Citrus Sinensis ID: 027385

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220----
MEGSANERITFGKMGYGCKHYRRRCRIRAPCCNEIFDCRHCHNEAASMLRNPYDRHELVRQDVKQVICSVCDTEQPVAQVCTNCGVNMGEYFCDICKFYDDDIEKGQFHCDDCGICRIGGRENYFHCKRCGSCYSTSLRNNHLCIENSMHHHCPICYEYLFDSLRNTTVMKCGHTMHCECYHEMIKRDKYCCPICSKSVIDMSRTWKRIDEEMNSSIFFPSFFR
ccccccccccccccccccccccccccEEcccccccccccccHHcccccccccccccccccccccEEEEcccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccEEEEcccccccHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHccccccccc
cccccHHHHHccccccccHHccccEEEEccccccEEEccccccccccccccccHcccccHHHHHHHHHHHccccccccHHHcccccHHHHHHHHHcEccccccccccEccccccEEEcccccccEEccccccEEEEEEcccccEEHccccccccccHHHHccccccEEEcccccHHHHHHHHHHHHccccccccccccHccHHHHHHHHHHHHHHcccccHccc
megsaneritfgkmgygckhyrrrcrirapccneifdcrhcHNEAAsmlrnpydrhelVRQDVKQVICSVCDTEQPVAQVCTncgvnmgeyfCDICKFYdddiekgqfhcddcgicriggrenyfhckrcgscystslrnnhlciensmhhhcpiCYEYLFDSlrnttvmkcghtmhcECYHemikrdkyccpicsksvidmSRTWKRIdeemnssiffpsffr
megsaneritfgkmgygckhyrRRCRIRAPCCNEIFDCRHCHNEAASMLRNPYDRHELVRQDVKQVICSVCDTEQPVAQVCTNCGVNMGEYFCDICKFYDDDIEKGQFHCDDCGICRIGGRENYFHCKRCGSCYSTSLRNNHLCIENSMHHHCPICYEYLFDSLRNTTVMKCGHTMHCECYHEMIKRDKYCCPICSKSVIDMSRTWKRIDeemnssiffpsffr
MEGSANERITFGKMGYGCKHYRRRCRIRAPCCNEIFDCRHCHNEAASMLRNPYDRHELVRQDVKQVICSVCDTEQPVAQVCTNCGVNMGEYFCDICKFYDDDIEKGQFHCDDCGICRIGGRENYFHCKRCGSCYSTSLRNNHLCIENSMHHHCPICYEYLFDSLRNTTVMKCGHTMHCECYHEMIKRDKYCCPICSKSVIDMSRTWKRIDEEMNSSIFFPSFFR
********ITFGKMGYGCKHYRRRCRIRAPCCNEIFDCRHCHNEAASMLRNPYDRHELVRQDVKQVICSVCDTEQPVAQVCTNCGVNMGEYFCDICKFYDDDIEKGQFHCDDCGICRIGGRENYFHCKRCGSCYSTSLRNNHLCIENSMHHHCPICYEYLFDSLRNTTVMKCGHTMHCECYHEMIKRDKYCCPICSKSVIDMSRTWKRIDEEMNSSIFF*****
***************YGCKHYRRRCRIRAPCCNEIFDCRHCHNEAASMLRNPYDRHELVRQDVKQVICSVCDTEQPVAQVCTNCGVNMGEYFCDICKFYDDDIEKGQFHCDDCGICRIGGRENYFHCKRCGSCYSTSLRNNHLCIENSMHHHCPICYEYLFDSLRNTTVMKCGHTMHCECYHEMIKRDKYCCPICSKSVIDMSRTWKRIDEEMNSSIFF*****
MEGSANERITFGKMGYGCKHYRRRCRIRAPCCNEIFDCRHCHNEAASMLRNPYDRHELVRQDVKQVICSVCDTEQPVAQVCTNCGVNMGEYFCDICKFYDDDIEKGQFHCDDCGICRIGGRENYFHCKRCGSCYSTSLRNNHLCIENSMHHHCPICYEYLFDSLRNTTVMKCGHTMHCECYHEMIKRDKYCCPICSKSVIDMSRTWKRIDEEMNSSIFFPSFFR
**********FGKMGYGCKHYRRRCRIRAPCCNEIFDCRHCHNEAASMLRNPY*RHELVRQDVKQVICSVCDTEQPVAQVCTNCGVNMGEYFCDICKFYDDDIEKGQFHCDDCGICRIGGRENYFHCKRCGSCYSTSLRNNHLCIENSMHHHCPICYEYLFDSLRNTTVMKCGHTMHCECYHEMIKRDKYCCPICSKSVIDMSRTWKRIDEEMNSSIFFP****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEGSANERITFGKMGYGCKHYRRRCRIRAPCCNEIFDCRHCHNEAASMLRNPYDRHELVRQDVKQVICSVCDTEQPVAQVCTNCGVNMGEYFCDICKFYDDDIEKGQFHCDDCGICRIGGRENYFHCKRCGSCYSTSLRNNHLCIENSMHHHCPICYEYLFDSLRNTTVMKCGHTMHCECYHEMIKRDKYCCPICSKSVIDMSRTWKRIDEEMNSSIFFPSFFR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query224 2.2.26 [Sep-21-2011]
Q9CR50261 RING finger and CHY zinc yes no 0.875 0.750 0.423 1e-42
Q96PM5261 RING finger and CHY zinc yes no 0.946 0.812 0.402 2e-42
O14099425 Uncharacterized RING fing yes no 0.839 0.442 0.432 7e-40
>sp|Q9CR50|ZN363_MOUSE RING finger and CHY zinc finger domain-containing protein 1 OS=Mus musculus GN=Rchy1 PE=1 SV=1 Back     alignment and function desciption
 Score =  172 bits (437), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 88/208 (42%), Positives = 127/208 (61%), Gaps = 12/208 (5%)

Query: 17  GCKHYRRRCRIRAPCCNEIFDCRHCHNEAASMLRNPYDRHELVRQDVKQVICSVCDTEQP 76
           GC+HY R C ++APCC++++ CR CH+          + H+L R  VK+V C  C+  Q 
Sbjct: 19  GCEHYDRACLLKAPCCDKLYTCRLCHDTN--------EDHQLDRFKVKEVQCINCEKLQH 70

Query: 77  VAQVCTNCGVNMGEYFCDICKFYDDDIEKGQFHCDDCGICRIGGRENYFHCKRCGSCYST 136
             Q C +C    GEY+C IC  +D D  K Q+HC+ CGICRIG +E++FHC +C  C +T
Sbjct: 71  AQQTCEDCSTLFGEYYCSICHLFDKD--KRQYHCESCGICRIGPKEDFFHCLKCNLCLTT 128

Query: 137 SLRNNHLCIENSMHHHCPICYEYLFDSLRNTTVMKCGHTMHCECYHEMIKRDKYCCPICS 196
           +LR  H CIEN    +CPIC E +  S     V+ CGH +H  CY EM+K + Y CP+C 
Sbjct: 129 NLRGKHKCIENVSRQNCPICLEDIHTSRVVAHVLPCGHLLHRTCYEEMLK-EGYRCPLCM 187

Query: 197 KSVIDMSRTWKRIDEEMNSSIFFPSFFR 224
            S +DM+R W+++D E+ +    PS ++
Sbjct: 188 HSALDMTRYWRQLDTEV-AQTPMPSEYQ 214
Mediates E3-dependent ubiquitination and proteasomal degradation of target proteins, including p53/TP53, HDAC1 and CDKN1B. Preferentially acts on tetrameric p53/TP53. Increases AR transcription factor activity (By similarity). Contributes to the regulation of CDKN1B and p53/TP53 levels, and thereby contributes to the regulation of the cell cycle progression.
Mus musculus (taxid: 10090)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q96PM5|ZN363_HUMAN RING finger and CHY zinc finger domain-containing protein 1 OS=Homo sapiens GN=RCHY1 PE=1 SV=1 Back     alignment and function description
>sp|O14099|YERG_SCHPO Uncharacterized RING finger protein C2F3.16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2F3.16 PE=4 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query224
359806446267 uncharacterized protein LOC100792038 [Gl 0.995 0.835 0.808 1e-106
357447417267 RING finger and CHY zinc finger domain-c 0.995 0.835 0.803 1e-106
388519059267 unknown [Medicago truncatula] 0.995 0.835 0.799 1e-105
225432370267 PREDICTED: RING finger and CHY zinc fing 0.973 0.816 0.821 1e-105
358248192267 uncharacterized protein LOC100812839 [Gl 0.995 0.835 0.803 1e-105
356555553267 PREDICTED: RING finger and CHY zinc fing 0.995 0.835 0.799 1e-104
297807887267 zinc finger family protein [Arabidopsis 0.995 0.835 0.785 1e-104
15238890267 ring finger and CHY zinc finger domain-c 0.995 0.835 0.785 1e-103
388496792267 unknown [Lotus japonicus] 0.995 0.835 0.785 1e-102
224102637269 predicted protein [Populus trichocarpa] 0.955 0.795 0.817 1e-102
>gi|359806446|ref|NP_001241502.1| uncharacterized protein LOC100792038 [Glycine max] gi|255646865|gb|ACU23903.1| unknown [Glycine max] Back     alignment and taxonomy information
 Score =  390 bits (1002), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 181/224 (80%), Positives = 206/224 (91%), Gaps = 1/224 (0%)

Query: 1   MEGSANERITFGKMGYGCKHYRRRCRIRAPCCNEIFDCRHCHNEAASMLRNPYDRHELVR 60
           MEGS NER+ FGKMGYGC HYRRRCRIRAPCCNEI+ CRHCHN+AAS+L+NP+DRHELVR
Sbjct: 1   MEGSVNERLDFGKMGYGCNHYRRRCRIRAPCCNEIYSCRHCHNDAASLLKNPFDRHELVR 60

Query: 61  QDVKQVICSVCDTEQPVAQVCTNCGVNMGEYFCDICKFYDDDIEKGQFHCDDCGICRIGG 120
           QDVKQV+CSVCDTEQPVAQVCTNCGV MGEYFC+ICKF+DDD+EK QFHCDDCGICR+GG
Sbjct: 61  QDVKQVVCSVCDTEQPVAQVCTNCGVKMGEYFCNICKFFDDDVEKEQFHCDDCGICRVGG 120

Query: 121 RENYFHCKRCGSCYSTSLRNNHLCIENSMHHHCPICYEYLFDSLRNTTVMKCGHTMHCEC 180
           R+N+FHCK+CGSCY+  LR+NHLC+ENSM HHCPICYEYLFDSL++T VMKCGHTMH EC
Sbjct: 121 RDNFFHCKKCGSCYAIGLRDNHLCVENSMRHHCPICYEYLFDSLKDTIVMKCGHTMHHEC 180

Query: 181 YHEMIKRDKYCCPICSKSVIDMSRTWKRIDEEMNSSIFFPSFFR 224
           Y EMIK DKYCCPICSKSVIDMS+TWKRIDEE+ +++  P  +R
Sbjct: 181 YVEMIKNDKYCCPICSKSVIDMSKTWKRIDEEIEATV-MPEDYR 223

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|357447417|ref|XP_003593984.1| RING finger and CHY zinc finger domain-containing protein [Medicago truncatula] gi|355483032|gb|AES64235.1| RING finger and CHY zinc finger domain-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|388519059|gb|AFK47591.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|225432370|ref|XP_002276039.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1 [Vitis vinifera] gi|297736904|emb|CBI26105.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|358248192|ref|NP_001239836.1| uncharacterized protein LOC100812839 [Glycine max] gi|255636475|gb|ACU18576.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|356555553|ref|XP_003546095.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1-like [Glycine max] Back     alignment and taxonomy information
>gi|297807887|ref|XP_002871827.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] gi|297317664|gb|EFH48086.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15238890|ref|NP_197366.1| ring finger and CHY zinc finger domain-containing protein 1 [Arabidopsis thaliana] gi|17381208|gb|AAL36416.1| unknown protein [Arabidopsis thaliana] gi|20465813|gb|AAM20011.1| unknown protein [Arabidopsis thaliana] gi|332005211|gb|AED92594.1| ring finger and CHY zinc finger domain-containing protein 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|388496792|gb|AFK36462.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|224102637|ref|XP_002312758.1| predicted protein [Populus trichocarpa] gi|222852578|gb|EEE90125.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query224
TAIR|locus:2180074267 MIEL1 "MYB30-Interacting E3 Li 0.995 0.835 0.785 7e-109
TAIR|locus:2099212287 AT3G62970 [Arabidopsis thalian 0.919 0.717 0.645 2.4e-85
TAIR|locus:2172656291 AT5G22920 [Arabidopsis thalian 0.901 0.694 0.620 4.2e-79
TAIR|locus:2179474328 AT5G25560 [Arabidopsis thalian 0.946 0.646 0.572 3.1e-74
DICTYBASE|DDB_G0281595 342 rchy "RING finger and CHY zinc 0.852 0.558 0.453 4.6e-50
ZFIN|ZDB-GENE-040801-73264 rchy1 "ring finger and CHY zin 0.848 0.719 0.42 2e-49
UNIPROTKB|Q96PM5261 RCHY1 "RING finger and CHY zin 0.830 0.712 0.441 1.1e-48
MGI|MGI:1915348261 Rchy1 "ring finger and CHY zin 0.830 0.712 0.441 1.4e-48
UNIPROTKB|A4IFE2261 RCHY1 "RCHY1 protein" [Bos tau 0.830 0.712 0.431 2.9e-48
RGD|1359180261 Rchy1 "ring finger and CHY zin 0.830 0.712 0.431 4.7e-48
TAIR|locus:2180074 MIEL1 "MYB30-Interacting E3 Ligase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1076 (383.8 bits), Expect = 7.0e-109, P = 7.0e-109
 Identities = 176/224 (78%), Positives = 202/224 (90%)

Query:     1 MEGSANERITFGKMGYGCKHYRRRCRIRAPCCNEIFDCRHCHNEAASMLRNPYDRHELVR 60
             ME S N+R+ FGKMG+GCKHY+RRC+IRAPCCNE+FDCRHCHNE+ S LRN YDRH+LVR
Sbjct:     1 MEASPNDRLHFGKMGFGCKHYKRRCQIRAPCCNEVFDCRHCHNESTSTLRNIYDRHDLVR 60

Query:    61 QDVKQVICSVCDTEQPVAQVCTNCGVNMGEYFCDICKFYDDDIEKGQFHCDDCGICRIGG 120
             QDVKQVICSVCDTEQP AQVC+NCGVNMGEYFC IC FYDDD EK QFHCDDCGICR+GG
Sbjct:    61 QDVKQVICSVCDTEQPAAQVCSNCGVNMGEYFCSICIFYDDDTEKQQFHCDDCGICRVGG 120

Query:   121 RENYFHCKRCGSCYSTSLRNNHLCIENSMHHHCPICYEYLFDSLRNTTVMKCGHTMHCEC 180
             REN+FHCK+CGSCY+  LRNNH C+ENSM HHCPICYEYLFDSL++T VMKCGHTMH EC
Sbjct:   121 RENFFHCKKCGSCYAVGLRNNHRCVENSMRHHCPICYEYLFDSLKDTNVMKCGHTMHVEC 180

Query:   181 YHEMIKRDKYCCPICSKSVIDMSRTWKRIDEEMNSSIFFPSFFR 224
             Y+EMIKRDK+CCPICS+SVIDMS+TW+R+DEE+ ++   PS +R
Sbjct:   181 YNEMIKRDKFCCPICSRSVIDMSKTWQRLDEEIEATAM-PSDYR 223
GO:0005634 "nucleus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA;ISS
TAIR|locus:2099212 AT3G62970 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2172656 AT5G22920 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2179474 AT5G25560 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0281595 rchy "RING finger and CHY zinc finger-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040801-73 rchy1 "ring finger and CHY zinc finger domain containing 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q96PM5 RCHY1 "RING finger and CHY zinc finger domain-containing protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1915348 Rchy1 "ring finger and CHY zinc finger domain containing 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|A4IFE2 RCHY1 "RCHY1 protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|1359180 Rchy1 "ring finger and CHY zinc finger domain containing 1, E3 ubiquitin protein ligase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q96PM5ZN363_HUMAN6, ., 3, ., 2, ., -0.40260.94640.8122yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00019811001
SubName- Full=Chromosome chr5 scaffold_2, whole genome shotgun sequence; (267 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query224
pfam0549574 pfam05495, zf-CHY, CHY zinc finger 5e-20
cd0016245 cd00162, RING, RING-finger (Really Interesting New 6e-04
smart0018440 smart00184, RING, Ring finger 0.001
COG1198 730 COG1198, PriA, Primosomal protein N' (replication 0.002
>gnl|CDD|218608 pfam05495, zf-CHY, CHY zinc finger Back     alignment and domain information 
 Score = 80.1 bits (198), Expect = 5e-20
 Identities = 40/84 (47%), Positives = 49/84 (58%), Gaps = 11/84 (13%)

Query: 18  CKHYRRR-CRIRAPCCNEIFDCRHCHNEAASMLRNPYDRHELVRQDVKQVICSVCDTEQP 76
           CKHY R  C IRAPCCN+ + CR CH+E           H L R +VK V+C VC TEQ 
Sbjct: 1   CKHYHRNLCAIRAPCCNKYYPCRLCHDELED--------HPLDRWNVKAVLCGVCRTEQT 52

Query: 77  VAQVCTNCGVNMGEYFCDICKFYD 100
           V +   NCGV   +Y+C ICK + 
Sbjct: 53  VQE--YNCGVEFADYYCPICKLFF 74

This family of domains are likely to bind to zinc ions. They contain many conserved cysteine and histidine residues. We have named this domain after the N-terminal motif CXHY. This domain can be found in isolation in some proteins, but is also often associated with pfam00097. One of the proteins in this family is a mitochondrial intermembrane space protein called Hot13. This protein is involved in the assembly of small TIM complexes. Length = 74
>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>gnl|CDD|214546 smart00184, RING, Ring finger Back     alignment and domain information
>gnl|CDD|224119 COG1198, PriA, Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 224
KOG1940276 consensus Zn-finger protein [General function pred 100.0
PF0549571 zf-CHY: CHY zinc finger; InterPro: IPR008913 Zinc 99.9
COG4357105 Zinc finger domain containing protein (CHY type) [ 99.7
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 99.46
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 99.13
cd0016245 RING RING-finger (Really Interesting New Gene) dom 99.07
COG5243 491 HRD1 HRD ubiquitin ligase complex, ER membrane com 99.06
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 99.0
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.94
PHA02929238 N1R/p28-like protein; Provisional 98.91
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 98.85
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.79
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 98.78
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.78
PF1463444 zf-RING_5: zinc-RING finger domain 98.72
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 98.67
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 98.61
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.53
PF1459961 zinc_ribbon_6: Zinc-ribbon; PDB: 2K2D_A. 98.47
KOG0802 543 consensus E3 ubiquitin ligase [Posttranslational m 98.46
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 98.44
PHA02926242 zinc finger-like protein; Provisional 98.34
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 98.23
smart0050463 Ubox Modified RING finger domain. Modified RING fi 98.14
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 98.12
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 98.06
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 97.96
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 97.94
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 97.9
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 97.75
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 97.73
KOG149384 consensus Anaphase-promoting complex (APC), subuni 97.72
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 97.71
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 97.66
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 97.63
KOG0823 230 consensus Predicted E3 ubiquitin ligase [Posttrans 97.56
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 97.41
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 97.39
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 97.39
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 97.37
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 97.24
KOG1941518 consensus Acetylcholine receptor-associated protei 97.22
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 97.02
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 96.92
KOG2930114 consensus SCF ubiquitin ligase, Rbx1 component [Po 96.73
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 96.66
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 96.62
KOG0825 1134 consensus PHD Zn-finger protein [General function 96.51
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 96.42
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 96.38
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 96.32
KOG1039344 consensus Predicted E3 ubiquitin ligase [Posttrans 96.26
KOG1785 563 consensus Tyrosine kinase negative regulator CBL [ 96.24
COG52191525 Uncharacterized conserved protein, contains RING Z 96.24
KOG1645 463 consensus RING-finger-containing E3 ubiquitin liga 96.15
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 95.98
PF1290647 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. 95.96
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 95.8
KOG1428 3738 consensus Inhibitor of type V adenylyl cyclases/Ne 95.71
PRK1489059 putative Zn-ribbon RNA-binding protein; Provisiona 95.7
KOG3970 299 consensus Predicted E3 ubiquitin ligase [Posttrans 95.65
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 94.8
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 94.45
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 94.28
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 94.15
KOG4739 233 consensus Uncharacterized protein involved in syna 94.04
KOG0824 324 consensus Predicted E3 ubiquitin ligase [Posttrans 94.0
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 93.92
KOG3002 299 consensus Zn finger protein [General function pred 93.89
KOG4185 296 consensus Predicted E3 ubiquitin ligase [Posttrans 93.67
KOG3800 300 consensus Predicted E3 ubiquitin ligase containing 93.62
KOG3268234 consensus Predicted E3 ubiquitin ligase [Posttrans 93.21
COG288861 Predicted Zn-ribbon RNA-binding protein with a fun 92.53
KOG0297 391 consensus TNF receptor-associated factor [Signal t 92.32
PF1277350 DZR: Double zinc ribbon 92.18
COG5175 480 MOT2 Transcriptional repressor [Transcription] 92.0
PHA02862156 5L protein; Provisional 91.94
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 91.48
PF04641260 Rtf2: Rtf2 RING-finger 91.45
KOG1002 791 consensus Nucleotide excision repair protein RAD16 91.08
PF0719170 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 91.07
PF07800162 DUF1644: Protein of unknown function (DUF1644); In 91.05
KOG4445 368 consensus Uncharacterized conserved protein, conta 90.91
KOG1814 445 consensus Predicted E3 ubiquitin ligase [Posttrans 90.63
KOG2660 331 consensus Locus-specific chromosome binding protei 90.36
KOG3161 861 consensus Predicted E3 ubiquitin ligase [Posttrans 90.0
KOG3039303 consensus Uncharacterized conserved protein [Funct 89.74
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 89.72
COG5152259 Uncharacterized conserved protein, contains RING a 89.41
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 89.13
KOG03091081 consensus Conserved WD40 repeat-containing protein 89.11
PHA02825162 LAP/PHD finger-like protein; Provisional 88.97
PF0385450 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc 88.51
KOG2817394 consensus Predicted E3 ubiquitin ligase [Posttrans 87.36
PF1324826 zf-ribbon_3: zinc-ribbon domain 86.77
KOG1952 950 consensus Transcription factor NF-X1, contains NFX 86.73
KOG2034911 consensus Vacuolar sorting protein PEP3/VPS18 [Int 86.48
PRK04023 1121 DNA polymerase II large subunit; Validated 86.38
COG5236 493 Uncharacterized conserved protein, contains RING Z 85.12
PF1057126 UPF0547: Uncharacterised protein family UPF0547; I 84.72
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 84.61
PF0289150 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 84.22
smart0073426 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18 83.96
PF1324023 zinc_ribbon_2: zinc-ribbon domain 83.71
PF0874643 zf-RING-like: RING-like domain; InterPro: IPR01485 82.85
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 82.54
PF0719170 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 81.87
PRK14559 645 putative protein serine/threonine phosphatase; Pro 81.57
PHA0062659 hypothetical protein 81.21
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 81.01
PRK14714 1337 DNA polymerase II large subunit; Provisional 80.39
>KOG1940 consensus Zn-finger protein [General function prediction only] Back     alignment and domain information 
Probab=100.00  E-value=6.6e-58  Score=408.28  Aligned_cols=209  Identities=48%  Similarity=1.034  Sum_probs=201.9

Q ss_pred             CccccccCCCCccCccccccccceecCCCCCcccChhhHHhhhcCCCCCCCcccccccccCeeEeCCCCccccccccCCC
Q 027385            4 SANERITFGKMGYGCKHYRRRCRIRAPCCNEIFDCRHCHNEAASMLRNPYDRHELVRQDVKQVICSVCDTEQPVAQVCTN   83 (224)
Q Consensus         4 ~~~~~~~~~~~~~gC~HY~r~c~l~~pCC~~~y~Cr~CHde~~~~~~~~~~~H~~~r~~~~~vlC~~C~~~q~~~~~C~~   83 (224)
                      ..+++.|++.++.+|+||+|++.+++|+|+++|+|++||+++.        +|.++|+.|.+|+|+.|.++|+++++|.+
T Consensus        21 ~~~~~~d~~~~~~~c~hy~r~~~~~a~ccd~~~~C~hCH~~s~--------~h~~~r~~v~~~~C~~C~~~q~~~~~c~~   92 (276)
T KOG1940|consen   21 IHSDAEDEIAFPYGCPHYRRNCKSRAPCCDREITCRHCHNESE--------DHDLDRKTVYELLCMKCRKIQPVGQICSN   92 (276)
T ss_pred             cccccccccccccCCchhhhccccccccccceeeeEEecChhh--------hcccchhhhhhhhhhhHHhhhhhhhcccc
Confidence            3556789999999999999999999999999999999999974        69999999999999999999999999999


Q ss_pred             CCCCcceeecCccccccCCCCcCeeccCCCCcceeCCccceeecCccCccccccccCcceeecCCCCCCCccchhhcccC
Q 027385           84 CGVNMGEYFCDICKFYDDDIEKGQFHCDDCGICRIGGRENYFHCKRCGSCYSTSLRNNHLCIENSMHHHCPICYEYLFDS  163 (224)
Q Consensus        84 Cg~~f~~Y~C~~C~l~dd~~~k~~yHC~~CgiCR~G~~~~~fHC~~C~~C~s~~l~~~H~C~e~~~~~~CpICle~lf~s  163 (224)
                      |+..+++|||.+|+||||+++ .||||+.|||||+|++++||||++|+.|++..+.++|+|+|++++.|||||.|+||++
T Consensus        93 c~~~~g~~~c~~C~l~dd~~~-~~~hC~~C~icr~g~~~~~fhc~~c~~c~~~~~~~~H~c~e~~~~~ncPic~e~l~~s  171 (276)
T KOG1940|consen   93 CHVELGEYYCLICKLFDDDPS-KQYHCDLCGICREGLGLDFFHCKKCKACLSAYLSNWHKCVERSSEFNCPICKEYLFLS  171 (276)
T ss_pred             chhhhhhhcCccccccccccc-ceeccccccccccccccchhHHhhhHhHHhhhcccccchhhhcccCCCchhHHHhccc
Confidence            999999999999999999999 9999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCceeEeccCCccCHHHHHHHHhcCcCCCCCCccccccchHHHHHHHHHHhcCCCCcCcc
Q 027385          164 LRNTTVMKCGHTMHCECYHEMIKRDKYCCPICSKSVIDMSRTWKRIDEEMNSSIFFPSFF  223 (224)
Q Consensus       164 ~~~v~~LpCGH~~H~~C~~~~l~~~~~~CPiCrksi~dm~~~~~~lD~~i~~~pmp~~y~  223 (224)
                      ...+.+|+|||.+|..||++++..+ |+||+|.+ +.||+.+|+++|.+|+++|||++|.
T Consensus       172 ~~~~~~~~CgH~~h~~cf~e~~~~~-y~CP~C~~-~~d~~~~~~~~d~~l~~~~~p~~y~  229 (276)
T KOG1940|consen  172 FEDAGVLKCGHYMHSRCFEEMICEG-YTCPICSK-PGDMSHYFRKLDKELAGSPMPEEYK  229 (276)
T ss_pred             cccCCccCcccchHHHHHHHHhccC-CCCCcccc-hHHHHHHHHHHHHHHhcCCCCchhh
Confidence            9999999999999999999999865 99999999 9999999999999999999999985

>PF05495 zf-CHY: CHY zinc finger; InterPro: IPR008913 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG4357 Zinc finger domain containing protein (CHY type) [Function unknown] Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>PF14599 zinc_ribbon_6: Zinc-ribbon; PDB: 2K2D_A Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] Back     alignment and domain information
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional Back     alignment and domain information
>KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3268 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>PF12773 DZR: Double zinc ribbon Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>PF07191 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13248 zf-ribbon_3: zinc-ribbon domain Back     alignment and domain information
>KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] Back     alignment and domain information
>KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK04023 DNA polymerase II large subunit; Validated Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger Back     alignment and domain information
>PF13240 zinc_ribbon_2: zinc-ribbon domain Back     alignment and domain information
>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>PF07191 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length Back     alignment and domain information
>PRK14559 putative protein serine/threonine phosphatase; Provisional Back     alignment and domain information
>PHA00626 hypothetical protein Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information
>PRK14714 DNA polymerase II large subunit; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query224
2dkt_A143 Solution Structure Of The Chy Zinc Finger Domain Of 2e-26
2k2c_A137 Solution Nmr Structure Of N-Terminal Domain Of Huma 2e-25
2jrj_A52 Solution Structure Of The Human Pirh2 Ring-H2 Domai 2e-04
2ecm_A55 Solution Structure Of The Ring Domain Of The Ring F 3e-04
>pdb|2DKT|A Chain A, Solution Structure Of The Chy Zinc Finger Domain Of The Ring Finger And Chy Zinc Finger Domain-Containing Protein 1 From Mus Musculus Length = 143 Back     alignment and structure 
Iteration: 1

 Score =  115 bits (289), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 58/132 (43%), Positives = 82/132 (62%), Gaps = 10/132 (7%)
Query: 17  GCKHYRRRCRIRAPCCNEIFDCRHCHNEAASMLRNPYDRHELVRQDVKQVICSVCDTEQP 76
           GC+HY R C ++APCC++++ CR CH+          + H+L R  VK+V C  C+  Q 
Sbjct: 18  GCEHYDRACLLKAPCCDKLYTCRLCHDTN--------EDHQLDRFKVKEVQCINCEKLQH 69
Query: 77  VAQVCTNCGVNMGEYFCDICKFYDDDIEKGQFHCDDCGICRIGGRENYFHCKRCGSCYST 136
             Q C +C    GEY+C IC  +D D  K Q+HC+ CGICRIG +E++FHC +C  C +T
Sbjct: 70  AQQTCEDCSTLFGEYYCSICHLFDKD--KRQYHCESCGICRIGPKEDFFHCLKCNLCLTT 127
Query: 137 SLRNNHLCIENS 148
           +LR  H CIE+ 
Sbjct: 128 NLRGKHKCIESG 139
>pdb|2K2C|A Chain A, Solution Nmr Structure Of N-Terminal Domain Of Human Pirh2. Northeast Structural Genomics Consortium (Nesg) Target Ht2a Length = 137 Back     alignment and structure
>pdb|2JRJ|A Chain A, Solution Structure Of The Human Pirh2 Ring-H2 Domain. Northeast Structural Genomics Consortium Target Ht2b Length = 52 Back     alignment and structure
>pdb|2ECM|A Chain A, Solution Structure Of The Ring Domain Of The Ring Finger And Chy Zinc Finger Domain-Containing Protein 1 From Mus Musculus Length = 55 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query224
2dkt_A143 Ring finger and CHY zinc finger domain- containing 1e-42
2ecm_A55 Ring finger and CHY zinc finger domain- containing 2e-13
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 2e-07
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 3e-05
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 2e-04
>2dkt_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.89.1.1 g.93.1.1 PDB: 2k2c_A Length = 143 Back     alignment and structure
 Score =  140 bits (353), Expect = 1e-42
 Identities = 60/149 (40%), Positives = 86/149 (57%), Gaps = 10/149 (6%)

Query: 2   EGSANERITFGKMGYGCKHYRRRCRIRAPCCNEIFDCRHCHNEAASMLRNPYDRHELVRQ 61
            GS+       +   GC+HY R C ++APCC++++ CR CH+          + H+L R 
Sbjct: 3   SGSSGGVRNLAQGPRGCEHYDRACLLKAPCCDKLYTCRLCHDTN--------EDHQLDRF 54

Query: 62  DVKQVICSVCDTEQPVAQVCTNCGVNMGEYFCDICKFYDDDIEKGQFHCDDCGICRIGGR 121
            VK+V C  C+  Q   Q C +C    GEY+C IC  +D D  K Q+HC+ CGICRIG +
Sbjct: 55  KVKEVQCINCEKLQHAQQTCEDCSTLFGEYYCSICHLFDKD--KRQYHCESCGICRIGPK 112

Query: 122 ENYFHCKRCGSCYSTSLRNNHLCIENSMH 150
           E++FHC +C  C +T+LR  H CIE+   
Sbjct: 113 EDFFHCLKCNLCLTTNLRGKHKCIESGPS 141
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Length = 78 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query224
2dkt_A143 Ring finger and CHY zinc finger domain- containing 100.0
2ecm_A55 Ring finger and CHY zinc finger domain- containing 99.48
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 99.41
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 99.4
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 99.39
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 99.38
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 99.38
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 99.34
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 99.33
2ect_A78 Ring finger protein 126; metal binding protein, st 99.31
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.29
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.29
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 99.28
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 99.26
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 99.24
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.21
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 99.2
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 99.19
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 99.17
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.15
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.15
2k2d_A79 Ring finger and CHY zinc finger domain- containing 99.14
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.13
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.11
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.1
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.1
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.08
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.07
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 99.05
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.05
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 99.04
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 99.02
2ysj_A63 Tripartite motif-containing protein 31; ring-type 99.01
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 99.0
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 98.99
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 98.98
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 98.98
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 98.98
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 98.98
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 98.97
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.97
2ecw_A85 Tripartite motif-containing protein 30; metal bind 98.96
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 98.95
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 98.94
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 98.92
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 98.91
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 98.83
1z6u_A150 NP95-like ring finger protein isoform B; structura 98.81
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 98.74
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 98.7
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 98.65
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 98.64
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 98.64
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 98.63
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 98.57
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 98.53
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 98.52
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 98.46
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.44
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.44
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.41
2ea5_A68 Cell growth regulator with ring finger domain prot 98.41
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 98.4
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 98.38
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 98.35
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 98.25
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.24
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 98.21
2f42_A179 STIP1 homology and U-box containing protein 1; cha 98.04
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 97.89
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 97.8
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 97.57
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 97.55
3nw0_A238 Non-structural maintenance of chromosomes element 96.05
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 92.76
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 91.2
2jrp_A81 Putative cytoplasmic protein; two-zinc binding pro 90.74
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 90.42
2jne_A101 Hypothetical protein YFGJ; zinc fingers, two zinc, 87.07
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 86.4
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 85.32
>2dkt_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.89.1.1 g.93.1.1 PDB: 2k2c_A Back     alignment and structure
Probab=100.00  E-value=3.2e-57  Score=369.04  Aligned_cols=139  Identities=42%  Similarity=1.050  Sum_probs=131.7

Q ss_pred             CCccccccCCCCccCccccccccceecCCCCCcccChhhHHhhhcCCCCCCCcccccccccCeeEeCCCCccccccccCC
Q 027385            3 GSANERITFGKMGYGCKHYRRRCRIRAPCCNEIFDCRHCHNEAASMLRNPYDRHELVRQDVKQVICSVCDTEQPVAQVCT   82 (224)
Q Consensus         3 ~~~~~~~~~~~~~~gC~HY~r~c~l~~pCC~~~y~Cr~CHde~~~~~~~~~~~H~~~r~~~~~vlC~~C~~~q~~~~~C~   82 (224)
                      ++....+|++++++||+||+|+|+|+||||++|||||+||||++        +|+++|+++++|+||+|+++|++++.|+
T Consensus         4 ~~~~~~~~~~~~~~gC~HY~r~~~lr~pCC~k~y~Cr~CHde~~--------dH~l~r~~~~~vlCg~C~~~q~~~~~C~   75 (143)
T 2dkt_A            4 GSSGGVRNLAQGPRGCEHYDRACLLKAPCCDKLYTCRLCHDTNE--------DHQLDRFKVKEVQCINCEKLQHAQQTCE   75 (143)
T ss_dssp             CCCCCCCCCCCCSSSCSSCCCSEEEEETTTTEEESSHHHHHHTS--------SSCCCSSSCCCEEESSSCCEECSCSBCS
T ss_pred             CCCCcccccccCcCCCcccCCCeeEECCCCCCccchhhhhcccc--------ccccchhccceeeecccCccccccCcCC
Confidence            45556789999999999999999999999999999999999974        6999999999999999999999999999


Q ss_pred             CCCCCcceeecCccccccCCCCcCeeccCCCCcceeCCccceeecCccCccccccccCcceeecCCCCC
Q 027385           83 NCGVNMGEYFCDICKFYDDDIEKGQFHCDDCGICRIGGRENYFHCKRCGSCYSTSLRNNHLCIENSMHH  151 (224)
Q Consensus        83 ~Cg~~f~~Y~C~~C~l~dd~~~k~~yHC~~CgiCR~G~~~~~fHC~~C~~C~s~~l~~~H~C~e~~~~~  151 (224)
                      +||+.||+|||+||||||  ++|+||||++|||||||+++|||||++||+|||++|+++|+|+|+++++
T Consensus        76 ~Cg~~f~~Y~C~~C~l~d--~~k~~yHC~~CgiCR~G~~~~ffHC~~C~~C~s~~l~~~H~C~e~~~~s  142 (143)
T 2dkt_A           76 DCSTLFGEYYCSICHLFD--KDKRQYHCESCGICRIGPKEDFFHCLKCNLCLTTNLRGKHKCIESGPSS  142 (143)
T ss_dssp             SSCCBSCSEECSSSCCEE--CSSSEEEETTTTEEEESCGGGEEEETTTTEEEEGGGSSSSCCSCCCSCC
T ss_pred             CCCccceeeEeceeeccc--CCCceecCCCCCceeccCCcCcEECCcCCeeeccccCcCcccCccCccC
Confidence            999999999999999997  4699999999999999999999999999999999999999999999864
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2k2d_A Ring finger and CHY zinc finger domain- containing protein 1; zinc-binding protein, cytoplasm, metal-binding, nucleus, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Back     alignment and structure
>2jrp_A Putative cytoplasmic protein; two-zinc binding protein, structural genomics, PSI-2, protein structure initiative; NMR {Salmonella typhimurium LT2} Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>2jne_A Hypothetical protein YFGJ; zinc fingers, two zinc, structural genomics, PSI-2, protein structure initiative; NMR {Escherichia coli} SCOP: g.41.18.1 Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 224
d2dkta256 g.93.1.1 (A:82-137) RING finger and CHY zinc finge 2e-20
d2dkta174 g.89.1.1 (A:8-81) RING finger and CHY zinc finger 2e-11
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 9e-05
d1ur6b_52 g.44.1.1 (B:) Not-4 N-terminal RING finger domain 0.001
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 0.004
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 0.004
>d2dkta2 g.93.1.1 (A:82-137) RING finger and CHY zinc finger domain-containing protein 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 56 Back     information, alignment and structure

class: Small proteins
fold: Zinc hairpin stack
superfamily: Zinc hairpin stack
family: Zinc hairpin stack
domain: RING finger and CHY zinc finger domain-containing protein 1
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 79.0 bits (195), Expect = 2e-20
 Identities = 32/58 (55%), Positives = 42/58 (72%), Gaps = 2/58 (3%)

Query: 89  GEYFCDICKFYDDDIEKGQFHCDDCGICRIGGRENYFHCKRCGSCYSTSLRNNHLCIE 146
           GEY+C IC  +D D  K Q+HC+ CGICRIG +E++FHC +C  C +T+LR  H CIE
Sbjct: 1   GEYYCSICHLFDKD--KRQYHCESCGICRIGPKEDFFHCLKCNLCLTTNLRGKHKCIE 56
>d2dkta1 g.89.1.1 (A:8-81) RING finger and CHY zinc finger domain-containing protein 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 74 Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query224
d2dkta256 RING finger and CHY zinc finger domain-containing 99.96
d2dkta174 RING finger and CHY zinc finger domain-containing 99.73
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 99.51
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 99.47
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 99.4
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.4
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 99.34
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.31
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 99.28
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.0
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 98.96
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 98.94
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 98.93
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 98.86
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 98.78
d2c2la280 STIP1 homology and U box-containing protein 1, STU 98.78
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 98.72
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 98.56
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 97.82
d2jnea171 Hypothetical protein YfgJ {Escherichia coli [TaxId 89.18
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 89.16
d2dkta256 RING finger and CHY zinc finger domain-containing 87.53
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 82.3
>d2dkta2 g.93.1.1 (A:82-137) RING finger and CHY zinc finger domain-containing protein 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Small proteins
fold: Zinc hairpin stack
superfamily: Zinc hairpin stack
family: Zinc hairpin stack
domain: RING finger and CHY zinc finger domain-containing protein 1
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.96  E-value=8.4e-31  Score=179.99  Aligned_cols=56  Identities=57%  Similarity=1.450  Sum_probs=54.0

Q ss_pred             ceeecCccccccCCCCcCeeccCCCCcceeCCccceeecCccCccccccccCcceeec
Q 027385           89 GEYFCDICKFYDDDIEKGQFHCDDCGICRIGGRENYFHCKRCGSCYSTSLRNNHLCIE  146 (224)
Q Consensus        89 ~~Y~C~~C~l~dd~~~k~~yHC~~CgiCR~G~~~~~fHC~~C~~C~s~~l~~~H~C~e  146 (224)
                      ++|||+|||||||+  |++|||++|||||||+++|||||++||+|+|++|+++|+|+|
T Consensus         1 G~YfC~iC~l~ddd--k~~yHC~~CgiCRvG~~~~ffHC~~C~~C~~~~l~~~H~CiE   56 (56)
T d2dkta2           1 GEYYCSICHLFDKD--KRQYHCESCGICRIGPKEDFFHCLKCNLCLTTNLRGKHKCIE   56 (56)
T ss_dssp             CSEECSSSCCEECS--SSEEEETTTTEEEESCGGGEEEETTTTEEEEGGGSSSSCCSC
T ss_pred             CceECCcCCcccCC--CCcccCCCCCceeecCCccccccCccccccCcccCCCccccC
Confidence            68999999999885  999999999999999999999999999999999999999997
>d2dkta1 g.89.1.1 (A:8-81) RING finger and CHY zinc finger domain-containing protein 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jnea1 g.41.18.1 (A:1-71) Hypothetical protein YfgJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2dkta2 g.93.1.1 (A:82-137) RING finger and CHY zinc finger domain-containing protein 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure