]	Back alignment and domain information

>COG1898 RfbC dTDP-4-dehydrorhamnose 3,5-epimerase and related enzymes [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>TIGR02272 gentisate_1_2 gentisate 1,2-dioxygenase	Back alignment and domain information

>PF06249 EutQ: Ethanolamine utilisation protein EutQ; InterPro: IPR010424 The eut operon of Salmonella typhimurium encodes proteins involved in the cobalamin-dependent degradation of ethanolamine	Back alignment and domain information

>COG4766 EutQ Ethanolamine utilization protein [Amino acid transport and metabolism]	Back alignment and domain information

>PF00908 dTDP_sugar_isom: dTDP-4-dehydrorhamnose 3,5-epimerase; InterPro: IPR000888 Deoxythymidine diphosphate (dTDP)-4-keto-6-deoxy-d-hexulose 3, 5-epimerase (RmlC, 5	Back alignment and domain information

>TIGR01221 rmlC dTDP-4-dehydrorhamnose 3,5-epimerase	Back alignment and domain information

>PF05995 CDO_I: Cysteine dioxygenase type I; InterPro: IPR010300 Cysteine dioxygenase type I (1	Back alignment and domain information

>COG3450 Predicted enzyme of the cupin superfamily [General function prediction only]	Back alignment and domain information

>PF04209 HgmA: homogentisate 1,2-dioxygenase; InterPro: IPR005708 Alkaptonuria (AKU), a rare hereditary disorder, was the first disease to be interpreted as an inborn error of metabolism	Back alignment and domain information

>COG3435 Gentisate 1,2-dioxygenase [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>PF07385 DUF1498: Protein of unknown function (DUF1498); InterPro: IPR010864 This family consists of several hypothetical bacterial proteins of around 225 residues in length	Back alignment and domain information

>PF13621 Cupin_8: Cupin-like domain; PDB: 3AL6_C 3AL5_C 2XUM_A 2Y0I_A 1MZE_A 3KCY_A 1MZF_A 1YCI_A 2ILM_A 1H2L_A	Back alignment and domain information

>PRK05341 homogentisate 1,2-dioxygenase; Provisional	Back alignment and domain information

>TIGR01015 hmgA homogentisate 1,2-dioxygenase	Back alignment and domain information

>PLN02658 homogentisate 1,2-dioxygenase	Back alignment and domain information

>PF08007 Cupin_4: Cupin superfamily protein; InterPro: IPR022777 This signature represents primarily the cupin fold found in JmjC transcription factors	Back alignment and domain information

>PF02678 Pirin: Pirin; InterPro: IPR003829 This entry represents N-terminal domain of Pirin proteins from both eukaryotes and prokaryotes	Back alignment and domain information

>PF14499 DUF4437: Domain of unknown function (DUF4437); PDB: 2QDR_A	Back alignment and domain information

>PF12852 Cupin_6: Cupin	Back alignment and domain information

>COG3806 ChrR Transcriptional activator [Transcription]	Back alignment and domain information

>PF13759 2OG-FeII_Oxy_5: Putative 2OG-Fe(II) oxygenase; PDB: 3BVC_B 2RG4_A	Back alignment and domain information

>PF02373 JmjC: JmjC domain, hydroxylase; InterPro: IPR013129 Jumonji protein is required for neural tube formation in mice []	Back alignment and domain information

>COG1741 Pirin-related protein [General function prediction only]	Back alignment and domain information

>PF07847 DUF1637: Protein of unknown function (DUF1637); InterPro: IPR012864 This entry represents cysteamine dioxygenase, which is a non-heme iron protein that is involved in the biosynthesis of taurine	Back alignment and domain information

>KOG3995 consensus 3-hydroxyanthranilate oxygenase HAAO [Amino acid transport and metabolism]	Back alignment and domain information

>PRK10572 DNA-binding transcriptional regulator AraC; Provisional	Back alignment and domain information

>PRK12335 tellurite resistance protein TehB; Provisional	Back alignment and domain information

>PRK09685 DNA-binding transcriptional activator FeaR; Provisional	Back alignment and domain information

>KOG3706 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF05118 Asp_Arg_Hydrox: Aspartyl/Asparaginyl beta-hydroxylase; InterPro: IPR007803 The alpha-ketoglutarate-dependent dioxygenase aspartyl (asparaginyl) beta-hydroxylase (1	Back alignment and domain information

>TIGR02466 conserved hypothetical protein	Back alignment and domain information

>COG3822 ABC-type sugar transport system, auxiliary component [General function prediction only]	Back alignment and domain information

>PRK00924 5-keto-4-deoxyuronate isomerase; Provisional	Back alignment and domain information

>COG5553 Predicted metal-dependent enzyme of the double-stranded beta helix superfamily [General function prediction only]	Back alignment and domain information

>COG3508 HmgA Homogentisate 1,2-dioxygenase [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>PRK10579 hypothetical protein; Provisional	Back alignment and domain information

>PF06865 DUF1255: Protein of unknown function (DUF1255); InterPro: IPR009664 This family consists of several conserved hypothetical bacterial proteins of around 95 residues in length	Back alignment and domain information

>PRK15131 mannose-6-phosphate isomerase; Provisional	Back alignment and domain information

>COG3257 GlxB Uncharacterized protein, possibly involved in glyoxylate utilization [General function prediction only]	Back alignment and domain information

>PF04962 KduI: KduI/IolB family; InterPro: IPR021120 The KduI/IolB family of enzymes includes 5-keto 4-deoxyuronate isomerase (KduI) and 5-deoxy-glucuronate isomerase (IolB)	Back alignment and domain information

>PLN02288 mannose-6-phosphate isomerase	Back alignment and domain information

>KOG2757 consensus Mannose-6-phosphate isomerase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PF09313 DUF1971: Domain of unknown function (DUF1971); InterPro: IPR015392 This uncharacterised domain is predominantly found in bacterial Tellurite resistance proteins	Back alignment and domain information

>PF05726 Pirin_C: Pirin C-terminal cupin domain; InterPro: IPR008778 This entry represents C-terminal domain of Pirin proteins from both eukaryotes and prokaryotes	Back alignment and domain information

>TIGR00218 manA mannose-6-phosphate isomerase, class I	Back alignment and domain information

>PRK09391 fixK transcriptional regulator FixK; Provisional	Back alignment and domain information

>PF11142 DUF2917: Protein of unknown function (DUF2917); InterPro: IPR021317 This bacterial family of proteins appears to be restricted to Proteobacteria	Back alignment and domain information

>PF14525 AraC_binding_2: AraC-binding-like domain	Back alignment and domain information

>COG2850 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PRK11753 DNA-binding transcriptional dual regulator Crp; Provisional	Back alignment and domain information

>PF00027 cNMP_binding: Cyclic nucleotide-binding domain; InterPro: IPR000595 Proteins that bind cyclic nucleotides (cAMP or cGMP) share a structural domain of about 120 residues [, , ]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		224
1fi2_A		201	Crystal Structure Of Germin (Oxalate Oxidase) Lengt		6e-43
2et7_A		201	Structural And Spectroscopic Insights Into The Mech		9e-43
2ete_A		201	Recombinant Oxalate Oxidase In Complex With Glycola		2e-42

>pdb|1FI2|A Chain A, Crystal Structure Of Germin (Oxalate Oxidase) Length = 201

Back alignment and structure

Iteration: 1

Score = 170 bits (430), Expect = 6e-43, Method: Compositional matrix adjust. Identities = 95/203 (46%), Positives = 128/203 (63%), Gaps = 3/203 (1%) Query: 23 TDPGHLQDVCVAINDPKDGVFVNGKFCKDPKLARAEDFFFSG-LGKPGNTANRLGVDETD 81 TDP LQD CVA D K V VNG CK P +DF FS L K GNT+ G T+ Sbjct: 1 TDPDPLQDFCVADLDGK-AVSVNGHTCK-PMSEAGDDFLFSSKLTKAGNTSTPNGSAVTE 58 Query: 82 ANVEQIPGLNTLGISAFRIDYAPYGQRPPHIHPRASEIFLVLEGTLYVGFVTSDQLNNTL 141 +V + PG NTLG+S R+D+AP G PPHIHPRA+EI +V++G L VG + S N L Sbjct: 59 LDVAEWPGTNTLGVSMNRVDFAPGGTNPPHIHPRATEIGMVMKGELLVGILGSLDSGNKL 118 Query: 142 IAKVLNKGDVFVFPQGLIHFQFNIGKTNAAAYSALNSQFPGEVTIADTVFGANPSINPDF 201 ++V+ G+ FV P+GL+HFQFN+GKT A + NSQ PG V + T+FG++P I Sbjct: 119 YSRVVRAGETFVIPRGLMHFQFNVGKTEAYMVVSFNSQNPGIVFVPLTLFGSDPPIPTPV 178 Query: 202 LGKAFQLDPKIVKDLQNKFINGN 224 L KA +++ +V+ L++KF G+ Sbjct: 179 LTKALRVEAGVVELLKSKFAGGS 201

PyMOL of 1fi2

>pdb|2ET7|A Chain A, Structural And Spectroscopic Insights Into The Mechanism Of Oxalate Oxidase Length = 201

Back alignment and structure

>pdb|2ETE|A Chain A, Recombinant Oxalate Oxidase In Complex With Glycolate Length = 201

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		224
1fi2_A		201	Oxalate oxidase, germin; beta-jellyroll, oxidoredu	6e-68
2d5f_A		493	Glycinin A3B4 subunit; soybean, globulin, 11S,SEED	1e-39
2d5f_A		493	Glycinin A3B4 subunit; soybean, globulin, 11S,SEED	3e-07
1fxz_A		476	Glycinin G1; proglycinin, legumin, SEED storage pr	8e-38
1fxz_A		476	Glycinin G1; proglycinin, legumin, SEED storage pr	2e-05
3c3v_A		510	Arachin ARAH3 isoform; peanut allergen, allergy, g	5e-36
2vqa_A		361	SLL1358 protein, MNCA; periplasmic binding protein	1e-35
2vqa_A		361	SLL1358 protein, MNCA; periplasmic binding protein	2e-30
2ea7_A		434	7S globulin-1; beta barrel, cupin superfamily, pla	2e-34
2ea7_A		434	7S globulin-1; beta barrel, cupin superfamily, pla	5e-13
1uij_A		416	Beta subunit of beta conglycinin; double-stranded	5e-34
1uij_A		416	Beta subunit of beta conglycinin; double-stranded	4e-12
2cav_A		445	Protein (canavalin); vicilin, 7S SEED protein, dom	8e-33
2cav_A		445	Protein (canavalin); vicilin, 7S SEED protein, dom	3e-13
2e9q_A		459	11S globulin subunit beta; cucubitin, pumpkin SEED	3e-29
2e9q_A		459	11S globulin subunit beta; cucubitin, pumpkin SEED	1e-05
3qac_A		465	11S globulin SEED storage protein; 11S SEED storag	9e-29
3ksc_A		496	LEGA class, prolegumin; PEA prolegumin, 11S SEED s	5e-28
1j58_A		385	YVRK protein; cupin, decarboxyklase, oxalate, mang	4e-27
1j58_A		385	YVRK protein; cupin, decarboxyklase, oxalate, mang	4e-21
3kgl_A		466	Cruciferin; 11S SEED globulin, rapeseed, SEED stor	6e-27
1dgw_A		178	Canavalin; duplicated swiss-roll beta barrels, loo	1e-17
1lr5_A		163	Auxin binding protein 1; beta jellyroll, double st	1e-15
2phl_A		397	Phaseolin; plant SEED storage protein(vicilin); HE	1e-15
2phl_A		397	Phaseolin; plant SEED storage protein(vicilin); HE	4e-07
3s7i_A		418	Allergen ARA H 1, clone P41B; bicupin, vicilin, st	2e-15
3s7i_A		418	Allergen ARA H 1, clone P41B; bicupin, vicilin, st	5e-14
1v70_A		105	Probable antibiotics synthesis protein; structural	2e-08
1y3t_A		337	Hypothetical protein YXAG; BI cupin, dioxygenase,	2e-08
1y3t_A		337	Hypothetical protein YXAG; BI cupin, dioxygenase,	3e-07
3fz3_A		531	Prunin; TREE NUT allergen, allergy, amandin, almon	5e-08
3d82_A		102	Cupin 2, conserved barrel domain protein; structur	1e-07
1o4t_A		133	Putative oxalate decarboxylase; double-stranded be	2e-07
3ht1_A		145	REMF protein; cupin fold, Zn-binding, antibiotic b	4e-07
1juh_A		350	Quercetin 2,3-dioxygenase; cupin, glycoprotein, be	5e-07
1juh_A		350	Quercetin 2,3-dioxygenase; cupin, glycoprotein, be	5e-05
2i45_A		107	Hypothetical protein; neisseria meningitidis cupin	6e-07
2gu9_A		113	Tetracenomycin polyketide synthesis protein; X-RAY	1e-06
1vj2_A		126	Novel manganese-containing cupin TM1459; structura	3e-06
3cew_A		125	Uncharacterized cupin protein; all beta-protein, j	5e-06
3ibm_A		167	Cupin 2, conserved barrel domain protein; cupin 2	6e-06
2d40_A		354	Z3393, putative gentisate 1,2-dioxygenase; gentisi	6e-06
3h8u_A		125	Uncharacterized conserved protein with double-STR	1e-05
1x82_A		190	Glucose-6-phosphate isomerase; cupin superfamily,	3e-05
3nw4_A		368	Gentisate 1,2-dioxygenase; beta-barrel, oxidoreduc	4e-05
3bu7_A		394	Gentisate 1,2-dioxygenase; cupin domain, oxidoredu	1e-04
3bu7_A		394	Gentisate 1,2-dioxygenase; cupin domain, oxidoredu	3e-04
4e2g_A		126	Cupin 2 conserved barrel domain protein; MCSG, PSI	1e-04
3i7d_A		163	Sugar phosphate isomerase; YP_168127.1, structural	2e-04
1y9q_A		192	Transcriptional regulator, HTH_3 family; transcrip	5e-04
3es1_A		172	Cupin 2, conserved barrel domain protein; YP_00116	8e-04

>1fi2_A Oxalate oxidase, germin; beta-jellyroll, oxidoreductase; 1.60A {Hordeum vulgare} SCOP: b.82.1.2 PDB: 2et1_A 2ete_A* 2et7_A Length = 201	Back alignment and structure

 Score =  206 bits (525), Expect = 6e-68
 Identities = 91/202 (45%), Positives = 125/202 (61%), Gaps = 1/202 (0%)

Query: 23  TDPGHLQDVCVAINDPKDGVFVNGKFCKDPKLARAEDFFFSGLGKPGNTANRLGVDETDA 82
           TDP  LQD CVA +     V VNG  CK    A  +  F S L K GNT+   G   T+ 
Sbjct: 1   TDPDPLQDFCVA-DLDGKAVSVNGHTCKPMSEAGDDFLFSSKLTKAGNTSTPNGSAVTEL 59

Query: 83  NVEQIPGLNTLGISAFRIDYAPYGQRPPHIHPRASEIFLVLEGTLYVGFVTSDQLNNTLI 142
           +V + PG NTLG+S  R+D+AP G  PPHIHPRA+EI +V++G L VG + S    N L 
Sbjct: 60  DVAEWPGTNTLGVSMNRVDFAPGGTNPPHIHPRATEIGMVMKGELLVGILGSLDSGNKLY 119

Query: 143 AKVLNKGDVFVFPQGLIHFQFNIGKTNAAAYSALNSQFPGEVTIADTVFGANPSINPDFL 202
           ++V+  G+ FV P+GL+HFQFN+GKT A    + NSQ PG V +  T+FG++P I    L
Sbjct: 120 SRVVRAGETFVIPRGLMHFQFNVGKTEAYMVVSFNSQNPGIVFVPLTLFGSDPPIPTPVL 179

Query: 203 GKAFQLDPKIVKDLQNKFINGN 224
            KA +++  +V+ L++KF  G+
Sbjct: 180 TKALRVEAGVVELLKSKFAGGS 201

PyMOL of 1fi2

>2d5f_A Glycinin A3B4 subunit; soybean, globulin, 11S,SEED storage protein, plant; 1.90A {Glycine max} PDB: 2d5h_A 1od5_A Length = 493	Back alignment and structure

>1fxz_A Glycinin G1; proglycinin, legumin, SEED storage protein, plant protein; 2.80A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ud1_A 1ucx_A Length = 476	Back alignment and structure

>1fxz_A Glycinin G1; proglycinin, legumin, SEED storage protein, plant protein; 2.80A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ud1_A 1ucx_A Length = 476	Back alignment and structure

>3c3v_A Arachin ARAH3 isoform; peanut allergen, allergy, glycinin; 1.73A {Arachis hypogaea} Length = 510	Back alignment and structure

>2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP} Length = 361	Back alignment and structure

>2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP} Length = 361	Back alignment and structure

>2ea7_A 7S globulin-1; beta barrel, cupin superfamily, plant protein; 1.80A {Vigna angularis} PDB: 2eaa_A* 2cv6_A 1uik_A Length = 434	Back alignment and structure

>2ea7_A 7S globulin-1; beta barrel, cupin superfamily, plant protein; 1.80A {Vigna angularis} PDB: 2eaa_A* 2cv6_A 1uik_A Length = 434	Back alignment and structure

>1uij_A Beta subunit of beta conglycinin; double-stranded beta helix, SEED storage protein, sugar binding protein; 2.50A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ipk_A 1ipj_A* Length = 416	Back alignment and structure

>1uij_A Beta subunit of beta conglycinin; double-stranded beta helix, SEED storage protein, sugar binding protein; 2.50A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ipk_A 1ipj_A* Length = 416	Back alignment and structure

>2cav_A Protein (canavalin); vicilin, 7S SEED protein, domain duplication, swiss roll, PL protein; 2.00A {Canavalia ensiformis} SCOP: b.82.1.2 b.82.1.2 PDB: 2cau_A 1cau_B 1cav_B 1caw_B 1cax_B Length = 445	Back alignment and structure

>2cav_A Protein (canavalin); vicilin, 7S SEED protein, domain duplication, swiss roll, PL protein; 2.00A {Canavalia ensiformis} SCOP: b.82.1.2 b.82.1.2 PDB: 2cau_A 1cau_B 1cav_B 1caw_B 1cax_B Length = 445	Back alignment and structure

>2e9q_A 11S globulin subunit beta; cucubitin, pumpkin SEED storage globulin, plant protein; 2.20A {Cucurbita maxima} PDB: 2evx_A Length = 459	Back alignment and structure

>2e9q_A 11S globulin subunit beta; cucubitin, pumpkin SEED storage globulin, plant protein; 2.20A {Cucurbita maxima} PDB: 2evx_A Length = 459	Back alignment and structure

>3qac_A 11S globulin SEED storage protein; 11S SEED storage protein (globulins) family, SEED storage PR plant protein; 2.27A {Amaranthus hypochondriacus} Length = 465	Back alignment and structure

>3ksc_A LEGA class, prolegumin; PEA prolegumin, 11S SEED storage protein, pisum sativum L., SEED storage protein, storage protein, plant protein; 2.61A {Pisum sativum} Length = 496	Back alignment and structure

>1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A Length = 385	Back alignment and structure

>1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A Length = 385	Back alignment and structure

>3kgl_A Cruciferin; 11S SEED globulin, rapeseed, SEED storage protein, storage protein, plant protein; 2.98A {Brassica napus} Length = 466	Back alignment and structure

>1dgw_A Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_A 1cau_A 1cav_A 1caw_A 1cax_A Length = 178	Back alignment and structure

>1lr5_A Auxin binding protein 1; beta jellyroll, double stranded beta helix, germin-like PROT protein binding; HET: NAG BMA MAN; 1.90A {Zea mays} SCOP: b.82.1.2 PDB: 1lrh_A* Length = 163	Back alignment and structure

>2phl_A Phaseolin; plant SEED storage protein(vicilin); HET: NAG; 2.20A {Phaseolus vulgaris} SCOP: b.82.1.2 b.82.1.2 PDB: 1phs_A* Length = 397	Back alignment and structure

>2phl_A Phaseolin; plant SEED storage protein(vicilin); HET: NAG; 2.20A {Phaseolus vulgaris} SCOP: b.82.1.2 b.82.1.2 PDB: 1phs_A* Length = 397	Back alignment and structure

>3s7i_A Allergen ARA H 1, clone P41B; bicupin, vicilin, storage SEED protein; 2.35A {Arachis hypogaea} PDB: 3s7e_A 3smh_A Length = 418	Back alignment and structure

>3s7i_A Allergen ARA H 1, clone P41B; bicupin, vicilin, storage SEED protein; 2.35A {Arachis hypogaea} PDB: 3s7e_A 3smh_A Length = 418	Back alignment and structure

>1v70_A Probable antibiotics synthesis protein; structural genomics, thermus thermophilus HB8, riken structu genomics/proteomics initiative, RSGI; 1.30A {Thermus thermophilus} SCOP: b.82.1.9 PDB: 2dct_A Length = 105	Back alignment and structure

>1y3t_A Hypothetical protein YXAG; BI cupin, dioxygenase, oxidoreductase; 2.40A {Bacillus subtilis} SCOP: b.82.1.5 PDB: 2h0v_A* Length = 337	Back alignment and structure

>1y3t_A Hypothetical protein YXAG; BI cupin, dioxygenase, oxidoreductase; 2.40A {Bacillus subtilis} SCOP: b.82.1.5 PDB: 2h0v_A* Length = 337	Back alignment and structure

>3fz3_A Prunin; TREE NUT allergen, allergy, amandin, almond, 11S SEED storage protein, allergen; 2.40A {Prunus dulcis} PDB: 3ehk_A Length = 531	Back alignment and structure

>3d82_A Cupin 2, conserved barrel domain protein; structural genomics, joint center for structural genomics; 2.05A {Shewanella frigidimarina ncimb 400} Length = 102	Back alignment and structure

>1o4t_A Putative oxalate decarboxylase; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; 1.95A {Thermotoga maritima} SCOP: b.82.1.9 Length = 133	Back alignment and structure

>3ht1_A REMF protein; cupin fold, Zn-binding, antibiotic biosynthesis, resistomycin, metalloprotein, cyclase, lyase; 1.20A {Streptomyces resistomycificus} PDB: 3ht2_A Length = 145	Back alignment and structure

>1juh_A Quercetin 2,3-dioxygenase; cupin, glycoprotein, beta sandwich, oxidoreduct; HET: NAG BMA MAN; 1.60A {Aspergillus japonicus} SCOP: b.82.1.5 PDB: 1gqh_A* 1h1i_A* 1h1m_A* 1gqg_A* Length = 350	Back alignment and structure

>1juh_A Quercetin 2,3-dioxygenase; cupin, glycoprotein, beta sandwich, oxidoreduct; HET: NAG BMA MAN; 1.60A {Aspergillus japonicus} SCOP: b.82.1.5 PDB: 1gqh_A* 1h1i_A* 1h1m_A* 1gqg_A* Length = 350	Back alignment and structure

>2i45_A Hypothetical protein; neisseria meningitidis cupin domain, structural genomics, PS protein structure initiative; 2.50A {Neisseria meningitidis} Length = 107	Back alignment and structure

>2gu9_A Tetracenomycin polyketide synthesis protein; X-RAY diffraction, cupin, immune system; 1.40A {Xanthomonas campestris} PDB: 2ilb_A 3h50_A Length = 113	Back alignment and structure

>1vj2_A Novel manganese-containing cupin TM1459; structural genomics, joint for structural genomics, JCSG; 1.65A {Thermotoga maritima} SCOP: b.82.1.10 Length = 126	Back alignment and structure

>3cew_A Uncharacterized cupin protein; all beta-protein, jelly-roll (cupin-2), structural genomics, protein structure initiative; 2.31A {Bacteroides fragilis} Length = 125	Back alignment and structure

>3ibm_A Cupin 2, conserved barrel domain protein; cupin 2 family, metal-binding site, beta barrel, PSI-2, NYSG structural genomics; 2.00A {Halorhodospira halophila SL1} Length = 167	Back alignment and structure

>2d40_A Z3393, putative gentisate 1,2-dioxygenase; gentisic acid, bicupin, tetramer, montreal- bacterial structural genomics initiative, BSGI; 2.41A {Escherichia coli} SCOP: b.82.1.23 Length = 354	Back alignment and structure

>3h8u_A Uncharacterized conserved protein with double-STR beta-helix domain; YP_001338853.1; HET: 2PE; 1.80A {Klebsiella pneumoniae subsp} Length = 125	Back alignment and structure

>1x82_A Glucose-6-phosphate isomerase; cupin superfamily, hyperthermophIle, phosphoglucose isomerase, extremeophIle; HET: PA5; 1.50A {Pyrococcus furiosus} SCOP: b.82.1.7 PDB: 1x7n_A* 1x8e_A 1qxr_A* 1qxj_A* 1qy4_A* 2gc1_A* 2gc0_A* 2gc2_A* 2gc3_A* 3sxw_A 1j3q_A 1j3p_A 1j3r_A* Length = 190	Back alignment and structure

>3nw4_A Gentisate 1,2-dioxygenase; beta-barrel, oxidoreductase; HET: GTQ; 2.00A {Pseudaminobacter salicylatoxidans} PDB: 3nvc_A* 3nst_A* 3njz_A* 2phd_A* 3nkt_A* 3nl1_A* Length = 368	Back alignment and structure

>3bu7_A Gentisate 1,2-dioxygenase; cupin domain, oxidoreductase, plasmid; 2.80A {Silicibacter pomeroyi} SCOP: b.82.1.23 Length = 394	Back alignment and structure

>3bu7_A Gentisate 1,2-dioxygenase; cupin domain, oxidoreductase, plasmid; 2.80A {Silicibacter pomeroyi} SCOP: b.82.1.23 Length = 394	Back alignment and structure

>4e2g_A Cupin 2 conserved barrel domain protein; MCSG, PSI-biology, structural genomics, GEBA, midwest center structural genomics; HET: MSE; 1.86A {Sphaerobacter thermophilus} Length = 126	Back alignment and structure

>3i7d_A Sugar phosphate isomerase; YP_168127.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.30A {Ruegeria pomeroyi dss-3} Length = 163	Back alignment and structure

>1y9q_A Transcriptional regulator, HTH_3 family; transcriptional regulaator, strucutral genomics, protein structure initiative, PSI; 1.90A {Vibrio cholerae} SCOP: a.35.1.8 b.82.1.15 Length = 192	Back alignment and structure

>3es1_A Cupin 2, conserved barrel domain protein; YP_001165807.1; HET: MSE; 1.91A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} Length = 172	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		224
1fi2_A		201	Oxalate oxidase, germin; beta-jellyroll, oxidoredu	100.0
3kgl_A		466	Cruciferin; 11S SEED globulin, rapeseed, SEED stor	99.98
3qac_A		465	11S globulin SEED storage protein; 11S SEED storag	99.97
3ksc_A		496	LEGA class, prolegumin; PEA prolegumin, 11S SEED s	99.97
2e9q_A		459	11S globulin subunit beta; cucubitin, pumpkin SEED	99.97
3fz3_A		531	Prunin; TREE NUT allergen, allergy, amandin, almon	99.97
2cav_A		445	Protein (canavalin); vicilin, 7S SEED protein, dom	99.97
1uij_A		416	Beta subunit of beta conglycinin; double-stranded	99.96
2ea7_A		434	7S globulin-1; beta barrel, cupin superfamily, pla	99.96
3c3v_A		510	Arachin ARAH3 isoform; peanut allergen, allergy, g	99.96
1fxz_A		476	Glycinin G1; proglycinin, legumin, SEED storage pr	99.96
2d5f_A		493	Glycinin A3B4 subunit; soybean, globulin, 11S,SEED	99.96
3s7i_A		418	Allergen ARA H 1, clone P41B; bicupin, vicilin, st	99.95
1dgw_A		178	Canavalin; duplicated swiss-roll beta barrels, loo	99.94
2phl_A		397	Phaseolin; plant SEED storage protein(vicilin); HE	99.93
2vqa_A		361	SLL1358 protein, MNCA; periplasmic binding protein	99.92
2e9q_A		459	11S globulin subunit beta; cucubitin, pumpkin SEED	99.91
2ea7_A		434	7S globulin-1; beta barrel, cupin superfamily, pla	99.91
2cav_A		445	Protein (canavalin); vicilin, 7S SEED protein, dom	99.9
1uij_A		416	Beta subunit of beta conglycinin; double-stranded	99.9
3ksc_A		496	LEGA class, prolegumin; PEA prolegumin, 11S SEED s	99.89
2phl_A		397	Phaseolin; plant SEED storage protein(vicilin); HE	99.89
3qac_A		465	11S globulin SEED storage protein; 11S SEED storag	99.89
1fxz_A		476	Glycinin G1; proglycinin, legumin, SEED storage pr	99.89
3s7i_A		418	Allergen ARA H 1, clone P41B; bicupin, vicilin, st	99.89
2d5f_A		493	Glycinin A3B4 subunit; soybean, globulin, 11S,SEED	99.87
3kgl_A		466	Cruciferin; 11S SEED globulin, rapeseed, SEED stor	99.86
3c3v_A		510	Arachin ARAH3 isoform; peanut allergen, allergy, g	99.86
2vqa_A		361	SLL1358 protein, MNCA; periplasmic binding protein	99.85
3fz3_A		531	Prunin; TREE NUT allergen, allergy, amandin, almon	99.84
1j58_A		385	YVRK protein; cupin, decarboxyklase, oxalate, mang	99.82
1dgw_X		79	Canavalin; duplicated swiss-roll beta barrels, loo	99.8
1j58_A		385	YVRK protein; cupin, decarboxyklase, oxalate, mang	99.78
3h8u_A		125	Uncharacterized conserved protein with double-STR	99.53
2xlg_A		239	SLL1785 protein, CUCA; metal binding protein, cupi	99.48
1lr5_A		163	Auxin binding protein 1; beta jellyroll, double st	99.48
3l2h_A		162	Putative sugar phosphate isomerase; AFE_0303, stru	99.47
2fqp_A		97	Hypothetical protein BP2299; double-stranded beta-	99.45
1v70_A		105	Probable antibiotics synthesis protein; structural	99.44
2oa2_A		148	BH2720 protein; 10175341, structural genomics, joi	99.42
3ibm_A		167	Cupin 2, conserved barrel domain protein; cupin 2	99.41
3i7d_A		163	Sugar phosphate isomerase; YP_168127.1, structural	99.4
3lag_A		98	Uncharacterized protein RPA4178; functionally unkn	99.4
1x82_A		190	Glucose-6-phosphate isomerase; cupin superfamily,	99.39
3ht1_A		145	REMF protein; cupin fold, Zn-binding, antibiotic b	99.38
2gu9_A		113	Tetracenomycin polyketide synthesis protein; X-RAY	99.38
3es1_A		172	Cupin 2, conserved barrel domain protein; YP_00116	99.36
3fjs_A		114	Uncharacterized protein with RMLC-like cupin fold;	99.34
4e2g_A		126	Cupin 2 conserved barrel domain protein; MCSG, PSI	99.34
3kgz_A		156	Cupin 2 conserved barrel domain protein; metallopr	99.33
1o4t_A		133	Putative oxalate decarboxylase; double-stranded be	99.32
2b8m_A		117	Hypothetical protein MJ0764; structural genomics,	99.32
3jzv_A		166	Uncharacterized protein RRU_A2000; structural geno	99.31
2bnm_A		198	Epoxidase; oxidoreductase, cupin, HTH, cation-depe	99.31
2ozi_A		98	Hypothetical protein RPA4178; APC6210, putative pr	99.31
2pfw_A		116	Cupin 2, conserved barrel domain protein; cupin do	99.28
2f4p_A		147	Hypothetical protein TM1010; double-stranded beta-	99.27
2o8q_A		134	Hypothetical protein; cpuin-like fold, structural	99.27
3cew_A		125	Uncharacterized cupin protein; all beta-protein, j	99.26
1vj2_A		126	Novel manganese-containing cupin TM1459; structura	99.25
4i4a_A		128	Similar to unknown protein; structural genomics, P	99.25
1yhf_A		115	Hypothetical protein SPY1581; structural genomics,	99.23
2vpv_A		166	Protein MIF2, MIF2P; nucleus, mitosis, centromere,	99.23
1y9q_A		192	Transcriptional regulator, HTH_3 family; transcrip	99.22
1rc6_A		261	Hypothetical protein YLBA; structural genomics, NY	99.2
3h7j_A		243	Bacilysin biosynthesis protein BACB; YWFC, bacilys	99.19
2ozj_A		114	Cupin 2, conserved barrel; cupin superfamily prote	99.15
2q30_A		110	Uncharacterized protein; double-stranded beta-heli	99.14
1sef_A		274	Conserved hypothetical protein; structural genomic	99.13
1y3t_A		337	Hypothetical protein YXAG; BI cupin, dioxygenase,	99.12
2d40_A		354	Z3393, putative gentisate 1,2-dioxygenase; gentisi	99.1
1juh_A		350	Quercetin 2,3-dioxygenase; cupin, glycoprotein, be	99.08
3lwc_A		119	Uncharacterized protein; structural genomics, unkn	99.07
2d40_A		354	Z3393, putative gentisate 1,2-dioxygenase; gentisi	99.07
3h7j_A		243	Bacilysin biosynthesis protein BACB; YWFC, bacilys	99.07
3d82_A		102	Cupin 2, conserved barrel domain protein; structur	99.07
2i45_A		107	Hypothetical protein; neisseria meningitidis cupin	99.06
1sfn_A		246	Conserved hypothetical protein; structural genomic	99.03
1y3t_A		337	Hypothetical protein YXAG; BI cupin, dioxygenase,	99.03
1sq4_A		278	GLXB, glyoxylate-induced protein; structural genom	99.0
4b29_A		217	Dimethylsulfoniopropionate lyase; hydrolase, dimet	99.0
2pyt_A		133	Ethanolamine utilization protein EUTQ; structural	99.0
1rc6_A		261	Hypothetical protein YLBA; structural genomics, NY	98.99
2opk_A		112	Hypothetical protein; putative mannose-6-phosphate	98.98
3rns_A		227	Cupin 2 conserved barrel domain protein; structura	98.98
4h7l_A		157	Uncharacterized protein; structural genomics, PSI-	98.96
3nw4_A		368	Gentisate 1,2-dioxygenase; beta-barrel, oxidoreduc	98.95
4e2q_A		266	Ureidoglycine aminohydrolase; BI-cupin, manganese	98.95
3bu7_A		394	Gentisate 1,2-dioxygenase; cupin domain, oxidoredu	98.94
1sef_A		274	Conserved hypothetical protein; structural genomic	98.94
1vr3_A		191	Acireductone dioxygenase; 13543033, structural gen	98.94
3rns_A		227	Cupin 2 conserved barrel domain protein; structura	98.93
1sq4_A		278	GLXB, glyoxylate-induced protein; structural genom	98.9
4e2q_A		266	Ureidoglycine aminohydrolase; BI-cupin, manganese	98.89
3bu7_A		394	Gentisate 1,2-dioxygenase; cupin domain, oxidoredu	98.89
4axo_A		151	EUTQ, ethanolamine utilization protein; structural	98.86
1dgw_Y		93	Canavalin; duplicated swiss-roll beta barrels, loo	98.83
1zrr_A		179	E-2/E-2' protein; nickel, cupin, beta helix, methi	98.75
3ebr_A		159	Uncharacterized RMLC-like cupin; structural genomi	98.74
1o5u_A		101	Novel thermotoga maritima enzyme TM1112; cupin, st	98.73
2q1z_B		195	Anti-sigma factor CHRR, transcriptional activator;	98.71
3bcw_A		123	Uncharacterized protein; structural genomics, join	98.66
1yfu_A		174	3-hydroxyanthranilate-3,4-dioxygenase; cupin, oxid	98.66
1juh_A		350	Quercetin 2,3-dioxygenase; cupin, glycoprotein, be	98.64
1sfn_A		246	Conserved hypothetical protein; structural genomic	98.63
2o1q_A		145	Putative acetyl/propionyl-COA carboxylase, alpha;	98.58
2y0o_A		175	Probable D-lyxose ketol-isomerase; carbohydrate me	98.56
3cjx_A		165	Protein of unknown function with A cupin-like FOL;	98.55
3eqe_A		171	Putative cystein deoxygenase; YUBC, SR112, NESG, s	98.53
3d0j_A		140	Uncharacterized protein CA_C3497; beta-barrel, str	98.49
3st7_A		369	Capsular polysaccharide synthesis enzyme CAP5F; ro	98.47
1zvf_A		176	3-hydroxyanthranilate 3,4-dioxygenase; jellyroll b	98.39
2gm6_A		208	Cysteine dioxygenase type I; structural genomics,	98.32
3o14_A		223	Anti-ecfsigma factor, CHRR; cupin, structural geno	98.32
3nw4_A		368	Gentisate 1,2-dioxygenase; beta-barrel, oxidoreduc	98.3
2qnk_A		286	3-hydroxyanthranilate 3,4-dioxygenase; bicupin fol	98.28
2arc_A		164	ARAC, arabinose operon regulatory protein; transcr	98.22
3bal_A		153	Acetylacetone-cleaving enzyme; jelly roll, tetrame	98.21
3eln_A		200	Cysteine dioxygenase type 1; peroxysulfenate, non-	98.13
3myx_A		238	Uncharacterized protein pspto_0244; protein of unk	97.84
2pa7_A		141	DTDP-6-deoxy-3,4-keto-hexulose isomerase; deoxysug	97.79
3ejk_A		174	DTDP sugar isomerase; YP_390184.1, structural geno	97.76
3uss_A		211	Putative uncharacterized protein; cupin, three his	97.74
3es4_A		116	Uncharacterized protein DUF861 with A RMLC-like C;	97.53
3myx_A		238	Uncharacterized protein pspto_0244; protein of unk	97.32
3gbg_A		276	TCP pilus virulence regulatory protein; cupin, hel	97.25
1yud_A		170	Hypothetical protein SO0799; SOR12, Q8E1N8, PSI, p	97.16
2vec_A		256	YHAK, pirin-like protein YHAK; ROS, bicupin, sulfe	96.92
1ep0_A		185	DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; race	96.91
3ryk_A		205	DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pat	96.87
3o14_A		223	Anti-ecfsigma factor, CHRR; cupin, structural geno	96.86
2ixk_A		184	DTDP-4-dehydrorhamnose 3,5-epimerase; isomerase, l	96.82
1dzr_A		183	DTDP-4-dehydrorhamnose 3\,5-epimerase; isomerase,	96.68
1nxm_A		197	DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; jell	96.62
3kmh_A		246	D-lyxose isomerase; cupin beta-barrel, structural	96.58
1wlt_A		196	176AA long hypothetical DTDP-4-dehydrorhamnose 3,	96.58
1tq5_A		242	Protein YHHW; bicupin, pirin, montreal-kingston ba	96.54
1vrb_A		342	Putative asparaginyl hydroxylase; 2636534, structu	96.54
4gjz_A		235	Lysine-specific demethylase 8; JMJC, beta barrel,	96.43
1oi6_A		205	PCZA361.16; epimerase, vancomycin group antibiotic	96.42
2c0z_A		216	NOVW; isomerase, epimerase, antibiotic biosynthesi	96.35
3bb6_A		127	Uncharacterized protein YEAR; structural genomics,	96.3
1upi_A		225	DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pat	96.25
4hn1_A		201	Putative 3-epimerase in D-allose pathway; 3'-monoe	96.17
3d8c_A		349	Hypoxia-inducible factor 1 alpha inhibitor; FIH, H	96.02
2qdr_A		303	Uncharacterized protein; double-stranded beta-heli	96.02
2qjv_A		270	Uncharacterized IOLB-like protein; structural geno	95.32
3al5_A		338	HTYW5, JMJC domain-containing protein C2ORF60; tRN	95.31
4diq_A		489	Lysine-specific demethylase NO66; structural genom	95.15
2xdv_A		442	MYC-induced nuclear antigen; ribosome biogenesis,	95.12
1eyb_A		471	Homogentisate 1,2-dioxygenase; jelly roll, beta sa	94.96
1e5r_A		290	Proline oxidase; oxidoreductase, oxygenase, 2-oxog	94.81
3k2o_A		336	Bifunctional arginine demethylase and lysyl-hydro	94.46
2p17_A		277	Pirin-like protein; GK1651, structural genomics, s	94.46
1j1l_A		290	Pirin; beta sandwich, cupin, iron, metatl binding	94.12
3kv5_D		488	JMJC domain-containing histone demethylation prote	93.23
2yu1_A		451	JMJC domain-containing histone demethylation PROT;	93.05
2qnk_A		286	3-hydroxyanthranilate 3,4-dioxygenase; bicupin fol	92.9
3kv4_A		447	PHD finger protein 8; epigenetics, histone CODE, c	92.67
3rcq_A		197	Aspartyl/asparaginyl beta-hydroxylase; structural	92.66
1xru_A		282	4-deoxy-L-threo-5-hexosulose-uronate ketol-isomer;	92.65
3k3o_A		371	PHF8, PHD finger protein 8; histone demethylase, c	92.24
3kv9_A		397	JMJC domain-containing histone demethylation prote	91.84
1ywk_A		289	4-deoxy-L-threo-5-hexosulose-uronate ketol- isomer	90.64
3pua_A		392	GRC5, PHD finger protein 2; alpha-ketoglutarate-Fe	90.6
2oyz_A		94	UPF0345 protein VPA0057; unknown function, structu	89.89
3hqx_A		111	UPF0345 protein aciad0356; DUF1255,PF06865,PSI2,MC	89.72
2rg4_A		216	Uncharacterized protein; rhodobacterales, oceanico	88.6
2ypd_A		392	Probable JMJC domain-containing histone demethyla	88.55
1pmi_A		440	PMI, phosphomannose isomerase; aldose-ketose isome	88.36
3pur_A		528	Lysine-specific demethylase 7 homolog; oxidoreduct	88.15
1qwr_A		319	Mannose-6-phosphate isomerase; structural genomics	86.91
2wfp_A		394	Mannose-6-phosphate isomerase; APO-structure, meta	86.19
3loi_A		172	Putative uncharacterized protein; beta barrel, unk	85.32
1tq5_A		242	Protein YHHW; bicupin, pirin, montreal-kingston ba	85.25
3m3i_A		225	Putative uncharacterized protein; PFAM:PF06172, st	85.22
3dl3_A		119	Tellurite resistance protein B; X-RAY NESG VFR98 Q	85.18
1zx5_A		300	Mannosephosphate isomerase, putative; STRU genomic	82.99
3eo6_A		106	Protein of unknown function (DUF1255); AFE_2634, s	82.64
2pqq_A		149	Putative transcriptional regulator; APC7345, strep	82.0
3dn7_A		194	Cyclic nucleotide binding regulatory protein; stru	80.47
2oz6_A		207	Virulence factor regulator; winged helix, helix-tu	80.06

>1fi2_A Oxalate oxidase, germin; beta-jellyroll, oxidoreductase; 1.60A {Hordeum vulgare} SCOP: b.82.1.2 PDB: 2et1_A 2ete_A* 2et7_A	Back alignment and structure

Probab=100.00  E-value=4.3e-51  Score=342.06  Aligned_cols=198  Identities=47%  Similarity=0.787  Sum_probs=185.4

Q ss_pred             cCCCCccceEeecCCCCCC-ceecCcccCCCCCCCCCCceeec-CCCCCCccCCCCceEEEeccCCCCCcccccEEEEEE
Q 027381           23 TDPGHLQDVCVAINDPKDG-VFVNGKFCKDPKLARAEDFFFSG-LGKPGNTANRLGVDETDANVEQIPGLNTLGISAFRI  100 (224)
Q Consensus        23 ~d~~~~~dfcv~~~~~~~~-~~~~g~~ck~~~~v~~~df~f~~-~~~~~~~~~~~g~~v~~~~~~~~P~l~~~gis~a~v  100 (224)
                      +|||||||||||  |++++ +++|||+|| |+.++++||+|++ +++++++.|..|+.++.++..++|+++++++++.++
T Consensus         1 ~~~~~~~d~c~~--~~~~~~~~~~g~~c~-~~~~~~~df~~~~~~~~~~~~~~~~G~~v~~~~~~~~p~l~~~~~~~~~~   77 (201)
T 1fi2_A            1 TDPDPLQDFCVA--DLDGKAVSVNGHTCK-PMSEAGDDFLFSSKLTKAGNTSTPNGSAVTELDVAEWPGTNTLGVSMNRV   77 (201)
T ss_dssp             CCCCCSSSCCCB--CCCTTSCCCSSCCBC-CGGGCCSCTTCCCTTSSCCCCCSTTSEEEEEESTTTCGGGTTSSCEEEEE
T ss_pred             CCCcccceeEEe--cCCCCcccccCcccc-cCcccccceEEeeeecCCCCccCCCCcEEEEEecccCCCcccCceEEEEE
Confidence            699999999999  99888 999999999 9999999999999 999999889999999999999999999999999999


Q ss_pred             EEcCCccCCCccCCCCcEEEEEEecEEEEEEEecCCCCCeEEEEEeCCCCEEEECCCCeeEEEecCCCcEEEEEEecCCC
Q 027381          101 DYAPYGQRPPHIHPRASEIFLVLEGTLYVGFVTSDQLNNTLIAKVLNKGDVFVFPQGLIHFQFNIGKTNAAAYSALNSQF  180 (224)
Q Consensus       101 ~l~pgg~~~pH~Hp~a~Ei~~Vl~G~~~v~~~~~~~~g~~~~~~~L~~GDv~~~P~G~~H~~~N~g~~~a~~i~~~~s~~  180 (224)
                      +++||++.+||||++++|++||++|++++++.+.++++++++++.|++||+++||+|..|+++|.|++++.+++++++++
T Consensus        78 ~l~pg~~~~~H~H~~~~E~~~Vl~G~~~v~~~~~~~~~~~~~~~~l~~GD~~~iP~g~~H~~~N~g~~~~~~l~v~~~~~  157 (201)
T 1fi2_A           78 DFAPGGTNPPHIHPRATEIGMVMKGELLVGILGSLDSGNKLYSRVVRAGETFVIPRGLMHFQFNVGKTEAYMVVSFNSQN  157 (201)
T ss_dssp             EECTTCEEEEEECTTCCEEEEEEESEEEEEEECCGGGTTCEEEEEEETTCEEEECTTCCEEEEECSSSCEEEEEEESSSC
T ss_pred             EECCCCCCCCeECCCCCEEEEEEeCEEEEEEEcCCCCCCeEEEEEECCCCEEEECCCCeEEEEeCCCCCEEEEEEECCCC
Confidence            99999999999999989999999999999997542001465568999999999999999999999999999999999999


Q ss_pred             CcceechhhhhcCCCCCCHHHHHhhcCCCHHHHHHHhhhhcCC
Q 027381          181 PGEVTIADTVFGANPSINPDFLGKAFQLDPKIVKDLQNKFING  223 (224)
Q Consensus       181 pg~~~~~~~lf~~~p~~~~~vla~~f~~d~~~v~~l~~~~~~~  223 (224)
                      |+.+.++.++|+++|++++++|+++|+++++++++|+++|+++
T Consensus       158 p~~~~~~~~~~~~~~~~~~~vl~~af~~~~~~v~~l~~~~~~~  200 (201)
T 1fi2_A          158 PGIVFVPLTLFGSDPPIPTPVLTKALRVEAGVVELLKSKFAGG  200 (201)
T ss_dssp             CCCEEHHHHHHHCSSCCCHHHHHHHHTSCHHHHHHHHHHSTTC
T ss_pred             CCeEehhhHHhcCCCCCCHHHHHHHHCcCHHHHHHHHHhhcCC
Confidence            9999999999999889999999999999999999999999765

PyMOL of 1fi2

>3kgl_A Cruciferin; 11S SEED globulin, rapeseed, SEED storage protein, storage protein, plant protein; 2.98A {Brassica napus}	Back alignment and structure

>3qac_A 11S globulin SEED storage protein; 11S SEED storage protein (globulins) family, SEED storage PR plant protein; 2.27A {Amaranthus hypochondriacus}	Back alignment and structure

>3ksc_A LEGA class, prolegumin; PEA prolegumin, 11S SEED storage protein, pisum sativum L., SEED storage protein, storage protein, plant protein; 2.61A {Pisum sativum}	Back alignment and structure

>2e9q_A 11S globulin subunit beta; cucubitin, pumpkin SEED storage globulin, plant protein; 2.20A {Cucurbita maxima} PDB: 2evx_A	Back alignment and structure

>3fz3_A Prunin; TREE NUT allergen, allergy, amandin, almond, 11S SEED storage protein, allergen; 2.40A {Prunus dulcis} PDB: 3ehk_A	Back alignment and structure

>2cav_A Protein (canavalin); vicilin, 7S SEED protein, domain duplication, swiss roll, PL protein; 2.00A {Canavalia ensiformis} SCOP: b.82.1.2 b.82.1.2 PDB: 2cau_A 1cau_B 1cav_B 1caw_B 1cax_B	Back alignment and structure

>1uij_A Beta subunit of beta conglycinin; double-stranded beta helix, SEED storage protein, sugar binding protein; 2.50A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ipk_A 1ipj_A*	Back alignment and structure

>2ea7_A 7S globulin-1; beta barrel, cupin superfamily, plant protein; 1.80A {Vigna angularis} PDB: 2eaa_A* 2cv6_A 1uik_A	Back alignment and structure

>3c3v_A Arachin ARAH3 isoform; peanut allergen, allergy, glycinin; 1.73A {Arachis hypogaea}	Back alignment and structure

>1fxz_A Glycinin G1; proglycinin, legumin, SEED storage protein, plant protein; 2.80A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ud1_A 1ucx_A	Back alignment and structure

>3s7i_A Allergen ARA H 1, clone P41B; bicupin, vicilin, storage SEED protein; 2.35A {Arachis hypogaea} PDB: 3s7e_A 3smh_A	Back alignment and structure

>1dgw_A Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_A 1cau_A 1cav_A 1caw_A 1cax_A	Back alignment and structure

>2phl_A Phaseolin; plant SEED storage protein(vicilin); HET: NAG; 2.20A {Phaseolus vulgaris} SCOP: b.82.1.2 b.82.1.2 PDB: 1phs_A*	Back alignment and structure

>2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP}	Back alignment and structure

>2e9q_A 11S globulin subunit beta; cucubitin, pumpkin SEED storage globulin, plant protein; 2.20A {Cucurbita maxima} PDB: 2evx_A	Back alignment and structure

>2ea7_A 7S globulin-1; beta barrel, cupin superfamily, plant protein; 1.80A {Vigna angularis} PDB: 2eaa_A* 2cv6_A 1uik_A	Back alignment and structure

>2cav_A Protein (canavalin); vicilin, 7S SEED protein, domain duplication, swiss roll, PL protein; 2.00A {Canavalia ensiformis} SCOP: b.82.1.2 b.82.1.2 PDB: 2cau_A 1cau_B 1cav_B 1caw_B 1cax_B	Back alignment and structure

>1uij_A Beta subunit of beta conglycinin; double-stranded beta helix, SEED storage protein, sugar binding protein; 2.50A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ipk_A 1ipj_A*	Back alignment and structure

>3ksc_A LEGA class, prolegumin; PEA prolegumin, 11S SEED storage protein, pisum sativum L., SEED storage protein, storage protein, plant protein; 2.61A {Pisum sativum}	Back alignment and structure

>2phl_A Phaseolin; plant SEED storage protein(vicilin); HET: NAG; 2.20A {Phaseolus vulgaris} SCOP: b.82.1.2 b.82.1.2 PDB: 1phs_A*	Back alignment and structure

>3qac_A 11S globulin SEED storage protein; 11S SEED storage protein (globulins) family, SEED storage PR plant protein; 2.27A {Amaranthus hypochondriacus}	Back alignment and structure

>1fxz_A Glycinin G1; proglycinin, legumin, SEED storage protein, plant protein; 2.80A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ud1_A 1ucx_A	Back alignment and structure

>3s7i_A Allergen ARA H 1, clone P41B; bicupin, vicilin, storage SEED protein; 2.35A {Arachis hypogaea} PDB: 3s7e_A 3smh_A	Back alignment and structure

>2d5f_A Glycinin A3B4 subunit; soybean, globulin, 11S,SEED storage protein, plant; 1.90A {Glycine max} PDB: 2d5h_A 1od5_A	Back alignment and structure

>3kgl_A Cruciferin; 11S SEED globulin, rapeseed, SEED storage protein, storage protein, plant protein; 2.98A {Brassica napus}	Back alignment and structure

>3c3v_A Arachin ARAH3 isoform; peanut allergen, allergy, glycinin; 1.73A {Arachis hypogaea}	Back alignment and structure

>2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP}	Back alignment and structure

>3fz3_A Prunin; TREE NUT allergen, allergy, amandin, almond, 11S SEED storage protein, allergen; 2.40A {Prunus dulcis} PDB: 3ehk_A	Back alignment and structure

>1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A	Back alignment and structure

>1dgw_X Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_X	Back alignment and structure

>1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A	Back alignment and structure

>3h8u_A Uncharacterized conserved protein with double-STR beta-helix domain; YP_001338853.1; HET: 2PE; 1.80A {Klebsiella pneumoniae subsp}	Back alignment and structure

>2xlg_A SLL1785 protein, CUCA; metal binding protein, cupin; 1.80A {Synechocystis SP} PDB: 2xl7_A 2xl9_A 2xlf_A* 2xla_A	Back alignment and structure

>1lr5_A Auxin binding protein 1; beta jellyroll, double stranded beta helix, germin-like PROT protein binding; HET: NAG BMA MAN; 1.90A {Zea mays} SCOP: b.82.1.2 PDB: 1lrh_A*	Back alignment and structure

>3l2h_A Putative sugar phosphate isomerase; AFE_0303, structural GEN joint center for structural genomics, JCSG; HET: MSE CXS; 1.85A {Acidithiobacillus ferrooxidans}	Back alignment and structure

>2fqp_A Hypothetical protein BP2299; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: 1PE; 1.80A {Bordetella pertussis tohama I}	Back alignment and structure

>1v70_A Probable antibiotics synthesis protein; structural genomics, thermus thermophilus HB8, riken structu genomics/proteomics initiative, RSGI; 1.30A {Thermus thermophilus} SCOP: b.82.1.9 PDB: 2dct_A	Back alignment and structure

>2oa2_A BH2720 protein; 10175341, structural genomics, joint center for STRU genomics, JCSG, protein structure initiative, PSI-2, unknow function; HET: MSE; 1.41A {Bacillus halodurans}	Back alignment and structure

>3ibm_A Cupin 2, conserved barrel domain protein; cupin 2 family, metal-binding site, beta barrel, PSI-2, NYSG structural genomics; 2.00A {Halorhodospira halophila SL1}	Back alignment and structure

>3i7d_A Sugar phosphate isomerase; YP_168127.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.30A {Ruegeria pomeroyi dss-3}	Back alignment and structure

>3lag_A Uncharacterized protein RPA4178; functionally unknown protein, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.15A {Rhodopseudomonas palustris}	Back alignment and structure

>1x82_A Glucose-6-phosphate isomerase; cupin superfamily, hyperthermophIle, phosphoglucose isomerase, extremeophIle; HET: PA5; 1.50A {Pyrococcus furiosus} SCOP: b.82.1.7 PDB: 1x7n_A* 1x8e_A 1qxr_A* 1qxj_A* 1qy4_A* 2gc1_A* 2gc0_A* 2gc2_A* 2gc3_A* 3sxw_A 1j3q_A 1j3p_A 1j3r_A*	Back alignment and structure

>3ht1_A REMF protein; cupin fold, Zn-binding, antibiotic biosynthesis, resistomycin, metalloprotein, cyclase, lyase; 1.20A {Streptomyces resistomycificus} PDB: 3ht2_A	Back alignment and structure

>2gu9_A Tetracenomycin polyketide synthesis protein; X-RAY diffraction, cupin, immune system; 1.40A {Xanthomonas campestris} PDB: 2ilb_A 3h50_A	Back alignment and structure

>3es1_A Cupin 2, conserved barrel domain protein; YP_001165807.1; HET: MSE; 1.91A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID}	Back alignment and structure

>3fjs_A Uncharacterized protein with RMLC-like cupin fold; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.90A {Ralstonia eutropha JMP134}	Back alignment and structure

>4e2g_A Cupin 2 conserved barrel domain protein; MCSG, PSI-biology, structural genomics, GEBA, midwest center structural genomics; HET: MSE; 1.86A {Sphaerobacter thermophilus}	Back alignment and structure

>3kgz_A Cupin 2 conserved barrel domain protein; metalloprotein, structural genomics, PSI-2, protein structur initiative; 1.85A {Rhodopseudomonas palustris}	Back alignment and structure

>1o4t_A Putative oxalate decarboxylase; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; 1.95A {Thermotoga maritima} SCOP: b.82.1.9	Back alignment and structure

>2b8m_A Hypothetical protein MJ0764; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.70A {Methanocaldococcus jannaschii} SCOP: b.82.1.18	Back alignment and structure

>3jzv_A Uncharacterized protein RRU_A2000; structural genomics, cupin-2 fold, unknown function, PSI-2, structure initiative; HET: MSE; 2.30A {Rhodospirillum rubrum}	Back alignment and structure

>2bnm_A Epoxidase; oxidoreductase, cupin, HTH, cation-dependant, zinc, fosfomycin; 1.7A {Streptomyces wedmorensis} SCOP: a.35.1.3 b.82.1.10 PDB: 1zz7_A 1zz8_A 1zz9_A 1zzb_A 1zz6_A 1zzc_A 2bnn_A 2bno_A 3scf_A 3scg_A 3sch_A	Back alignment and structure

>2pfw_A Cupin 2, conserved barrel domain protein; cupin domain, struc genomics, joint center for structural genomics, JCSG; 1.90A {Shewanella frigidimarina}	Back alignment and structure

>2f4p_A Hypothetical protein TM1010; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: UNL; 1.90A {Thermotoga maritima} SCOP: b.82.1.9	Back alignment and structure

>2o8q_A Hypothetical protein; cpuin-like fold, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.55A {Burkholderia xenovorans}	Back alignment and structure

>3cew_A Uncharacterized cupin protein; all beta-protein, jelly-roll (cupin-2), structural genomics, protein structure initiative; 2.31A {Bacteroides fragilis}	Back alignment and structure

>1vj2_A Novel manganese-containing cupin TM1459; structural genomics, joint for structural genomics, JCSG; 1.65A {Thermotoga maritima} SCOP: b.82.1.10	Back alignment and structure

>4i4a_A Similar to unknown protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 1.35A {Photorhabdus luminescens subsp}	Back alignment and structure

>1yhf_A Hypothetical protein SPY1581; structural genomics, conserved hypothetical protein, PSI, PR structure initiative; 2.00A {Streptococcus pyogenes} SCOP: b.82.1.9	Back alignment and structure

>2vpv_A Protein MIF2, MIF2P; nucleus, mitosis, centromere, cell cycle, DNA-binding, kinetochore, cell division, phosphoprotein, jelly-roll fold; 2.7A {Saccharomyces cerevisiae}	Back alignment and structure

>1y9q_A Transcriptional regulator, HTH_3 family; transcriptional regulaator, strucutral genomics, protein structure initiative, PSI; 1.90A {Vibrio cholerae} SCOP: a.35.1.8 b.82.1.15	Back alignment and structure

>1rc6_A Hypothetical protein YLBA; structural genomics, NYSGXRC, SGX clone NAME 3174C1TCT3B1, T T1521, PSI, protein initiative; 2.60A {Escherichia coli} SCOP: b.82.1.11	Back alignment and structure

>3h7j_A Bacilysin biosynthesis protein BACB; YWFC, bacilysin synthesis, anticapsin synthesis, BI-Cu double stranded beta helix, antibiotic biosynthesis; HET: PPY; 1.87A {Bacillus subtilis} PDB: 3h7y_A* 3h9a_A*	Back alignment and structure

>2ozj_A Cupin 2, conserved barrel; cupin superfamily protein, struct genomics, joint center for structural genomics, JCSG; HET: MSE; 1.60A {Desulfitobacterium hafniense}	Back alignment and structure

>2q30_A Uncharacterized protein; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: MSE; 1.94A {Desulfovibrio desulfuricans subsp}	Back alignment and structure

>1sef_A Conserved hypothetical protein; structural genomics, nysgxrc target T1582, PSI, protein STRU initiative; 2.05A {Enterococcus faecalis} SCOP: b.82.1.11	Back alignment and structure

>1y3t_A Hypothetical protein YXAG; BI cupin, dioxygenase, oxidoreductase; 2.40A {Bacillus subtilis} SCOP: b.82.1.5 PDB: 2h0v_A*	Back alignment and structure

>2d40_A Z3393, putative gentisate 1,2-dioxygenase; gentisic acid, bicupin, tetramer, montreal- bacterial structural genomics initiative, BSGI; 2.41A {Escherichia coli} SCOP: b.82.1.23	Back alignment and structure

>1juh_A Quercetin 2,3-dioxygenase; cupin, glycoprotein, beta sandwich, oxidoreduct; HET: NAG BMA MAN; 1.60A {Aspergillus japonicus} SCOP: b.82.1.5 PDB: 1gqh_A* 1h1i_A* 1h1m_A* 1gqg_A*	Back alignment and structure

>3lwc_A Uncharacterized protein; structural genomics, unknown function, joint center for STRU genomics, JCSG, protein structure initiative; HET: MSE; 1.40A {Rhizobium leguminosarum}	Back alignment and structure

>2d40_A Z3393, putative gentisate 1,2-dioxygenase; gentisic acid, bicupin, tetramer, montreal- bacterial structural genomics initiative, BSGI; 2.41A {Escherichia coli} SCOP: b.82.1.23	Back alignment and structure

>3h7j_A Bacilysin biosynthesis protein BACB; YWFC, bacilysin synthesis, anticapsin synthesis, BI-Cu double stranded beta helix, antibiotic biosynthesis; HET: PPY; 1.87A {Bacillus subtilis} PDB: 3h7y_A* 3h9a_A*	Back alignment and structure

>3d82_A Cupin 2, conserved barrel domain protein; structural genomics, joint center for structural genomics; 2.05A {Shewanella frigidimarina ncimb 400}	Back alignment and structure

>2i45_A Hypothetical protein; neisseria meningitidis cupin domain, structural genomics, PS protein structure initiative; 2.50A {Neisseria meningitidis}	Back alignment and structure

>1sfn_A Conserved hypothetical protein; structural genomics, nysgxrc target T1583, PSI, protein STRU initiative; 2.46A {Deinococcus radiodurans} SCOP: b.82.1.11	Back alignment and structure

>1y3t_A Hypothetical protein YXAG; BI cupin, dioxygenase, oxidoreductase; 2.40A {Bacillus subtilis} SCOP: b.82.1.5 PDB: 2h0v_A*	Back alignment and structure

>1sq4_A GLXB, glyoxylate-induced protein; structural genomics, double beta barrel protein, PSI, protei structure initiative; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.11	Back alignment and structure

>4b29_A Dimethylsulfoniopropionate lyase; hydrolase, dimethylsulfide, sulphur cycle; 1.72A {Roseovarius nubinhibens ism}	Back alignment and structure

>2pyt_A Ethanolamine utilization protein EUTQ; structural genomics, joint center for structural genomics, J protein structure initiative; 1.90A {Salmonella typhimurium LT2} SCOP: b.82.1.24	Back alignment and structure

>1rc6_A Hypothetical protein YLBA; structural genomics, NYSGXRC, SGX clone NAME 3174C1TCT3B1, T T1521, PSI, protein initiative; 2.60A {Escherichia coli} SCOP: b.82.1.11	Back alignment and structure

>2opk_A Hypothetical protein; putative mannose-6-phosphate isomerase, structural genomics, center for structural genomics, JCSG; 2.10A {Ralstonia eutropha}	Back alignment and structure

>3rns_A Cupin 2 conserved barrel domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 2.07A {Leptotrichia buccalis}	Back alignment and structure

>4h7l_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, cupin, unknown function; 2.45A {Planctomyces limnophilus}	Back alignment and structure

>3nw4_A Gentisate 1,2-dioxygenase; beta-barrel, oxidoreductase; HET: GTQ; 2.00A {Pseudaminobacter salicylatoxidans} PDB: 3nvc_A* 3nst_A* 3njz_A* 2phd_A* 3nkt_A* 3nl1_A* 4fag_A* 4fbf_A 4fah_A	Back alignment and structure

>4e2q_A Ureidoglycine aminohydrolase; BI-cupin, manganese binding, endoplasmic RET hydrolase; 2.50A {Arabidopsis thaliana} PDB: 4e2s_A	Back alignment and structure

>3bu7_A Gentisate 1,2-dioxygenase; cupin domain, oxidoreductase, plasmid; 2.80A {Silicibacter pomeroyi} SCOP: b.82.1.23	Back alignment and structure

>1sef_A Conserved hypothetical protein; structural genomics, nysgxrc target T1582, PSI, protein STRU initiative; 2.05A {Enterococcus faecalis} SCOP: b.82.1.11	Back alignment and structure

>1vr3_A Acireductone dioxygenase; 13543033, structural genomics, JOI for structural genomics, JCSG, protein structure initiative oxidoreductase; 2.06A {Mus musculus} SCOP: b.82.1.6	Back alignment and structure

>3rns_A Cupin 2 conserved barrel domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 2.07A {Leptotrichia buccalis}	Back alignment and structure

>1sq4_A GLXB, glyoxylate-induced protein; structural genomics, double beta barrel protein, PSI, protei structure initiative; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.11	Back alignment and structure

>4e2q_A Ureidoglycine aminohydrolase; BI-cupin, manganese binding, endoplasmic RET hydrolase; 2.50A {Arabidopsis thaliana} PDB: 4e2s_A	Back alignment and structure

>3bu7_A Gentisate 1,2-dioxygenase; cupin domain, oxidoreductase, plasmid; 2.80A {Silicibacter pomeroyi} SCOP: b.82.1.23	Back alignment and structure

>4axo_A EUTQ, ethanolamine utilization protein; structural protein, bacterial microcompartment, BMC; 1.00A {Clostridium difficile}	Back alignment and structure

>1dgw_Y Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_Y	Back alignment and structure

>1zrr_A E-2/E-2' protein; nickel, cupin, beta helix, methionine salvage, oxidoreductase; NMR {Klebsiella oxytoca} SCOP: b.82.1.6 PDB: 2hji_A	Back alignment and structure

>3ebr_A Uncharacterized RMLC-like cupin; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.60A {Ralstonia eutropha JMP134}	Back alignment and structure

>1o5u_A Novel thermotoga maritima enzyme TM1112; cupin, structural genomics center for structural genomics, JCSG, protein structure INI PSI; 1.83A {Thermotoga maritima} SCOP: b.82.1.8 PDB: 1lkn_A 2k9z_A	Back alignment and structure

>3bcw_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.60A {Bordetella bronchiseptica RB50}	Back alignment and structure

>1yfu_A 3-hydroxyanthranilate-3,4-dioxygenase; cupin, oxidoreductase; 1.90A {Cupriavidus metallidurans} SCOP: b.82.1.20 PDB: 1yfw_A* 1yfx_A* 1yfy_A*	Back alignment and structure

>1juh_A Quercetin 2,3-dioxygenase; cupin, glycoprotein, beta sandwich, oxidoreduct; HET: NAG BMA MAN; 1.60A {Aspergillus japonicus} SCOP: b.82.1.5 PDB: 1gqh_A* 1h1i_A* 1h1m_A* 1gqg_A*	Back alignment and structure

>1sfn_A Conserved hypothetical protein; structural genomics, nysgxrc target T1583, PSI, protein STRU initiative; 2.46A {Deinococcus radiodurans} SCOP: b.82.1.11	Back alignment and structure

>2o1q_A Putative acetyl/propionyl-COA carboxylase, alpha; putative acetylacetone dioxygenase, structural genomics; HET: MSE PG4; 1.50A {Methylibium petroleiphilum} SCOP: b.82.1.21	Back alignment and structure

>2y0o_A Probable D-lyxose ketol-isomerase; carbohydrate metabolism, metal-binding, sugar ISO stress response; HET: MSE; 1.23A {Bacillus subtilis subsp}	Back alignment and structure

>3cjx_A Protein of unknown function with A cupin-like FOL; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.60A {Ralstonia eutropha}	Back alignment and structure

>3eqe_A Putative cystein deoxygenase; YUBC, SR112, NESG, structural genomics, PSI-2, protein structure initiative; 2.82A {Bacillus subtilis}	Back alignment and structure

>3d0j_A Uncharacterized protein CA_C3497; beta-barrel, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.53A {Clostridium acetobutylicum atcc 824}	Back alignment and structure

>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A	Back alignment and structure

>1zvf_A 3-hydroxyanthranilate 3,4-dioxygenase; jellyroll beta-barrel, oxidoreductase; 2.41A {Saccharomyces cerevisiae} SCOP: b.82.1.20	Back alignment and structure

>2gm6_A Cysteine dioxygenase type I; structural genomics, J center for structural genomics, JCSG, protein structure INI PSI-2, oxidoreductase; 1.84A {Ralstonia eutropha} SCOP: b.82.1.19	Back alignment and structure

>3o14_A Anti-ecfsigma factor, CHRR; cupin, structural genomics, joint center for structura genomics, JCSG, protein structure initiative; HET: MSE; 1.70A {Marinobacter aquaeolei}	Back alignment and structure

>3nw4_A Gentisate 1,2-dioxygenase; beta-barrel, oxidoreductase; HET: GTQ; 2.00A {Pseudaminobacter salicylatoxidans} PDB: 3nvc_A* 3nst_A* 3njz_A* 2phd_A* 3nkt_A* 3nl1_A* 4fag_A* 4fbf_A 4fah_A	Back alignment and structure

>2qnk_A 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fold, cupin barrel, extradiol dioxygenase, metalloen trytophan catabolism, NAD+ synthesis; HET: MSE; 1.60A {Homo sapiens} PDB: 3fe5_A	Back alignment and structure

>2arc_A ARAC, arabinose operon regulatory protein; transcription factor, carbohydrate binding, coiled-coil, jelly roll; HET: ARA; 1.50A {Escherichia coli} SCOP: b.82.4.1 PDB: 2aac_A* 1xja_A 2ara_A	Back alignment and structure

>3bal_A Acetylacetone-cleaving enzyme; jelly roll, tetramer, dioxygenase, iron, metal-binding, oxidoreductase; 1.95A {Acinetobacter johnsonii}	Back alignment and structure

>3eln_A Cysteine dioxygenase type 1; peroxysulfenate, non-heme dioxygenases, Fe2+ metalloenzyme, taurine, thioether, iron, metal- binding; 1.42A {Rattus norvegicus} SCOP: b.82.1.19 PDB: 2gh2_A 2b5h_A 2atf_A* 2q4s_A 2ic1_A	Back alignment and structure

>3myx_A Uncharacterized protein pspto_0244; protein of unknown function (DUF861), cupin_3 (PF05899), STR genomics; HET: MSE; 1.30A {Pseudomonas syringae PV}	Back alignment and structure

>2pa7_A DTDP-6-deoxy-3,4-keto-hexulose isomerase; deoxysugar biosynthesis, S-layer biosynthesis, ketoisomerase; HET: TYD; 1.50A {Aneurinibacillus thermoaerophilus} SCOP: b.82.1.1 PDB: 2pae_A* 2pak_A* 2pam_A*	Back alignment and structure

>3ejk_A DTDP sugar isomerase; YP_390184.1, structural genomics, JOIN for structural genomics, JCSG; HET: CIT; 1.95A {Desulfovibrio desulfuricans subsp}	Back alignment and structure

>3uss_A Putative uncharacterized protein; cupin, three histidine, non-heme iron, cysteine catabolism, oxidoreductase; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.19	Back alignment and structure

>3es4_A Uncharacterized protein DUF861 with A RMLC-like C; 17741406, protein of unknown function (DUF861) with A RMLC-L fold; HET: MSE; 1.64A {Agrobacterium tumefaciens str}	Back alignment and structure

>3myx_A Uncharacterized protein pspto_0244; protein of unknown function (DUF861), cupin_3 (PF05899), STR genomics; HET: MSE; 1.30A {Pseudomonas syringae PV}	Back alignment and structure

>3gbg_A TCP pilus virulence regulatory protein; cupin, helix-turn-helix, ARAC family, activator, DNA-binding transcription, transcription regulation; HET: PAM; 1.90A {Vibrio cholerae}	Back alignment and structure

>1yud_A Hypothetical protein SO0799; SOR12, Q8E1N8, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.70A {Shewanella oneidensis} SCOP: b.82.1.16	Back alignment and structure

>2vec_A YHAK, pirin-like protein YHAK; ROS, bicupin, sulfenic acid, reactive cysteine, cytosolic protein; 1.85A {Escherichia coli}	Back alignment and structure

>1ep0_A DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; racemase, DTDP-4-dehydrorhamnose epimerase, structural genomics, PSI; 1.50A {Methanothermobacterthermautotrophicus} SCOP: b.82.1.1 PDB: 1epz_A*	Back alignment and structure

>3ryk_A DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pathway, STRU genomics, infectious diseases; HET: TYD; 1.63A {Bacillus anthracis str}	Back alignment and structure

>3o14_A Anti-ecfsigma factor, CHRR; cupin, structural genomics, joint center for structura genomics, JCSG, protein structure initiative; HET: MSE; 1.70A {Marinobacter aquaeolei}	Back alignment and structure

>2ixk_A DTDP-4-dehydrorhamnose 3,5-epimerase; isomerase, lipopolysaccharide biosynthesis, epimerise, epimerize; HET: TDO; 1.7A {Pseudomonas aeruginosa} PDB: 2ixi_A* 2ixh_A* 1rtv_A* 2ixj_A*	Back alignment and structure

>1dzr_A DTDP-4-dehydrorhamnose 3\,5-epimerase; isomerase, 3\,5-hexulose epimerase; 2.17A {Salmonella typhimurium} SCOP: b.82.1.1 PDB: 1dzt_A*	Back alignment and structure

>1nxm_A DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; jelly roll-like structure, beta sheet, isomerase; 1.30A {Streptococcus suis} SCOP: b.82.1.1 PDB: 1nyw_A* 1nzc_A* 2ixl_A*	Back alignment and structure

>3kmh_A D-lyxose isomerase; cupin beta-barrel, structural genomics, montreal-kingston BA structural genomics initiative, BSGI; 1.58A {Escherichia coli O157} PDB: 3mpb_A*	Back alignment and structure

>1wlt_A 176AA long hypothetical DTDP-4-dehydrorhamnose 3, 5-epimerase; jelly roll-like topology, flattened barrel, isomerase; 1.90A {Sulfolobus tokodaii} SCOP: b.82.1.1 PDB: 2b9u_A	Back alignment and structure

>1tq5_A Protein YHHW; bicupin, pirin, montreal-kingston bacterial structural genomics initiative, BSGI, structural genomics, unknown function; 1.76A {Escherichia coli} SCOP: b.82.1.12	Back alignment and structure

>1vrb_A Putative asparaginyl hydroxylase; 2636534, structural genomi center for structural genomics, JCSG, protein structure INI PSI, oxidoreductase; 2.60A {Bacillus subtilis} SCOP: b.82.2.11	Back alignment and structure

>4gjz_A Lysine-specific demethylase 8; JMJC, beta barrel, Fe(II) and 2-oxoglutarate binding, oxidor; HET: AKG BME; 1.05A {Homo sapiens} PDB: 4gjy_A* 4aap_A* 3uyj_A*	Back alignment and structure

>1oi6_A PCZA361.16; epimerase, vancomycin group antibiotic, EVAD, isomerase; HET: TMP; 1.4A {Amycolatopsis orientalis} SCOP: b.82.1.1 PDB: 1ofn_A* 1wa4_A	Back alignment and structure

>2c0z_A NOVW; isomerase, epimerase, antibiotic biosynthesis, RMLC-like cupin; 1.60A {Streptomyces sphaeroides} SCOP: b.82.1.1	Back alignment and structure

>3bb6_A Uncharacterized protein YEAR; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Escherichia coli} SCOP: b.82.2.13	Back alignment and structure

>1upi_A DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pathway, PSI, protein structure initiative, TB structural genomics consortium, TB; HET: CME; 1.7A {Mycobacterium tuberculosis} SCOP: b.82.1.1 PDB: 2ixc_A* 1pm7_A*	Back alignment and structure

>4hn1_A Putative 3-epimerase in D-allose pathway; 3'-monoepimerase, natural product, deoxysugar, chalcomycin, mycinose, cupin fold; HET: TYD THM; 1.60A {Streptomyces bikiniensis} PDB: 4hmz_A* 4hn0_A	Back alignment and structure

>3d8c_A Hypoxia-inducible factor 1 alpha inhibitor; FIH, HIF, DSBH, oxygenase, transcription, inhibitor oxoglutarate, asparaginyl hydroxylase; HET: AKG; 2.10A {Homo sapiens} PDB: 2ilm_A* 2w0x_A* 1h2l_A* 1h2m_A* 1h2n_A* 1yci_A* 2cgn_A 2cgo_A* 1h2k_A* 2wa3_A* 2wa4_A* 3od4_A* 3p3n_A* 3p3p_A* 2yc0_A* 2y0i_A* 2yde_A* 1mze_A* 1mzf_A* 2xum_A* ...	Back alignment and structure

>2qdr_A Uncharacterized protein; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: MSE EPE; 2.60A {Nostoc punctiforme}	Back alignment and structure

>2qjv_A Uncharacterized IOLB-like protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MLY MSE; 1.90A {Salmonella typhimurium LT2}	Back alignment and structure

>3al5_A HTYW5, JMJC domain-containing protein C2ORF60; tRNA modification enzyme, unknown function; 2.50A {Homo sapiens} PDB: 3al6_A*	Back alignment and structure

>4diq_A Lysine-specific demethylase NO66; structural genomics, structural genomics consortium, SGC, HI demethylase, oxidoreductase; HET: PD2; 2.40A {Homo sapiens}	Back alignment and structure

>2xdv_A MYC-induced nuclear antigen; ribosome biogenesis, nuclear protein; HET: OGA; 2.57A {Homo sapiens}	Back alignment and structure

>1eyb_A Homogentisate 1,2-dioxygenase; jelly roll, beta sandwich, oxidoreductase; 1.90A {Homo sapiens} SCOP: b.82.1.4 PDB: 1ey2_A	Back alignment and structure

>1e5r_A Proline oxidase; oxidoreductase, oxygenase, 2-oxoglutarate dependent oxygenase; 2.30A {Streptomyces SP} SCOP: b.82.2.4 PDB: 1e5s_A	Back alignment and structure

>3k2o_A Bifunctional arginine demethylase and lysyl-hydro JMJD6; structural genomics consortium, SGC, chromatin regulator, developmental protein; 1.75A {Homo sapiens} PDB: 3ld8_A 3ldb_A*	Back alignment and structure

>2p17_A Pirin-like protein; GK1651, structural genomics, south collaboratory for structural genomics, protein structure in secsg; 1.52A {Geobacillus kaustophilus}	Back alignment and structure

>1j1l_A Pirin; beta sandwich, cupin, iron, metatl binding protein; 2.10A {Homo sapiens} SCOP: b.82.1.12 PDB: 3acl_A*	Back alignment and structure

>3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A*	Back alignment and structure

>2yu1_A JMJC domain-containing histone demethylation PROT; JMJC-domain-containing histone demethylases, oxidoreductase; HET: AKG; 2.70A {Homo sapiens} PDB: 2yu2_A	Back alignment and structure

>2qnk_A 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fold, cupin barrel, extradiol dioxygenase, metalloen trytophan catabolism, NAD+ synthesis; HET: MSE; 1.60A {Homo sapiens} PDB: 3fe5_A	Back alignment and structure

>3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens}	Back alignment and structure

>3rcq_A Aspartyl/asparaginyl beta-hydroxylase; structural genomics, structural genomics consortium, SGC, oxidoreductase, human; HET: OGA; 2.05A {Homo sapiens}	Back alignment and structure

>1xru_A 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomer; beta barrel, cupin, isomerase; HET: 1PE; 1.94A {Escherichia coli} SCOP: b.82.1.13 PDB: 1x8m_A	Back alignment and structure

>3k3o_A PHF8, PHD finger protein 8; histone demethylase, chromatin modification, methylated H3K9, mental retardation, metal-BI phosphoprotein, zinc-finger; HET: AKG; 2.10A {Homo sapiens} PDB: 3k3n_A* 4do0_A* 2wwu_A*	Back alignment and structure

>3kv9_A JMJC domain-containing histone demethylation protein 1D; jumonji domain lysine demethylase, metal-binding, zinc, zinc-finger; 2.29A {Homo sapiens} PDB: 3kva_A* 3kvb_A* 3u78_A*	Back alignment and structure

>1ywk_A 4-deoxy-L-threo-5-hexosulose-uronate ketol- isomerase 1; structural genomics, nysgxrc target T1814, PSI, protein structure initiative; 2.95A {Enterococcus faecalis} SCOP: b.82.1.13	Back alignment and structure

>3pua_A GRC5, PHD finger protein 2; alpha-ketoglutarate-Fe2+ dependent dioxygenases, histone TAI protein, protein binding; HET: OGA; 1.89A {Homo sapiens} PDB: 3pu3_A* 3ptr_B* 3pu8_B* 3pus_A*	Back alignment and structure

>2oyz_A UPF0345 protein VPA0057; unknown function, structural genomi 2, protein structure initiative, midwest center for structu genomics, MCSG; 1.71A {Vibrio parahaemolyticus} SCOP: b.82.1.22	Back alignment and structure

>3hqx_A UPF0345 protein aciad0356; DUF1255,PF06865,PSI2,MCSG, structural genomics, protein STRU initiative, midwest center for structural genomics; 1.66A {Acinetobacter SP} SCOP: b.82.1.0	Back alignment and structure

>2rg4_A Uncharacterized protein; rhodobacterales, oceanicola granulosus HTCC2516, Q2CBJ1_9RHO structural genomics, PSI-2; 1.90A {Oceanicola granulosus} PDB: 3bvc_A	Back alignment and structure

>2ypd_A Probable JMJC domain-containing histone demethyla PROT EIN 2C; oxidoreductase; 2.10A {Homo sapiens}	Back alignment and structure

>1pmi_A PMI, phosphomannose isomerase; aldose-ketose isomerase; 1.70A {Candida albicans} SCOP: b.82.1.3	Back alignment and structure

>3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A*	Back alignment and structure

>1qwr_A Mannose-6-phosphate isomerase; structural genomics, D-mannose 6-phosphate, PSI, protein structure initiative; 1.80A {Bacillus subtilis} SCOP: b.82.1.3	Back alignment and structure

>2wfp_A Mannose-6-phosphate isomerase; APO-structure, metal-binding; 1.67A {Salmonella typhimurium} PDB: 3h1w_A 3h1m_A 3h1y_A*	Back alignment and structure

>3loi_A Putative uncharacterized protein; beta barrel, unknown function; 2.10A {Branchiostoma belcheri tsingtauense} SCOP: b.82.1.0 PDB: 3lzz_A*	Back alignment and structure

>1tq5_A Protein YHHW; bicupin, pirin, montreal-kingston bacterial structural genomics initiative, BSGI, structural genomics, unknown function; 1.76A {Escherichia coli} SCOP: b.82.1.12	Back alignment and structure

>3m3i_A Putative uncharacterized protein; PFAM:PF06172, structural genomics, structural genomics of pathogenic protozoa consortium, SGPP; 2.35A {Leishmania major}	Back alignment and structure

>3dl3_A Tellurite resistance protein B; X-RAY NESG VFR98 Q5E3X2_VIBF1, structural genomics, PSI-2, protein structure initiative; 2.30A {Vibrio fischeri ES114} SCOP: b.82.2.13	Back alignment and structure

>1zx5_A Mannosephosphate isomerase, putative; STRU genomics, PSI, protein structure initiative, midwest center structural genomics, MCSG; HET: LFR; 2.30A {Archaeoglobus fulgidus} SCOP: b.82.1.3	Back alignment and structure

>3eo6_A Protein of unknown function (DUF1255); AFE_2634, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 0.97A {Acidithiobacillus ferrooxidans ATCC23270}	Back alignment and structure

>2pqq_A Putative transcriptional regulator; APC7345, streptomyces coelicolor structural genomics, PSI-2, protein structure initiative; 2.00A {Streptomyces coelicolor A3}	Back alignment and structure

>3dn7_A Cyclic nucleotide binding regulatory protein; structural genomics, APC88869, cyclic nucleotide binding REG protein, PSI-2; 1.80A {Cytophaga hutchinsonii}	Back alignment and structure

>2oz6_A Virulence factor regulator; winged helix, helix-turn-helix, transcription factor, CAMP-B proteins, CAMP receptor protein; HET: CMP; 2.80A {Pseudomonas aeruginosa} SCOP: a.4.5.4 b.82.3.2	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		224
d2et1a1		201	b.82.1.2 (A:1-201) Germin {Barley (Hordeum vulgare	3e-73
d1fxza2		174	b.82.1.2 (A:297-470) Seed storage 7S protein {Soyb	5e-34
d1j58a_		372	b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {B	5e-33
d1j58a_		372	b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {B	4e-18
d1od5a2		173	b.82.1.2 (A:321-493) Seed storage 7S protein {Soyb	8e-33
d1uika2		185	b.82.1.2 (A:351-535) Seed storage 7S protein {Soyb	1e-32
g1dgw.1		168	b.82.1.2 (X:,Y:) Seed storage 7S protein {Jack bea	6e-30
d2phla2		162	b.82.1.2 (A:220-381) Seed storage 7S protein {Fren	1e-23
d1uija1		170	b.82.1.2 (A:6-175) Seed storage 7S protein {Soybea	2e-22
d1dgwa_		178	b.82.1.2 (A:) Seed storage 7S protein {Jack bean (	3e-20
d1uika1		203	b.82.1.2 (A:148-350) Seed storage 7S protein {Soyb	1e-18
d2phla1		200	b.82.1.2 (A:11-210) Seed storage 7S protein {Frenc	2e-17
d1lr5a_		160	b.82.1.2 (A:) Auxin binding protein {Maize (Zea ma	3e-13
d1y3ta1		330	b.82.1.5 (A:5-334) Hypothetical protein YxaG {Baci	2e-08
d1y3ta1		330	b.82.1.5 (A:5-334) Hypothetical protein YxaG {Baci	1e-05
d1o4ta_		115	b.82.1.9 (A:) Hypothetical protein TM1287 {Thermot	1e-06
d1v70a_		105	b.82.1.9 (A:) Hypothetical protein TTHA0104 {Therm	3e-06
d1juha_		348	b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergill	4e-06
d1juha_		348	b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergill	4e-06
d2d40a1		308	b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Es	4e-06
d2d40a1		308	b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Es	2e-04
d3bu7a1		355	b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Si	1e-05
d1od5a1		245	b.82.1.2 (A:7-251) Seed storage 7S protein {Soybea	1e-05
d1fxza1		239	b.82.1.2 (A:10-248) Seed storage 7S protein {Soybe	3e-05
d1x82a_		190	b.82.1.7 (A:) Glucose-6-phosphate isomerase, GPI {	4e-05
d1sq4a_		273	b.82.1.11 (A:) Glyoxylate-induced protein PA1140 {	5e-05
d1sefa_		250	b.82.1.11 (A:) Hypothetical protein EF2996 {Entero	8e-05
d1sefa_		250	b.82.1.11 (A:) Hypothetical protein EF2996 {Entero	5e-04
d1rc6a_		253	b.82.1.11 (A:) Hypothetical protein YlbA {Escheric	4e-04
d2phda1		351	b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Ps	4e-04
d1zrra1		179	b.82.1.6 (A:1-179) Acireductone dioxygenase {Klebs	4e-04
d1y9qa2		99	b.82.1.15 (A:83-181) Probable transcriptional regu	0.002
d1vj2a_		114	b.82.1.10 (A:) Hypothetical protein TM1459 {Thermo	0.003
d2pyta1		128	b.82.1.24 (A:100-227) Ethanolamine utilization pro	0.003
d2o1qa1		144	b.82.1.21 (A:1-144) Putative acetyl/propionyl-CoA	0.004

>d2et1a1 b.82.1.2 (A:1-201) Germin {Barley (Hordeum vulgare) [TaxId: 4513]} Length = 201	Back information, alignment and structure


class: All beta proteins
fold: Double-stranded beta-helix
superfamily: RmlC-like cupins
family: Germin/Seed storage 7S protein
domain: Germin
species: Barley (Hordeum vulgare) [TaxId: 4513]

 Score =  219 bits (558), Expect = 3e-73
 Identities = 92/198 (46%), Positives = 124/198 (62%), Gaps = 1/198 (0%)

Query: 23  TDPGHLQDVCVAINDPKDGVFVNGKFCKDPKLARAEDFFFSGLGKPGNTANRLGVDETDA 82
           TDP  LQD CVA  D K  V VNG  CK    A  +  F S L K GNT+   G   T+ 
Sbjct: 1   TDPDPLQDFCVADLDGK-AVSVNGHTCKPMSEAGDDFLFSSKLTKAGNTSTPNGSAVTEL 59

Query: 83  NVEQIPGLNTLGISAFRIDYAPYGQRPPHIHPRASEIFLVLEGTLYVGFVTSDQLNNTLI 142
           +V + PG NTLG+S  R+D+AP G  PPHIHPRA+EI +V++G L VG + S    N L 
Sbjct: 60  DVAEWPGTNTLGVSMNRVDFAPGGTNPPHIHPRATEIGMVMKGELLVGILGSLDSGNKLY 119

Query: 143 AKVLNKGDVFVFPQGLIHFQFNIGKTNAAAYSALNSQFPGEVTIADTVFGANPSINPDFL 202
           ++V+  G+ FV P+GL+HFQFN+GKT A    + NSQ PG V +  T+FG++P I    L
Sbjct: 120 SRVVRAGETFVIPRGLMHFQFNVGKTEAYMVVSFNSQNPGIVFVPLTLFGSDPPIPTPVL 179

Query: 203 GKAFQLDPKIVKDLQNKF 220
            KA +++  +V+ L++KF
Sbjct: 180 TKALRVEAGVVELLKSKF 197

PyMOL of d2et1a1

>d1fxza2 b.82.1.2 (A:297-470) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} Length = 174	Back information, alignment and structure

>d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} Length = 372	Back information, alignment and structure

>d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} Length = 372	Back information, alignment and structure

>d1od5a2 b.82.1.2 (A:321-493) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} Length = 173	Back information, alignment and structure

>d1uika2 b.82.1.2 (A:351-535) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} Length = 185	Back information, alignment and structure

>d2phla2 b.82.1.2 (A:220-381) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} Length = 162	Back information, alignment and structure

>d1uija1 b.82.1.2 (A:6-175) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin beta subunit [TaxId: 3847]} Length = 170	Back information, alignment and structure

>d1dgwa_ b.82.1.2 (A:) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId: 3823]} Length = 178	Back information, alignment and structure

>d1uika1 b.82.1.2 (A:148-350) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} Length = 203	Back information, alignment and structure

>d2phla1 b.82.1.2 (A:11-210) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} Length = 200	Back information, alignment and structure

>d1lr5a_ b.82.1.2 (A:) Auxin binding protein {Maize (Zea mays) [TaxId: 4577]} Length = 160	Back information, alignment and structure

>d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]} Length = 330	Back information, alignment and structure

>d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]} Length = 330	Back information, alignment and structure

>d1o4ta_ b.82.1.9 (A:) Hypothetical protein TM1287 {Thermotoga maritima [TaxId: 2336]} Length = 115	Back information, alignment and structure

>d1v70a_ b.82.1.9 (A:) Hypothetical protein TTHA0104 {Thermus thermophilus [TaxId: 274]} Length = 105	Back information, alignment and structure

>d1juha_ b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId: 34381]} Length = 348	Back information, alignment and structure

>d1juha_ b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId: 34381]} Length = 348	Back information, alignment and structure

>d2d40a1 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]} Length = 308	Back information, alignment and structure

>d2d40a1 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]} Length = 308	Back information, alignment and structure

>d3bu7a1 b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [TaxId: 89184]} Length = 355	Back information, alignment and structure

>d1od5a1 b.82.1.2 (A:7-251) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} Length = 245	Back information, alignment and structure

>d1fxza1 b.82.1.2 (A:10-248) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} Length = 239	Back information, alignment and structure

>d1x82a_ b.82.1.7 (A:) Glucose-6-phosphate isomerase, GPI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 190	Back information, alignment and structure

>d1sq4a_ b.82.1.11 (A:) Glyoxylate-induced protein PA1140 {Pseudomonas aeruginosa [TaxId: 287]} Length = 273	Back information, alignment and structure

>d1sefa_ b.82.1.11 (A:) Hypothetical protein EF2996 {Enterococcus faecalis [TaxId: 1351]} Length = 250	Back information, alignment and structure

>d1sefa_ b.82.1.11 (A:) Hypothetical protein EF2996 {Enterococcus faecalis [TaxId: 1351]} Length = 250	Back information, alignment and structure

>d1rc6a_ b.82.1.11 (A:) Hypothetical protein YlbA {Escherichia coli [TaxId: 562]} Length = 253	Back information, alignment and structure

>d2phda1 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Pseudaminobacter salicylatoxidans [TaxId: 93369]} Length = 351	Back information, alignment and structure

>d1zrra1 b.82.1.6 (A:1-179) Acireductone dioxygenase {Klebsiella pneumoniae [TaxId: 573]} Length = 179	Back information, alignment and structure

>d1y9qa2 b.82.1.15 (A:83-181) Probable transcriptional regulator VC1968, C-terminal domain {Vibrio cholerae [TaxId: 666]} Length = 99	Back information, alignment and structure

>d1vj2a_ b.82.1.10 (A:) Hypothetical protein TM1459 {Thermotoga maritima [TaxId: 2336]} Length = 114	Back information, alignment and structure

>d2pyta1 b.82.1.24 (A:100-227) Ethanolamine utilization protein EutQ {Salmonella typhimurium [TaxId: 90371]} Length = 128	Back information, alignment and structure

>d2o1qa1 b.82.1.21 (A:1-144) Putative acetyl/propionyl-CoA carboxylase subunit alpha Mpe_A3659 {Rubrivivax gelatinosus [TaxId: 28068]} Length = 144	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		224
d2et1a1		201	Germin {Barley (Hordeum vulgare) [TaxId: 4513]}	100.0
d1fxza2		174	Seed storage 7S protein {Soybean (Glycine max), pr	100.0
d1od5a2		173	Seed storage 7S protein {Soybean (Glycine max), gl	100.0
d1uika2		185	Seed storage 7S protein {Soybean (Glycine max), be	99.97
g1dgw.1		168	Seed storage 7S protein {Jack bean (Canavalia ensi	99.97
d1j58a_		372	Oxalate decarboxylase OxdC (YvrK) {Bacillus subtil	99.96
d2phla2		162	Seed storage 7S protein {French bean (Phaseolus vu	99.94
d1dgwa_		178	Seed storage 7S protein {Jack bean (Canavalia ensi	99.9
d1uija1		170	Seed storage 7S protein {Soybean (Glycine max), be	99.9
d1j58a_		372	Oxalate decarboxylase OxdC (YvrK) {Bacillus subtil	99.89
d1uika1		203	Seed storage 7S protein {Soybean (Glycine max), be	99.87
d2phla1		200	Seed storage 7S protein {French bean (Phaseolus vu	99.84
d1od5a1		245	Seed storage 7S protein {Soybean (Glycine max), gl	99.81
d1fxza1		239	Seed storage 7S protein {Soybean (Glycine max), pr	99.79
d1o4ta_		115	Hypothetical protein TM1287 {Thermotoga maritima [	99.6
d1v70a_		105	Hypothetical protein TTHA0104 {Thermus thermophilu	99.55
d1lr5a_		160	Auxin binding protein {Maize (Zea mays) [TaxId: 45	99.55
d2b8ma1		108	Hypothetical protein MJ0764 {Archaeon Methanococcu	99.53
d1vj2a_		114	Hypothetical protein TM1459 {Thermotoga maritima [	99.45
d1y9qa2		99	Probable transcriptional regulator VC1968, C-termi	99.45
d2f4pa1		134	Hypothetical protein TM1010 {Thermotoga maritima [	99.41
d1x82a_		190	Glucose-6-phosphate isomerase, GPI {Archaeon Pyroc	99.33
d1yhfa1		112	Hypothetical protein SPy1581 {Streptococcus pyogen	99.26
d1juha_		348	Quercetin 2,3-dioxygenase {Aspergillus japonicus [	99.19
d2bnma2		122	Hydroxypropylphosphonic acid epoxidase Fom4, C-ter	99.19
d2d40a1		308	Gentisate 1,2-dioxygenase {Escherichia coli [TaxId	99.16
d1sfna_		245	Hypothetical protein DR1152 {Deinococcus radiodura	99.15
d1sefa_		250	Hypothetical protein EF2996 {Enterococcus faecalis	99.14
d1y3ta1		330	Hypothetical protein YxaG {Bacillus subtilis [TaxI	99.1
d1juha_		348	Quercetin 2,3-dioxygenase {Aspergillus japonicus [	99.1
d1sq4a_		273	Glyoxylate-induced protein PA1140 {Pseudomonas aer	99.1
d1y3ta1		330	Hypothetical protein YxaG {Bacillus subtilis [TaxI	99.09
d1rc6a_		253	Hypothetical protein YlbA {Escherichia coli [TaxId	99.09
d1sefa_		250	Hypothetical protein EF2996 {Enterococcus faecalis	99.02
d1sq4a_		273	Glyoxylate-induced protein PA1140 {Pseudomonas aer	98.96
d2phda1		351	Gentisate 1,2-dioxygenase {Pseudaminobacter salicy	98.96
d2pyta1		128	Ethanolamine utilization protein EutQ {Salmonella	98.95
d1rc6a_		253	Hypothetical protein YlbA {Escherichia coli [TaxId	98.92
d3bu7a1		355	Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [	98.87
d1sfna_		245	Hypothetical protein DR1152 {Deinococcus radiodura	98.73
d2d40a1		308	Gentisate 1,2-dioxygenase {Escherichia coli [TaxId	98.7
d3bu7a1		355	Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [	98.69
d2phda1		351	Gentisate 1,2-dioxygenase {Pseudaminobacter salicy	98.65
d1zrra1		179	Acireductone dioxygenase {Klebsiella pneumoniae [T	98.64
d1vr3a1		179	Acireductone dioxygenase {Mouse (Mus musculus) [Ta	98.58
d2o1qa1		144	Putative acetyl/propionyl-CoA carboxylase subunit	98.22
d2pa7a1		135	dTDP-6-deoxy-3,4-keto-hexulose isomerase FdtA {Ane	98.14
d2arca_		161	Regulatory protein AraC {Escherichia coli [TaxId:	97.83
d1o5ua_		88	Hypothetical protein TM1112 {Thermotoga maritima [	97.56
d1zvfa1		175	3-hydroxyanthranilate-3,4-dioxygenase {Baker's yea	97.54
d3elna1		186	Cysteine dioxygenase type I {Rattus norvegicus [Ta	97.44
d1yfua1		174	3-hydroxyanthranilate-3,4-dioxygenase {Ralstonia m	97.43
d2gm6a1		192	Cysteine dioxygenase type I {Ralstonia eutropha [T	97.4
d1wlta1		176	dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeo	97.01
d1vrba1		319	Putative asparaginyl hydroxylase YxbC {Bacillus su	96.99
d1dzra_		183	dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Salmone	96.96
d2ixca1		198	dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Mycobac	96.91
d2ixha1		184	dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Pseudom	96.71
d1oi6a_		202	dTDP-4-keto-6-deoxy-glucose-5-epimerase EvaD {Amyc	96.65
d1ep0a_		183	dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeo	96.54
d2c0za1		190	Novobiocin biosynthesis protein NovW {Streptomyces	96.47
d1eyba_		439	Homogentisate dioxygenase {Human (Homo sapiens) [T	96.21
d1nxma_		194	dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Strepto	95.91
d1tq5a1		231	Hypothetical protein YhhW {Escherichia coli [TaxId	95.41
d1h2ka_		335	Hypoxia-inducible factor HIF ihhibitor (FIH1) {Hum	95.13
d1j1la_		288	Pirin {Human (Homo sapiens) [TaxId: 9606]}	95.02
d1pmia_		440	Phosphomannose isomerase {Yeast (Candida albicans)	93.46
d1znpa1		140	Hypothetical protein Atu3615 {Agrobacterium tumefa	92.83
d3dl3a1		96	Tellurite resistance protein B, TehB {Vibrio fisch	92.39
d3bb6a1		109	Uncharacterized protein YeaR {Escherichia coli [Ta	91.14
d1qwra_		315	Mannose-6-phosphate isomerase ManA {Bacillus subti	90.3
d1xrua1		277	5-keto-4-deoxyuronate isomerase KduI {Escherichia	88.36
d1e5ra_		290	Type II Proline 3-hydroxylase (proline oxidase) {S	87.59
d1tq5a1		231	Hypothetical protein YhhW {Escherichia coli [TaxId	87.55
d2zcwa2		112	Transcriptional regulator TTHA1359, N-terminal dom	86.96
d1j1la_		288	Pirin {Human (Homo sapiens) [TaxId: 9606]}	86.96
d2oyza1		93	Uncharacterized protein VPA0057 {Vibrio parahaemol	85.76
d1ft9a2		132	CO-sensing protein CooA, N-terminal domain {Rhodos	85.05
d1i5za2		132	Catabolite gene activator protein, N-terminal doma	84.29
d1ywka1		260	5-keto-4-deoxyuronate isomerase KduI {Enterococcus	84.14
d1yuda1		158	Hypothetical protein SO0799 {Shewanella oneidensis	82.83
d2oz6a2		134	Cyclic AMP receptor-like protein Vfr {Pseudomonas	81.39
d1zx5a1		299	Putative mannosephosphate isomerase AF0035 {Archae	80.43

>d2et1a1 b.82.1.2 (A:1-201) Germin {Barley (Hordeum vulgare) [TaxId: 4513]}	Back information, alignment and structure

class: All beta proteins
fold: Double-stranded beta-helix
superfamily: RmlC-like cupins
family: Germin/Seed storage 7S protein
domain: Germin
species: Barley (Hordeum vulgare) [TaxId: 4513]

Probab=100.00  E-value=3.9e-62  Score=408.31  Aligned_cols=199  Identities=46%  Similarity=0.737  Sum_probs=189.8

Q ss_pred             cCCCCccceEeecCCCCC-CceecCcccCCCCCCCCCCceeecCCCCCCccCCCCceEEEeccCCCCCcccccEEEEEEE
Q 027381           23 TDPGHLQDVCVAINDPKD-GVFVNGKFCKDPKLARAEDFFFSGLGKPGNTANRLGVDETDANVEQIPGLNTLGISAFRID  101 (224)
Q Consensus        23 ~d~~~~~dfcv~~~~~~~-~~~~~g~~ck~~~~v~~~df~f~~~~~~~~~~~~~g~~v~~~~~~~~P~l~~~gis~a~v~  101 (224)
                      ||||||||||||  |+++ ++++||||||+++.++++||+|+++.++++++|+.|++++.+++.+||+||++|++++|++
T Consensus         1 sdp~~lqdfcva--d~~~~~~~~~g~~ck~~~~~~~~~f~~~~l~~~~~~~~~~g~~vt~~~~~~fP~Ln~lglS~~rv~   78 (201)
T d2et1a1           1 TDPDPLQDFCVA--DLDGKAVSVNGHTCKPMSEAGDDFLFSSKLTKAGNTSTPNGSAVTELDVAEWPGTNTLGVSMNRVD   78 (201)
T ss_dssp             CCCCCSSSCCCB--CCCTTSCCCSSCCBCCGGGCCSCTTCCCTTSSCCCCCSTTSEEEEEESTTTCGGGTTSSCEEEEEE
T ss_pred             CCCcccceeEee--cCCCCccccCCcccCChhhccccceeecccccCCCccCCCCcEEEEeehhcCccccccceeEEEEE
Confidence            799999999999  8865 5899999999999999999999999999999999999999999999999999999999999


Q ss_pred             EcCCccCCCccCCCCcEEEEEEecEEEEEEEecCCCCCeEEEEEeCCCCEEEECCCCeeEEEecCCCcEEEEEEecCCCC
Q 027381          102 YAPYGQRPPHIHPRASEIFLVLEGTLYVGFVTSDQLNNTLIAKVLNKGDVFVFPQGLIHFQFNIGKTNAAAYSALNSQFP  181 (224)
Q Consensus       102 l~pgg~~~pH~Hp~a~Ei~~Vl~G~~~v~~~~~~~~g~~~~~~~L~~GDv~~~P~G~~H~~~N~g~~~a~~i~~~~s~~p  181 (224)
                      ++||++++|||||+|+|++||++|+++++++.+..+++++++++|++||+++||+|.+||++|.|+++++++++|++++|
T Consensus        79 l~pgg~~~PH~Hp~A~Ei~yV~~G~~~v~~v~~~~~~~~~~~~~l~~GDv~vvP~G~~H~~~N~g~~~a~~i~~f~s~~p  158 (201)
T d2et1a1          79 FAPGGTNPPHIHPRATEIGMVMKGELLVGILGSLDSGNKLYSRVVRAGETFVIPRGLMHFQFNVGKTEAYMVVSFNSQNP  158 (201)
T ss_dssp             ECTTCEEEEEECTTCCEEEEEEESCEEEEEECCGGGTTCEEEEEECTTCEEEECTTCCEEEEECSSSCEEEEEEESSSCC
T ss_pred             ECCCCCcCCcccCCCCEEEEEEcceEEEEEEeccCCCceeEEEEecCCCEEEECCCCeEEEEEcCCCCEEEEEEecCCCC
Confidence            99999999999999999999999999999986421137889999999999999999999999999999999999999999


Q ss_pred             cceechhhhhcCCCCCCHHHHHhhcCCCHHHHHHHhhhhcCC
Q 027381          182 GEVTIADTVFGANPSINPDFLGKAFQLDPKIVKDLQNKFING  223 (224)
Q Consensus       182 g~~~~~~~lf~~~p~~~~~vla~~f~~d~~~v~~l~~~~~~~  223 (224)
                      |.+.++.++|+++|.+|+|||+++|++|+++++|||++|+++
T Consensus       159 g~~~~~~~~f~~~~~~p~eVLa~af~i~~~~v~kLks~f~g~  200 (201)
T d2et1a1         159 GIVFVPLTLFGSDPPIPTPVLTKALRVEAGVVELLKSKFAGG  200 (201)
T ss_dssp             CCEEHHHHHHHCSSCCCHHHHHHHHTSCHHHHHHHHHTTTTC
T ss_pred             cceehhhhhhccCCCCCHHHHHHHhCCCHHHHHHHHhhccCC
Confidence            999999999999999999999999999999999999999976

PyMOL of d2et1a1

>d1fxza2 b.82.1.2 (A:297-470) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]}	Back information, alignment and structure

>d1od5a2 b.82.1.2 (A:321-493) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]}	Back information, alignment and structure

>d1uika2 b.82.1.2 (A:351-535) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]}	Back information, alignment and structure

>d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d2phla2 b.82.1.2 (A:220-381) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]}	Back information, alignment and structure

>d1dgwa_ b.82.1.2 (A:) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId: 3823]}	Back information, alignment and structure

>d1uija1 b.82.1.2 (A:6-175) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin beta subunit [TaxId: 3847]}	Back information, alignment and structure

>d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1uika1 b.82.1.2 (A:148-350) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]}	Back information, alignment and structure

>d2phla1 b.82.1.2 (A:11-210) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]}	Back information, alignment and structure

>d1od5a1 b.82.1.2 (A:7-251) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]}	Back information, alignment and structure

>d1fxza1 b.82.1.2 (A:10-248) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]}	Back information, alignment and structure

>d1o4ta_ b.82.1.9 (A:) Hypothetical protein TM1287 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1v70a_ b.82.1.9 (A:) Hypothetical protein TTHA0104 {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1lr5a_ b.82.1.2 (A:) Auxin binding protein {Maize (Zea mays) [TaxId: 4577]}	Back information, alignment and structure

>d2b8ma1 b.82.1.18 (A:1-108) Hypothetical protein MJ0764 {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d1vj2a_ b.82.1.10 (A:) Hypothetical protein TM1459 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1y9qa2 b.82.1.15 (A:83-181) Probable transcriptional regulator VC1968, C-terminal domain {Vibrio cholerae [TaxId: 666]}	Back information, alignment and structure

>d2f4pa1 b.82.1.9 (A:2-135) Hypothetical protein TM1010 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1x82a_ b.82.1.7 (A:) Glucose-6-phosphate isomerase, GPI {Archaeon Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1yhfa1 b.82.1.9 (A:1-112) Hypothetical protein SPy1581 {Streptococcus pyogenes [TaxId: 1314]}	Back information, alignment and structure

>d1juha_ b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId: 34381]}	Back information, alignment and structure

>d2bnma2 b.82.1.10 (A:77-198) Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain {Streptomyces wedmorensis [TaxId: 43759]}	Back information, alignment and structure

>d2d40a1 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1sfna_ b.82.1.11 (A:) Hypothetical protein DR1152 {Deinococcus radiodurans [TaxId: 1299]}	Back information, alignment and structure

>d1sefa_ b.82.1.11 (A:) Hypothetical protein EF2996 {Enterococcus faecalis [TaxId: 1351]}	Back information, alignment and structure

>d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1juha_ b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId: 34381]}	Back information, alignment and structure

>d1sq4a_ b.82.1.11 (A:) Glyoxylate-induced protein PA1140 {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1rc6a_ b.82.1.11 (A:) Hypothetical protein YlbA {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1sefa_ b.82.1.11 (A:) Hypothetical protein EF2996 {Enterococcus faecalis [TaxId: 1351]}	Back information, alignment and structure

>d1sq4a_ b.82.1.11 (A:) Glyoxylate-induced protein PA1140 {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d2phda1 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Pseudaminobacter salicylatoxidans [TaxId: 93369]}	Back information, alignment and structure

>d2pyta1 b.82.1.24 (A:100-227) Ethanolamine utilization protein EutQ {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d1rc6a_ b.82.1.11 (A:) Hypothetical protein YlbA {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d3bu7a1 b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [TaxId: 89184]}	Back information, alignment and structure

>d1sfna_ b.82.1.11 (A:) Hypothetical protein DR1152 {Deinococcus radiodurans [TaxId: 1299]}	Back information, alignment and structure

>d2d40a1 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d3bu7a1 b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [TaxId: 89184]}	Back information, alignment and structure

>d2phda1 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Pseudaminobacter salicylatoxidans [TaxId: 93369]}	Back information, alignment and structure

>d1zrra1 b.82.1.6 (A:1-179) Acireductone dioxygenase {Klebsiella pneumoniae [TaxId: 573]}	Back information, alignment and structure

>d1vr3a1 b.82.1.6 (A:1-179) Acireductone dioxygenase {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2o1qa1 b.82.1.21 (A:1-144) Putative acetyl/propionyl-CoA carboxylase subunit alpha Mpe_A3659 {Rubrivivax gelatinosus [TaxId: 28068]}	Back information, alignment and structure

>d2pa7a1 b.82.1.1 (A:2-136) dTDP-6-deoxy-3,4-keto-hexulose isomerase FdtA {Aneurinibacillus thermoaerophilus [TaxId: 143495]}	Back information, alignment and structure

>d2arca_ b.82.4.1 (A:) Regulatory protein AraC {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1o5ua_ b.82.1.8 (A:) Hypothetical protein TM1112 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1zvfa1 b.82.1.20 (A:1-175) 3-hydroxyanthranilate-3,4-dioxygenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d3elna1 b.82.1.19 (A:5-190) Cysteine dioxygenase type I {Rattus norvegicus [TaxId: 10116]}	Back information, alignment and structure

>d1yfua1 b.82.1.20 (A:1-174) 3-hydroxyanthranilate-3,4-dioxygenase {Ralstonia metallidurans [TaxId: 119219]}	Back information, alignment and structure

>d2gm6a1 b.82.1.19 (A:11-202) Cysteine dioxygenase type I {Ralstonia eutropha [TaxId: 106590]}	Back information, alignment and structure

>d1wlta1 b.82.1.1 (A:1-176) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeon Sulfolobus tokodaii [TaxId: 111955]}	Back information, alignment and structure

>d1vrba1 b.82.2.11 (A:8-326) Putative asparaginyl hydroxylase YxbC {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1dzra_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d2ixca1 b.82.1.1 (A:1-198) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d2ixha1 b.82.1.1 (A:1-184) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1oi6a_ b.82.1.1 (A:) dTDP-4-keto-6-deoxy-glucose-5-epimerase EvaD {Amycolatopsis orientalis [TaxId: 31958]}	Back information, alignment and structure

>d1ep0a_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]}	Back information, alignment and structure

>d2c0za1 b.82.1.1 (A:1-190) Novobiocin biosynthesis protein NovW {Streptomyces caeruleus [TaxId: 195949]}	Back information, alignment and structure

>d1eyba_ b.82.1.4 (A:) Homogentisate dioxygenase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nxma_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Streptococcus suis [TaxId: 1307]}	Back information, alignment and structure

>d1tq5a1 b.82.1.12 (A:1-231) Hypothetical protein YhhW {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1h2ka_ b.82.2.6 (A:) Hypoxia-inducible factor HIF ihhibitor (FIH1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1j1la_ b.82.1.12 (A:) Pirin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1pmia_ b.82.1.3 (A:) Phosphomannose isomerase {Yeast (Candida albicans) [TaxId: 5476]}	Back information, alignment and structure

>d1znpa1 b.82.1.16 (A:4-143) Hypothetical protein Atu3615 {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d3dl3a1 b.82.2.13 (A:5-100) Tellurite resistance protein B, TehB {Vibrio fischeri [TaxId: 668]}	Back information, alignment and structure

>d3bb6a1 b.82.2.13 (A:1-109) Uncharacterized protein YeaR {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1qwra_ b.82.1.3 (A:) Mannose-6-phosphate isomerase ManA {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1xrua1 b.82.1.13 (A:1-277) 5-keto-4-deoxyuronate isomerase KduI {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1e5ra_ b.82.2.4 (A:) Type II Proline 3-hydroxylase (proline oxidase) {Streptomyces sp. [TaxId: 1931]}	Back information, alignment and structure

>d1tq5a1 b.82.1.12 (A:1-231) Hypothetical protein YhhW {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1j1la_ b.82.1.12 (A:) Pirin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2oyza1 b.82.1.22 (A:2-94) Uncharacterized protein VPA0057 {Vibrio parahaemolyticus [TaxId: 670]}	Back information, alignment and structure

>d1ft9a2 b.82.3.1 (A:2-133) CO-sensing protein CooA, N-terminal domain {Rhodospirillum rubrum [TaxId: 1085]}	Back information, alignment and structure

>d1i5za2 b.82.3.2 (A:6-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1ywka1 b.82.1.13 (A:1001-1260) 5-keto-4-deoxyuronate isomerase KduI {Enterococcus faecalis [TaxId: 1351]}	Back information, alignment and structure

>d1yuda1 b.82.1.16 (A:1-158) Hypothetical protein SO0799 {Shewanella oneidensis [TaxId: 70863]}	Back information, alignment and structure

>d2oz6a2 b.82.3.2 (A:9-142) Cyclic AMP receptor-like protein Vfr {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1zx5a1 b.82.1.3 (A:1-299) Putative mannosephosphate isomerase AF0035 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure