Citrus Sinensis ID: 027420

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220---

MAVRGAAAIACTTRGRNPFVSSANHYFFMRFHHSPSRSFQRFTSHPNHRSGYRNQIRAIQGATADPLTSKKEYDKDPSPENWKIKMLYDGDCPLCMREVNMLKERNKQYGTIKFVDISSDEYSIEENQGLDYKTVMGSIHAIVSDGTVVTDVEAFRRLYEEVGLGWVYAITKYEPIAKIADFVYSVWAKYRLQITGRPPLEEILEARRKNKGEVCGDNKSCQM

cccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccccHHHHHHHHHHHccccccEEEEEcccccccHHHHccccHHHHHcccEEEEcccEEEEcHHHHHHHHHHcccHHHHHHHHHcHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHcccccccccccccc

cccHEHHEEEEcccccccccccccccccccccccccccccccccccccccccEEEEEEEcccEEccccccHcccccccccccEEEEEEccccHHHHHHHHHHHHHccccccEEEEEcccccccccccccccHHHHHHHHccEcccccEEccHHHHHHHHHHHccccEEEccccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcHHccccccccc

MAVRGAAAIACttrgrnpfvssanhyffmrfhhspsrsfqrftshpnhrsgyRNQIRAIQgatadpltskkeydkdpspenwkikmlydgdcplcMREVNMLKErnkqygtikfvdissdeysieenqgldyktvmGSIHAIvsdgtvvtDVEAFRRLYEEVGLGWVYAITKYEPIAKIADFVYSVWAKYRlqitgrppLEEILEARRknkgevcgdnkscqm

MAVRGAAAiacttrgrnpfVSSANHYFFMRFHHSPSRSFQRFTSHPNHRSGYRNQIRAIQGatadpltskkeydkdpspenwkikmLYDGDCPLCMREVNMLKERNKQYGTIKFVDISSDEYSIEENQGLDYKTVMGSIHAIVSDGTVVTDVEAFRRLYEEVGLGWVYAITKYEPIAKIADFVYSVWAKYRLQITGRPPLEEILEarrknkgevcgdnkscqm

******AAIACTTRGRNPFVSSANHYFFMRFH*************************************************WKIKMLYDGDCPLCMREVNMLKERNKQYGTIKFVDISSDEYSIEENQGLDYKTVMGSIHAIVSDGTVVTDVEAFRRLYEEVGLGWVYAITKYEPIAKIADFVYSVWAKYRLQITGRP*************************

************************************************************************************KMLYDGDCPLCMREVNMLKERNKQYGTIKFVDISSDEYSIEENQGLDYKTVMGSIHAIVSDGTVVTDVEAFRRLYEEVGLGWVYAITKYEPIAKIADFVYSVWAKYRLQITGRPPLEEIL************D**SCQ*

*AVRGAAAIACTTRGRNPFVSSANHYFFMRFHHSPSRSFQRFTSHPNHRSGYRNQIRAIQGATADPLTS********SPENWKIKMLYDGDCPLCMREVNMLKERNKQYGTIKFVDISSDEYSIEENQGLDYKTVMGSIHAIVSDGTVVTDVEAFRRLYEEVGLGWVYAITKYEPIAKIADFVYSVWAKYRLQITGRPPLEEILEARRKNKG**C********

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		223	2.2.26 [Sep-21-2011]
Q8W485		214	Uncharacterized protein A	yes	no	0.946	0.985	0.610	4e-74

>sp\|Q8W485\|Y5010_ARATH Uncharacterized protein At5g50100, mitochondrial OS=Arabidopsis thaliana GN=At5g50100 PE=1 SV=1	Back alignment and function desciption

 Score =  277 bits (709), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 138/226 (61%), Positives = 171/226 (75%), Gaps = 15/226 (6%)

Query: 1   MAVRGAAAIACTT---RGRNPFVSSANHYFFMRFHHSPSRSFQRFTSHPNHRSGYRNQIR 57
           MA RGA A A +T     RNP + S + +F   F+H       R        +G++ Q+R
Sbjct: 1   MATRGAVAAAASTIWKHRRNPSLRSLSRHFNPNFNH-------RIIP-----TGFKYQVR 48

Query: 58  AIQGATADPLTSKKEYDKDPSPENWKIKMLYDGDCPLCMREVNMLKERNKQYGTIKFVDI 117
           AIQG + DP+ +  +  ++P P+NWKIKMLYDGDCPLCMREVNML ERN+++GTIKFVDI
Sbjct: 49  AIQGTSTDPVITPLKNREEPKPQNWKIKMLYDGDCPLCMREVNMLMERNEKHGTIKFVDI 108

Query: 118 SSDEYSIEENQGLDYKTVMGSIHAIVSDGTVVTDVEAFRRLYEEVGLGWVYAITKYEPIA 177
           SS++YS E+NQGLDYKTVMG IHAI SDG VV  VEAFRRLYEEVGLGWVY ITK+EPI 
Sbjct: 109 SSNDYSPEDNQGLDYKTVMGQIHAIQSDGNVVKGVEAFRRLYEEVGLGWVYTITKFEPIG 168

Query: 178 KIADFVYSVWAKYRLQITGRPPLEEILEARRKNKGEVCGDNKSCQM 223
           K+AD VY VWAKYRLQ+TGRP +E ILEAR+K+K E CG++K+C++
Sbjct: 169 KLADVVYDVWAKYRLQVTGRPSIEAILEARKKDKVETCGESKNCKI 214

Arabidopsis thaliana (taxid: 3702)

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		223
255587476		222	conserved hypothetical protein [Ricinus	0.982	0.986	0.663	3e-79
225457126		215	PREDICTED: uncharacterized protein At5g5	0.860	0.893	0.742	4e-78
363807536		227	uncharacterized protein LOC100814016 [Gl	0.950	0.933	0.665	9e-76
297792301		213	hypothetical protein ARALYDRAFT_495066 [	0.946	0.990	0.626	4e-73
224135751		167	predicted protein [Populus trichocarpa]	0.748	1.0	0.764	5e-73
18423105		214	putative thiol-disulfide oxidoreductase	0.946	0.985	0.610	2e-72
18146782		221	PBng143 [Vigna radiata]	0.968	0.977	0.638	3e-72
449440704		223	PREDICTED: uncharacterized protein At5g5	0.977	0.977	0.584	6e-70
363807530		208	uncharacterized protein LOC100785087 [Gl	0.869	0.932	0.669	1e-69
388518351		216	unknown [Lotus japonicus]	0.834	0.861	0.676	2e-68

>gi\|255587476\|ref\|XP_002534285.1\| conserved hypothetical protein [Ricinus communis] gi\|223525573\|gb\|EEF28096.1\| conserved hypothetical protein [Ricinus communis]	Back alignment and taxonomy information

 Score =  300 bits (768), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 150/226 (66%), Positives = 174/226 (76%), Gaps = 7/226 (3%)

Query: 1   MAVRGAAAIACTTRGRNPFVSSAN--HYFFMRFHHSPSRSFQRFTSHPNHRSG-YRNQIR 57
           MA++G    AC    R  + SS +   Y   RFHHS S   +RFT +P  ++G +   +R
Sbjct: 1   MAIKGVVT-ACNVARRGSYQSSLSVPRYLTFRFHHSSSYPPKRFTFYPTSQTGKFMYSVR 59

Query: 58  AIQGATADPLTSKKEYDKDPSPENWKIKMLYDGDCPLCMREVNMLKERNKQYGTIKFVDI 117
           AI  A  DP+T+KK+ ++  +P  WKIKMLYDGDCPLCMREVNML+ERNK Y TIKFVDI
Sbjct: 60  AIHKAIVDPVTTKKKNEEKSTP--WKIKMLYDGDCPLCMREVNMLRERNKSYDTIKFVDI 117

Query: 118 SSDEYSIEENQGLDYKTVMGSIHAIVSDGTVVTDVEAFRRLYEEVGLGWVYAITKYEPIA 177
           SS +YS EENQGLDY TVMG IHAI+SDGT+VTDVEAFRRLYE+VGLGWVYAITKYEPI 
Sbjct: 118 SSKDYSPEENQGLDYTTVMGRIHAILSDGTIVTDVEAFRRLYEQVGLGWVYAITKYEPIG 177

Query: 178 KIADFVYSVWAKYRLQITGRPPLEEILEARRKNKGEVCGDNKSCQM 223
            IAD VYS WAKYRLQITGRPPLEEIL AR+K KGEVC DN +C+M
Sbjct: 178 SIADVVYSFWAKYRLQITGRPPLEEILVARKK-KGEVCNDNNTCKM 222

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|225457126\|ref\|XP_002283569.1\| PREDICTED: uncharacterized protein At5g50100, mitochondrial [Vitis vinifera] gi\|297733833\|emb\|CBI15080.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|363807536\|ref\|NP_001242657.1\| uncharacterized protein LOC100814016 [Glycine max] gi\|255647257\|gb\|ACU24096.1\| unknown [Glycine max]	Back alignment and taxonomy information

>gi\|297792301\|ref\|XP_002864035.1\| hypothetical protein ARALYDRAFT_495066 [Arabidopsis lyrata subsp. lyrata] gi\|297309870\|gb\|EFH40294.1\| hypothetical protein ARALYDRAFT_495066 [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|224135751\|ref\|XP_002322151.1\| predicted protein [Populus trichocarpa] gi\|222869147\|gb\|EEF06278.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi|18423105|ref|NP_568719.1| putative thiol-disulfide oxidoreductase DCC [Arabidopsis thaliana] gi|75162429|sp|Q8W485.1|Y5010_ARATH RecName: Full=Uncharacterized protein At5g50100, mitochondrial; Flags: Precursor gi|17065380|gb|AAL32844.1| Unknown protein [Arabidopsis thaliana] gi|20148617|gb|AAM10199.1| unknown protein [Arabidopsis thaliana] gi|21593055|gb|AAM65004.1| unknown [Arabidopsis thaliana] gi|332008513|gb|AED95896.1| putative thiol-disulfide oxidoreductase DCC [Arabidopsis thaliana]

Back alignment and taxonomy information

>gi\|18146782\|dbj\|BAB82450.1\| PBng143 [Vigna radiata]	Back alignment and taxonomy information

>gi\|449440704\|ref\|XP_004138124.1\| PREDICTED: uncharacterized protein At5g50100, mitochondrial-like [Cucumis sativus] gi\|449477382\|ref\|XP_004155007.1\| PREDICTED: uncharacterized protein At5g50100, mitochondrial-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|363807530\|ref\|NP_001242656.1\| uncharacterized protein LOC100785087 [Glycine max] gi\|255639025\|gb\|ACU19813.1\| unknown [Glycine max]	Back alignment and taxonomy information

>gi\|388518351\|gb\|AFK47237.1\| unknown [Lotus japonicus]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		223
TAIR\|locus:2170041		214	AT5G50100 "AT5G50100" [Arabido	0.946	0.985	0.615	7e-70
UNIPROTKB\|Q885H3		163	PSPTO_1860 "Uncharacterized pr	0.556	0.760	0.315	3.5e-11
UNIPROTKB\|Q8EIR5		129	SO_0771 "Thiol-disulphide oxid	0.484	0.837	0.258	5.7e-07
TIGR_CMR\|SO_0771		129	SO_0771 "conserved hypothetica	0.484	0.837	0.258	5.7e-07
UNIPROTKB\|Q74GL0		138	GSU0236 "Uncharacterized prote	0.412	0.666	0.276	9.7e-07
TIGR_CMR\|GSU_0236		138	GSU_0236 "conserved hypothetic	0.412	0.666	0.276	9.7e-07
UNIPROTKB\|Q9KR35		139	VC_1812 "Putative uncharacteri	0.475	0.762	0.276	3.6e-06
TIGR_CMR\|VC_1812		139	VC_1812 "conserved hypothetica	0.475	0.762	0.276	3.6e-06

TAIR\|locus:2170041 AT5G50100 "AT5G50100" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 708 (254.3 bits), Expect = 7.0e-70, P = 7.0e-70
 Identities = 139/226 (61%), Positives = 172/226 (76%)

Query:     1 MAVRGAAAIACTT---RGRNPFVSSANHYFFMRFHHSPSRSFQRFTSHPNHRSGYRNQIR 57
             MA RGA A A +T     RNP + S + +F   F+H       R    P   +G++ Q+R
Sbjct:     1 MATRGAVAAAASTIWKHRRNPSLRSLSRHFNPNFNH-------RII--P---TGFKYQVR 48

Query:    58 AIQGATADPLTSKKEYDKDPSPENWKIKMLYDGDCPLCMREVNMLKERNKQYGTIKFVDI 117
             AIQG + DP+ +  +  ++P P+NWKIKMLYDGDCPLCMREVNML ERN+++GTIKFVDI
Sbjct:    49 AIQGTSTDPVITPLKNREEPKPQNWKIKMLYDGDCPLCMREVNMLMERNEKHGTIKFVDI 108

Query:   118 SSDEYSIEENQGLDYKTVMGSIHAIVSDGTVVTDVEAFRRLYEEVGLGWVYAITKYEPIA 177
             SS++YS E+NQGLDYKTVMG IHAI SDG VV  VEAFRRLYEEVGLGWVY ITK+EPI 
Sbjct:   109 SSNDYSPEDNQGLDYKTVMGQIHAIQSDGNVVKGVEAFRRLYEEVGLGWVYTITKFEPIG 168

Query:   178 KIADFVYSVWAKYRLQITGRPPLEEILEARRKNKGEVCGDNKSCQM 223
             K+AD VY VWAKYRLQ+TGRP +E ILEAR+K+K E CG++K+C++
Sbjct:   169 KLADVVYDVWAKYRLQVTGRPSIEAILEARKKDKVETCGESKNCKI 214

GO:0003674 "molecular_function" evidence=ND

GO:0008150 "biological_process" evidence=ND

GO:0010264 "myo-inositol hexakisphosphate biosynthetic process" evidence=RCA

UNIPROTKB\|Q885H3 PSPTO_1860 "Uncharacterized protein" [Pseudomonas syringae pv. tomato str. DC3000 (taxid:223283)]	Back alignment and assigned GO terms

UNIPROTKB\|Q8EIR5 SO_0771 "Thiol-disulphide oxidoreductase DCC family" [Shewanella oneidensis MR-1 (taxid:211586)]	Back alignment and assigned GO terms

TIGR_CMR\|SO_0771 SO_0771 "conserved hypothetical protein" [Shewanella oneidensis MR-1 (taxid:211586)]	Back alignment and assigned GO terms

UNIPROTKB\|Q74GL0 GSU0236 "Uncharacterized protein" [Geobacter sulfurreducens PCA (taxid:243231)]	Back alignment and assigned GO terms

TIGR_CMR\|GSU_0236 GSU_0236 "conserved hypothetical protein" [Geobacter sulfurreducens PCA (taxid:243231)]	Back alignment and assigned GO terms

UNIPROTKB\|Q9KR35 VC_1812 "Putative uncharacterized protein" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)]	Back alignment and assigned GO terms

TIGR_CMR\|VC_1812 VC_1812 "conserved hypothetical protein" [Vibrio cholerae O1 biovar El Tor (taxid:686)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q8W485	Y5010_ARATH	No assigned EC number	0.6106	0.9461	0.9859	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	fgenesh2_kg.8__882__AT5G50100.1	annotation not avaliable (213 aa)
		(Arabidopsis lyrata)
Predicted Functional Partners:
	s4	Short-chain dehydrogenase/reductase family protei (298 aa)	•	0.414

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		223
pfam04134		113	pfam04134, DUF393, Protein of unknown function, DU	5e-28
COG3011		137	COG3011, COG3011, Predicted thiol-disulfide oxidor	6e-15

>gnl\|CDD\|217918 pfam04134, DUF393, Protein of unknown function, DUF393	Back alignment and domain information

 Score =  101 bits (255), Expect = 5e-28
 Identities = 36/114 (31%), Positives = 62/114 (54%), Gaps = 5/114 (4%)

Query: 87  LYDGDCPLCMREVNMLKERNKQYGTIKFVDISSDE-YSIEENQGLDYKTVMGSIHAIVSD 145
           LYDG+CPLC REV  L+ R++  G ++FVDI S E  ++ E  G+D + +   +H +   
Sbjct: 2   LYDGECPLCNREVRFLERRDRG-GRLRFVDIQSAEGQALLEAFGIDPEDLDSRLH-VEDG 59

Query: 146 GTVVTDVEAFRRLYEEVG--LGWVYAITKYEPIAKIADFVYSVWAKYRLQITGR 197
           G V T  +AF  ++  +      + A+ +   +  + D +Y   A+ R ++ GR
Sbjct: 60  GDVYTGSDAFLEIWRLLPGPWRLLAALLRLPRLRPLRDALYRFIARNRYRLFGR 113

Members of this family have two highly conserved cysteine residues near their N-terminus. The function of these proteins is unknown. Length = 113

>gnl\|CDD\|225556 COG3011, COG3011, Predicted thiol-disulfide oxidoreductase [General function prediction only]	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		223
COG3011		137	Predicted thiol-disulfide oxidoreductase [General	99.96
PF04134		114	DUF393: Protein of unknown function, DUF393; Inter	99.96
TIGR02180		84	GRX_euk Glutaredoxin. This model represents eukary	96.31
cd03027		73	GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Eg	95.88
cd02066		72	GRX_family Glutaredoxin (GRX) family; composed of	95.85
cd03419		82	GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX h	95.74
TIGR02190		79	GlrX-dom Glutaredoxin-family domain. This C-termin	95.39
PHA03050		108	glutaredoxin; Provisional	95.13
cd03418		75	GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX b	94.5
PRK10638		83	glutaredoxin 3; Provisional	94.35
PRK11200		85	grxA glutaredoxin 1; Provisional	94.06
cd03040		77	GST_N_mPGES2 GST_N family; microsomal Prostaglandi	94.04
cd02966		116	TlpA_like_family TlpA-like family; composed of Tlp	93.22
TIGR02183		86	GRXA Glutaredoxin, GrxA family. This model include	92.9
cd03028		90	GRX_PICOT_like Glutaredoxin (GRX) family, PKC-inte	92.84
TIGR02189		99	GlrX-like_plant Glutaredoxin-like family. This fam	92.75
cd03041		77	GST_N_2GST_N GST_N family, 2 repeats of the N-term	92.75
cd03029		72	GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hyb	92.73
KOG1422		221	consensus Intracellular Cl- channel CLIC, contains	92.49
TIGR02200		77	GlrX_actino Glutaredoxin-like protein. This family	92.08
cd03055		89	GST_N_Omega GST_N family, Class Omega subfamily; G	92.0
TIGR02181		79	GRX_bact Glutaredoxin, GrxC family. This family of	91.96
TIGR02196		74	GlrX_YruB Glutaredoxin-like protein, YruB-family.	91.77
cd02973		67	TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-	91.76
PRK10329		81	glutaredoxin-like protein; Provisional	91.5
PTZ00051		98	thioredoxin; Provisional	91.21
COG3019		149	Predicted metal-binding protein [General function	90.97
TIGR00365		97	monothiol glutaredoxin, Grx4 family. The gene for	90.31
PF13728		215	TraF: F plasmid transfer operon protein	90.17
TIGR02738		153	TrbB type-F conjugative transfer system pilin asse	90.01
cd00570		71	GST_N_family Glutathione S-transferase (GST) famil	89.92
PRK13703		248	conjugal pilus assembly protein TraF; Provisional	89.74
cd03037		71	GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) sub	89.52
PF00578		124	AhpC-TSA: AhpC/TSA family; InterPro: IPR000866 Per	88.91
TIGR02739		256	TraF type-F conjugative transfer system pilin asse	88.43
cd02967		114	mauD Methylamine utilization (mau) D family; mauD	87.7
PF00085		103	Thioredoxin: Thioredoxin; InterPro: IPR013766 Thio	87.16
PRK10877		232	protein disulfide isomerase II DsbC; Provisional	86.73
cd03045		74	GST_N_Delta_Epsilon GST_N family, Class Delta and	86.7
TIGR01126		102	pdi_dom protein disulfide-isomerase domain. This m	86.56
TIGR02194		72	GlrX_NrdH Glutaredoxin-like protein NrdH. NrdH-red	86.51
cd03059		73	GST_N_SspA GST_N family, Stringent starvation prot	86.46
cd03023		154	DsbA_Com1_like DsbA family, Com1-like subfamily; c	86.37
TIGR00411		82	redox_disulf_1 small redox-active disulfide protei	86.35
cd02982		103	PDI_b'_family Protein Disulfide Isomerase (PDIb')	86.06
cd02949		97	TRX_NTR TRX domain, novel NADPH thioredoxin reduct	85.94
PRK10824		115	glutaredoxin-4; Provisional	85.69
cd03060		71	GST_N_Omega_like GST_N family, Omega-like subfamil	85.63
PRK03147		173	thiol-disulfide oxidoreductase; Provisional	85.43
PRK15412		185	thiol:disulfide interchange protein DsbE; Provisio	85.42
PRK11657		251	dsbG disulfide isomerase/thiol-disulfide oxidase;	85.39
cd01659		69	TRX_superfamily Thioredoxin (TRX) superfamily; a l	85.18
cd02961		101	PDI_a_family Protein Disulfide Isomerase (PDIa) fa	85.12
cd02976		73	NrdH NrdH-redoxin (NrdH) family; NrdH is a small m	84.93
TIGR02740		271	TraF-like TraF-like protein. This protein is relat	84.68
cd03020		197	DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamil	84.63
cd03056		73	GST_N_4 GST_N family, unknown subfamily 4; compose	84.19
PF13098		112	Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_	82.96
cd03051		74	GST_N_GTT2_like GST_N family, Saccharomyces cerevi	82.94
cd03026		89	AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxid	82.34
cd02984		97	TRX_PICOT TRX domain, PICOT (for PKC-interacting c	82.27
cd02968		142	SCO SCO (an acronym for Synthesis of Cytochrome c	82.01
COG4545		85	Glutaredoxin-related protein [Posttranslational mo	81.91
TIGR02187		215	GlrX_arch Glutaredoxin-like domain protein. This f	81.8
cd02972		98	DsbA_family DsbA family; consists of DsbA and DsbA	81.44
cd03036		111	ArsC_like Arsenate Reductase (ArsC) family, unknow	81.4
PTZ00062		204	glutaredoxin; Provisional	81.32
cd02989		113	Phd_like_TxnDC9 Phosducin (Phd)-like family, Thior	81.18
cd03061		91	GST_N_CLIC GST_N family, Chloride Intracellular Ch	80.9
cd02957		113	Phd_like Phosducin (Phd)-like family; composed of	80.87
cd02950		142	TxlA TRX-like protein A (TxlA) family; TxlA was or	80.53
cd02947		93	TRX_family TRX family; composed of two groups: Gro	80.48
PRK13728		181	conjugal transfer protein TrbB; Provisional	80.44
PRK12759		410	bifunctional gluaredoxin/ribonucleoside-diphosphat	80.22

>COG3011 Predicted thiol-disulfide oxidoreductase [General function prediction only]	Back alignment and domain information

Probab=99.96  E-value=3.6e-29  Score=202.73  Aligned_cols=131  Identities=27%  Similarity=0.421  Sum_probs=117.1

Q ss_pred             CCCCCCceEEEEcCCChhhHHHHHHHHhhcccCCCEEEEeCCChhhhH-HHhCCCChhcccceEEEEEeCCeEEehHHHH
Q 027420           77 PSPENWKIKMLYDGDCPLCMREVNMLKERNKQYGTIKFVDISSDEYSI-EENQGLDYKTVMGSIHAIVSDGTVVTDVEAF  155 (223)
Q Consensus        77 ~~~~~~ki~VlYDG~CpLC~~~v~~L~~~d~~~~~I~fvdiqs~~~~~-~~~~gld~e~~~~~lhvv~~dG~v~~G~dA~  155 (223)
                      ++++.+.++|+|||.|+||..+|+||.++|. .++|+|.++|++.+.+ ++..|+++|..  ..|+.+++|+.+.|+||+
T Consensus         3 ~~~~~p~~vvlyDG~C~lC~~~vrfLi~~D~-~~~i~f~~~q~e~g~~~l~~~~l~~~~~--~s~~~~~~g~~~~~sdA~   79 (137)
T COG3011           3 PQMKKPDLVVLYDGVCPLCDGWVRFLIRRDQ-GGRIRFAALQSEPGQALLEAAGLDPEDV--DSVLLVEAGQLLVGSDAA   79 (137)
T ss_pred             CCCCCCCEEEEECCcchhHHHHHHHHHHhcc-CCcEEEEeccCchhhhHHhhcCCChhhh--heeeEecCCceEeccHHH
Confidence            4567888999999999999999999999997 6999999999999876 77889999984  356777999999999999


Q ss_pred             HHHHHHcCchhhhh-hhhccchhhHHHHHHHHHHhhchhccCCCCchhhhHHHhhcc
Q 027420          156 RRLYEEVGLGWVYA-ITKYEPIAKIADFVYSVWAKYRLQITGRPPLEEILEARRKNK  211 (223)
Q Consensus       156 ~~Il~~lp~~wl~~-ll~lppi~~L~d~lY~~IArnR~ri~Gr~~~c~l~~~~~~~~  211 (223)
                      +++++.+|.+|++. .+...| ++++|++|++||+|||+|||+.+-|+++.+++|..
T Consensus        80 ~~i~~~L~~~Wr~~~~~~~lp-~plrD~~Y~~~A~nRyrwfGr~~~~~~~~~~~~~r  135 (137)
T COG3011          80 IRILRLLPGPWRLLVWLWILP-RPLRDRVYDFFADNRYRWFGRKDQCELPPPRERQR  135 (137)
T ss_pred             HHHHHHCCcceeeeehhhccc-hHHHHHHHHHHHHhhhhhcCcccccccCCHHHhhh
Confidence            99999999999965 445555 99999999999999999999999999999997764

>PF04134 DUF393: Protein of unknown function, DUF393; InterPro: IPR007263 The DCC family, named after the conserved N-terminal DxxCxxC motif, encompasses COG3011 from COG	Back alignment and domain information

>TIGR02180 GRX_euk Glutaredoxin	Back alignment and domain information

>cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions	Back alignment and domain information

>cd02066 GRX_family Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain	Back alignment and domain information

>cd03419 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain	Back alignment and domain information

>TIGR02190 GlrX-dom Glutaredoxin-family domain	Back alignment and domain information

>PHA03050 glutaredoxin; Provisional	Back alignment and domain information

>cd03418 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain	Back alignment and domain information

>PRK10638 glutaredoxin 3; Provisional	Back alignment and domain information

>PRK11200 grxA glutaredoxin 1; Provisional	Back alignment and domain information

>cd03040 GST_N_mPGES2 GST_N family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2	Back alignment and domain information

>cd02966 TlpA_like_family TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins	Back alignment and domain information

>TIGR02183 GRXA Glutaredoxin, GrxA family	Back alignment and domain information

>cd03028 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins	Back alignment and domain information

>TIGR02189 GlrX-like_plant Glutaredoxin-like family	Back alignment and domain information

>cd03041 GST_N_2GST_N GST_N family, 2 repeats of the N-terminal domain of soluble GSTs (2 GST_N) subfamily; composed of uncharacterized proteins	Back alignment and domain information

>cd03029 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria	Back alignment and domain information

>KOG1422 consensus Intracellular Cl- channel CLIC, contains GST domain [Inorganic ion transport and metabolism]	Back alignment and domain information

>TIGR02200 GlrX_actino Glutaredoxin-like protein	Back alignment and domain information

>cd03055 GST_N_Omega GST_N family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress	Back alignment and domain information

>TIGR02181 GRX_bact Glutaredoxin, GrxC family	Back alignment and domain information

>TIGR02196 GlrX_YruB Glutaredoxin-like protein, YruB-family	Back alignment and domain information

>cd02973 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-like family; composed of archaeal and bacterial proteins that show similarity to both TRX and GRX, including the C-terminal TRX-fold subdomain of Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO)	Back alignment and domain information

>PRK10329 glutaredoxin-like protein; Provisional	Back alignment and domain information

>PTZ00051 thioredoxin; Provisional	Back alignment and domain information

>COG3019 Predicted metal-binding protein [General function prediction only]	Back alignment and domain information

>TIGR00365 monothiol glutaredoxin, Grx4 family	Back alignment and domain information

>PF13728 TraF: F plasmid transfer operon protein	Back alignment and domain information

>TIGR02738 TrbB type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB	Back alignment and domain information

>cd00570 GST_N_family Glutathione S-transferase (GST) family, N-terminal domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress	Back alignment and domain information

>PRK13703 conjugal pilus assembly protein TraF; Provisional	Back alignment and domain information

>cd03037 GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E	Back alignment and domain information

>PF00578 AhpC-TSA: AhpC/TSA family; InterPro: IPR000866 Peroxiredoxins (Prxs) are a ubiquitous family of antioxidant enzymes that also control cytokine-induced peroxide levels which mediate signal transduction in mammalian cells	Back alignment and domain information

>TIGR02739 TraF type-F conjugative transfer system pilin assembly protein TraF	Back alignment and domain information

>cd02967 mauD Methylamine utilization (mau) D family; mauD protein is the translation product of the mauD gene found in methylotrophic bacteria, which are able to use methylamine as a sole carbon source and a nitrogen source	Back alignment and domain information

>PF00085 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms	Back alignment and domain information

>PRK10877 protein disulfide isomerase II DsbC; Provisional	Back alignment and domain information

>cd03045 GST_N_Delta_Epsilon GST_N family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress	Back alignment and domain information

>TIGR01126 pdi_dom protein disulfide-isomerase domain	Back alignment and domain information

>TIGR02194 GlrX_NrdH Glutaredoxin-like protein NrdH	Back alignment and domain information

>cd03059 GST_N_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E	Back alignment and domain information

>cd03023 DsbA_Com1_like DsbA family, Com1-like subfamily; composed of proteins similar to Com1, a 27-kDa outer membrane-associated immunoreactive protein originally found in both acute and chronic disease strains of the pathogenic bacteria Coxiella burnetti	Back alignment and domain information

>TIGR00411 redox_disulf_1 small redox-active disulfide protein 1	Back alignment and domain information

>cd02982 PDI_b'_family Protein Disulfide Isomerase (PDIb') family, redox inactive TRX-like domain b'; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants	Back alignment and domain information

>cd02949 TRX_NTR TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains	Back alignment and domain information

>PRK10824 glutaredoxin-4; Provisional	Back alignment and domain information

>cd03060 GST_N_Omega_like GST_N family, Omega-like subfamily; composed of uncharacterized proteins with similarity to class Omega GSTs	Back alignment and domain information

>PRK03147 thiol-disulfide oxidoreductase; Provisional	Back alignment and domain information

>PRK15412 thiol:disulfide interchange protein DsbE; Provisional	Back alignment and domain information

>PRK11657 dsbG disulfide isomerase/thiol-disulfide oxidase; Provisional	Back alignment and domain information

>cd01659 TRX_superfamily Thioredoxin (TRX) superfamily; a large, diverse group of proteins containing a TRX-fold	Back alignment and domain information

>cd02961 PDI_a_family Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants	Back alignment and domain information

>cd02976 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile	Back alignment and domain information

>TIGR02740 TraF-like TraF-like protein	Back alignment and domain information

>cd03020 DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamily; V-shaped homodimeric proteins containing a redox active CXXC motif imbedded in a TRX fold	Back alignment and domain information

>cd03056 GST_N_4 GST_N family, unknown subfamily 4; composed of uncharacterized bacterial proteins with similarity to GSTs	Back alignment and domain information

>PF13098 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_A 2L57_A 1EEJ_B 1TJD_A 1JZD_B 1JZO_A 1G0T_B 3GV1_A 1V58_A 2H0H_A	Back alignment and domain information

>cd03051 GST_N_GTT2_like GST_N family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S	Back alignment and domain information

>cd03026 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) subfamily, C-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which then reduces hydrogen peroxide and organic hydroperoxides	Back alignment and domain information

>cd02984 TRX_PICOT TRX domain, PICOT (for PKC-interacting cousin of TRX) subfamily; PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes	Back alignment and domain information

>cd02968 SCO SCO (an acronym for Synthesis of Cytochrome c Oxidase) family; composed of proteins similar to Sco1, a membrane-anchored protein possessing a soluble domain with a TRX fold	Back alignment and domain information

>COG4545 Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR02187 GlrX_arch Glutaredoxin-like domain protein	Back alignment and domain information

>cd02972 DsbA_family DsbA family; consists of DsbA and DsbA-like proteins, including DsbC, DsbG, glutathione (GSH) S-transferase kappa (GSTK), 2-hydroxychromene-2-carboxylate (HCCA) isomerase, an oxidoreductase (FrnE) presumed to be involved in frenolicin biosynthesis, a 27-kDa outer membrane protein, and similar proteins	Back alignment and domain information

>cd03036 ArsC_like Arsenate Reductase (ArsC) family, unknown subfamily; uncharacterized proteins containing a CXXC motif with similarity to thioredoxin (TRX)-fold arsenic reductases, ArsC	Back alignment and domain information

>PTZ00062 glutaredoxin; Provisional	Back alignment and domain information

>cd02989 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thioredoxin (TRX) domain containing protein 9 (TxnDC9) subfamily; composed of predominantly uncharacterized eukaryotic proteins, containing a TRX-like domain without the redox active CXXC motif	Back alignment and domain information

>cd03061 GST_N_CLIC GST_N family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin and similar proteins	Back alignment and domain information

>cd02957 Phd_like Phosducin (Phd)-like family; composed of Phd and Phd-like proteins (PhLP), characterized as cytosolic regulators of G protein functions	Back alignment and domain information

>cd02950 TxlA TRX-like protein A (TxlA) family; TxlA was originally isolated from the cyanobacterium Synechococcus	Back alignment and domain information

>cd02947 TRX_family TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains	Back alignment and domain information

>PRK13728 conjugal transfer protein TrbB; Provisional	Back alignment and domain information

>PRK12759 bifunctional gluaredoxin/ribonucleoside-diphosphate reductase subunit beta; Provisional	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		223
3msz_A		89	Glutaredoxin 1; alpha-beta sandwich, center for st	96.45
1fov_A		82	Glutaredoxin 3, GRX3; active site disulfide, CIS P	96.36
1kte_A		105	Thioltransferase; redox-active center, electron tr	95.7
3qmx_A		99	Glutaredoxin A, glutaredoxin 3; electron transport	95.63
2khp_A		92	Glutaredoxin; thioredoxin type domain, ssgcid, ele	95.62
2klx_A		89	Glutaredoxin; thioredoxin type domain, ssgcid, ele	95.51
1aba_A		87	Glutaredoxin; electron transport; HET: MES; 1.45A	95.47
2l57_A		126	Uncharacterized protein; structural genomics, unkn	95.26
2hze_A		114	Glutaredoxin-1; thioredoxin fold, arsenic, dimethy	94.94
2lqo_A		92	Putative glutaredoxin RV3198.1/MT3292; TRX fold, o	94.87
3ipz_A		109	Monothiol glutaredoxin-S14, chloroplastic; electro	94.82
1zzo_A		136	RV1677; thioredoxin fold, structural genomics, PSI	94.8
1wik_A		109	Thioredoxin-like protein 2; picot homology 2 domai	94.79
3c1r_A		118	Glutaredoxin-1; oxidized form, oxidoreductase, cyt	94.78
2yan_A		105	Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {H	94.7
1lu4_A		136	Soluble secreted antigen MPT53; thioredoxin-like f	94.7
2cq9_A		130	GLRX2 protein, glutaredoxin 2; glutathione-S-trans	94.45
1r7h_A		75	NRDH-redoxin; thioredoxin, glutaredoxin, redox pro	94.29
3gx8_A		121	Monothiol glutaredoxin-5, mitochondrial; TRX fold,	94.24
3ha9_A		165	Uncharacterized thioredoxin-like protein; PSI, MCS	94.13
3h8q_A		114	Thioredoxin reductase 3; oxidoreductase, structura	94.06
3ctg_A		129	Glutaredoxin-2; reduced form, electron transport,	94.06
2lrn_A		152	Thiol:disulfide interchange protein; structural ge	93.62
2ht9_A		146	Glutaredoxin-2; thioredoxin fold, iron-sulfur clus	93.62
2b5x_A		148	YKUV protein, TRXY; thioredoxin-like, oxidoreducta	93.52
3rhb_A		113	ATGRXC5, glutaredoxin-C5, chloroplastic; thioredox	93.51
1ego_A		85	Glutaredoxin; electron transport; NMR {Escherichia	93.46
4evm_A		138	Thioredoxin family protein; structural genomics, n	93.43
3erw_A		145	Sporulation thiol-disulfide oxidoreductase A; thio	93.33
2vlu_A		122	Thioredoxin, thioredoxin H isoform 2.; oxidoreduct	93.22
3zyw_A		111	Glutaredoxin-3; metal binding protein; 1.84A {Homo	93.05
2e7p_A		116	Glutaredoxin; thioredoxin fold, poplar, electron t	93.03
1t1v_A		93	SH3BGRL3, SH3 domain-binding glutamic acid-rich pr	92.97
1h75_A		81	Glutaredoxin-like protein NRDH; electron transport	92.97
1t00_A		112	Thioredoxin, TRX; redox regulation, multifunction	92.89
3ia1_A		154	THIO-disulfide isomerase/thioredoxin; oxidoreducta	92.89
2ct6_A		111	SH3 domain-binding glutamic acid-rich-like protein	92.84
1xfl_A		124	Thioredoxin H1; AT3G51030, structural genomics, pr	92.71
2oe3_A		114	Thioredoxin-3; electron transport, alpha/beta sand	92.71
3fk8_A		133	Disulphide isomerase; APC61824.1, xylella fastidio	92.68
1kng_A		156	Thiol:disulfide interchange protein CYCY; thioredo	92.6
3hdc_A		158	Thioredoxin family protein; ATCC53774, DSM 7210, ,	92.44
2e0q_A		104	Thioredoxin; electron transport; 1.49A {Sulfolobus	92.42
2f9s_A		151	Thiol-disulfide oxidoreductase RESA; thioredoxin-l	92.36
3ic4_A		92	Glutaredoxin (GRX-1); structural genomics, PSI, MC	92.33
1nm3_A		241	Protein HI0572; hybrid, peroxiredoxin, glutaredoxi	92.23
3hxs_A		141	Thioredoxin, TRXP; electron transport; 2.00A {Bact	92.23
1dby_A		107	Chloroplast thioredoxin M CH2; thioredoxin CH2, ch	92.22
3fkf_A		148	Thiol-disulfide oxidoreductase; structural genomic	92.19
2vm1_A		118	Thioredoxin, thioredoxin H isoform 1.; oxidoreduct	92.16
2l5l_A		136	Thioredoxin; structural genomics, electron transpo	92.1
1r26_A		125	Thioredoxin; redox-active disulfide, electron tran	91.98
2l6c_A		110	Thioredoxin; oxidoreductase; NMR {Desulfovibrio vu	91.98
1w4v_A		119	Thioredoxin, mitochondrial; antioxidant enzyme, mi	91.9
2vim_A		104	Thioredoxin, TRX; thioredoxin fold, oxidoreductase	91.79
1syr_A		112	Thioredoxin; SGPP, structural genomics, PSI, prote	91.79
2pu9_C		111	TRX-F, thioredoxin F-type, chloroplast; protein-pr	91.72
1xwb_A		106	Thioredoxin; dimerization, redox regulation, THI X	91.7
2wci_A		135	Glutaredoxin-4; redox-active center, iron-sulfur c	91.61
1ep7_A		112	Thioredoxin CH1, H-type; electron transport; 2.10A	91.57
1fo5_A		85	Thioredoxin; disulfide oxidoreductase, structural	91.56
1ti3_A		113	Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Popul	91.56
3f3q_A		109	Thioredoxin-1; His TAG, electron transport, cytopl	91.45
2l5o_A		153	Putative thioredoxin; structural genomics, unknown	91.32
2wem_A		118	Glutaredoxin-related protein 5; chromosome 14 open	91.29
1thx_A		115	Thioredoxin, thioredoxin 2; oxido-reductase, elect	91.13
3die_A		106	Thioredoxin, TRX; electron transport, SWAP domain,	91.06
3l4n_A		127	Monothiol glutaredoxin-6; C-terminal domain of GRX	90.98
2wz9_A		153	Glutaredoxin-3; protein binding; 1.55A {Homo sapie	90.97
2trx_A		108	Thioredoxin; electron transport; 1.68A {Escherichi	90.9
1fb6_A		105	Thioredoxin M; electron transport; 2.10A {Spinacia	90.76
3m9j_A		105	Thioredoxin; oxidoreductase; 1.10A {Homo sapiens}	90.75
2cvb_A		188	Probable thiol-disulfide isomerase/thioredoxin; re	90.68
2lja_A		152	Putative thiol-disulfide oxidoreductase; structura	90.6
1nsw_A		105	Thioredoxin, TRX; thermostability, electron transp	90.6
2fwh_A		134	Thiol:disulfide interchange protein DSBD; thioredo	90.51
2i4a_A		107	Thioredoxin; acidophIle, disulfide exchange, oxido	90.48
3nzn_A		103	Glutaredoxin; structural genomics, PSI2, MCSG, pro	90.47
2lrt_A		152	Uncharacterized protein; structural genomics, thio	90.45
2i1u_A		121	Thioredoxin, TRX, MPT46; redox protein, electron t	90.44
3uvt_A		111	Thioredoxin domain-containing protein 5; thioredox	90.4
3or5_A		165	Thiol:disulfide interchange protein, thioredoxin p	90.28
2k8s_A		80	Thioredoxin; dimer, structural genomics, PSI-2, pr	90.22
2yzu_A		109	Thioredoxin; redox protein, electron transport, st	90.12
3tco_A		109	Thioredoxin (TRXA-1); disulfide oxidoreductase, ox	90.11
1nho_A		85	Probable thioredoxin; beta sheet, alpha helix, oxi	90.09
3kcm_A		154	Thioredoxin family protein; SGX, thioredoxin prote	90.06
2xc2_A		117	Thioredoxinn; oxidoreductase, protein disulfide re	90.01
3drn_A		161	Peroxiredoxin, bacterioferritin comigratory prote	89.98
3d22_A		139	TRXH4, thioredoxin H-type; electron transport, cyt	89.93
1xvw_A		160	Hypothetical protein RV2238C/MT2298; thioredoxin f	89.92
3gl3_A		152	Putative thiol:disulfide interchange protein DSBE;	89.73
3d6i_A		112	Monothiol glutaredoxin-3; thioredoxin-like, electr	89.66
1faa_A		124	Thioredoxin F; electron transport; 1.85A {Spinacia	89.44
3gyk_A		175	27KDA outer membrane protein; APC61738.2, siliciba	89.37
3raz_A		151	Thioredoxin-related protein; structural genomics,	89.36
1v98_A		140	Thioredoxin; oxidoreductase, structural genomics,	88.87
3qfa_C		116	Thioredoxin; protein-protein complex, rossmann fol	88.84
3cxg_A		133	Putative thioredoxin; malaria, structural GEN oxid	88.81
2j23_A		121	Thioredoxin; immune protein, autoreactivity, cross	88.76
3eur_A		142	Uncharacterized protein; PSI2,MCSG, conserved prot	88.7
2fgx_A		107	Putative thioredoxin; NET3, NESG, GFT-glutaredoxin	88.5
2ywi_A		196	Hypothetical conserved protein; uncharacterized co	88.49
1i5g_A		144	Tryparedoxin II; electron transport; HET: TS5; 1.4	88.4
2k6v_A		172	Putative cytochrome C oxidase assembly protein; th	88.38
1ttz_A		87	Conserved hypothetical protein; structural genomic	88.31
1jfu_A		186	Thiol:disulfide interchange protein TLPA; thioredo	88.2
3gnj_A		111	Thioredoxin domain protein; APC92103, STR genomics	88.12
2b1k_A		168	Thiol:disulfide interchange protein DSBE; C-termin	88.08
3q18_A		239	GSTO-2, glutathione S-transferase omega-2; glutath	88.06
3s9f_A		165	Tryparedoxin; thioredoxin fold, disulfide reductas	87.87
4euy_A		105	Uncharacterized protein; structural genomics, PSI-	87.65
3kh7_A		176	Thiol:disulfide interchange protein DSBE; TRX-like	87.64
1gh2_A		107	Thioredoxin-like protein; redox-active center, ele	87.24
1eej_A		216	Thiol:disulfide interchange protein; oxidoreductas	87.01
2o8v_B		128	Thioredoxin 1; disulfide crosslinked complex, oxid	87.01
2voc_A		112	Thioredoxin; electron transport, homodimer, disulf	86.88
2ppt_A		155	Thioredoxin-2; thiredoxin, zinc finger, oxidoreduc	86.52
2wul_A		118	Glutaredoxin related protein 5; chromosome 14 open	86.17
1o8x_A		146	Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrot	86.16
3ewl_A		142	Uncharacterized conserved protein BF1870; alpha-be	86.0
2vup_A		190	Glutathione peroxidase-like protein; oxidoreductas	85.96
3p2a_A		148	Thioredoxin 2, putative thioredoxin-like protein;	85.9
3gv1_A		147	Disulfide interchange protein; neisseria gonorrhoe	85.89
3fz4_A		120	Putative arsenate reductase; APC61768, structural	85.87
1o73_A		144	Tryparedoxin; electron transport, trypanosomatid,	85.79
3ul3_B		128	Thioredoxin, thioredoxin-2; PTEX, oxidoreductase;	85.68
3hcz_A		148	Possible thiol-disulfide isomerase; APC61559.2, cy	85.58
3vln_A		241	GSTO-1, glutathione S-transferase omega-1; GST fol	85.57
1wjk_A		100	C330018D20RIK protein; glutaredoxin, thioredoxin f	85.52
3eyt_A		158	Uncharacterized protein SPOA0173; thioredoxin-like	85.5
3hd5_A		195	Thiol:disulfide interchange protein DSBA; protein	85.4
3lor_A		160	Thiol-disulfide isomerase and thioredoxins; PSI, M	85.25
3emx_A		135	Thioredoxin; structural genomics, oxidoreductase,	85.2
1v58_A		241	Thiol:disulfide interchange protein DSBG; reduced	85.17
1t3b_A		211	Thiol:disulfide interchange protein DSBC; oxidored	84.95
4hi7_A		228	GI20122; GST, glutathione S-transferase, enzyme fu	84.85
2obi_A		183	PHGPX, GPX-4, phospholipid hydroperoxide glutathio	84.62
3hz4_A		140	Thioredoxin; NYSGXRC, PSI-II, reduced form, protei	84.23
3ir4_A		218	Glutaredoxin 2; glutathione, IDP00895, structural	84.06
3fw2_A		150	Thiol-disulfide oxidoreductase; structural genomic	84.01
3h93_A		192	Thiol:disulfide interchange protein DSBA; disulfid	83.69
4glt_A		225	Glutathione S-transferase-like protein; structural	83.64
3hz8_A		193	Thiol:disulfide interchange protein DSBA; thiol-ox	83.53
3u5r_E		218	Uncharacterized protein; structural genomics, PSI-	83.52
2f51_A		118	Thioredoxin; electron transport; 1.90A {Trichomona	83.48
2ju5_A		154	Thioredoxin disulfide isomerase; protein, oxidored	83.47
1psq_A		163	Probable thiol peroxidase; structural genomics, NY	83.41
4ags_A		471	Thiol-dependent reductase 1; transferase, leishman	83.09
3qav_A		243	RHO-class glutathione S-transferase; cytosol; 2.10	82.91
2p31_A		181	CL683, glutathione peroxidase 7; thioredoxin fold,	82.83
3l9v_A		189	Putative thiol-disulfide isomerase or thioredoxin;	82.81
3aps_A		122	DNAJ homolog subfamily C member 10; thioredoxin fo	82.51
2jad_A		362	Yellow fluorescent protein glutaredoxin fusion pro	82.31
2gs3_A		185	PHGPX, GPX-4, phospholipid hydroperoxide glutathio	82.1
3kp8_A		106	Vkorc1/thioredoxin domain protein; blood coagulati	81.98
2rem_A		193	Disulfide oxidoreductase; disulfide oxidoreductase	81.79
3tdg_A		273	DSBG, putative uncharacterized protein; thioredoxi	81.76
3lwa_A		183	Secreted thiol-disulfide isomerase; thioredoxin, P	81.51
3cmi_A		171	Peroxiredoxin HYR1; thioredoxin-like fold, oxidore	81.21
3bby_A		215	Uncharacterized GST-like protein YFCF; NP_416804.1	81.13
2yj7_A		106	LPBCA thioredoxin; oxidoreductase; 1.65A {Syntheti	81.93
1z6m_A		175	Conserved hypothetical protein; structural genomic	80.9
4hoj_A		210	REGF protein; GST, glutathione S-transferase, enzy	80.6
2hnl_A		225	Glutathione S-transferase 1; prostaglandin synthas	80.5
2imi_A		221	Epsilon-class glutathione S-transferase; HET: GSH;	80.2
1x5e_A		126	Thioredoxin domain containing protein 1; TMX, TXND	80.06

>3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A*	Back alignment and structure

Probab=96.45  E-value=0.0064  Score=42.26  Aligned_cols=77  Identities=16%  Similarity=0.256  Sum_probs=48.9

Q ss_pred             CceEEEEcCCChhhHHHHHHHHhhcccCCCEEEEeCCChhh----hHH-HhCCCChhcccceEEEEEeCCeEEehHHHHH
Q 027420           82 WKIKMLYDGDCPLCMREVNMLKERNKQYGTIKFVDISSDEY----SIE-ENQGLDYKTVMGSIHAIVSDGTVVTDVEAFR  156 (223)
Q Consensus        82 ~ki~VlYDG~CpLC~~~v~~L~~~d~~~~~I~fvdiqs~~~----~~~-~~~gld~e~~~~~lhvv~~dG~v~~G~dA~~  156 (223)
                      .+++||...+||.|.+...+|.++..   .+.++++.....    .++ +..|...... ..+-++.-+|+.+.|++.+.
T Consensus         4 m~v~ly~~~~Cp~C~~~~~~L~~~~i---~~~~~~vd~~~~~~~~~el~~~~g~~~~~~-~~vP~i~i~g~~i~g~~~i~   79 (89)
T 3msz_A            4 MKVKIYTRNGCPYCVWAKQWFEENNI---AFDETIIDDYAQRSKFYDEMNQSGKVIFPI-STVPQIFIDDEHIGGFTELK   79 (89)
T ss_dssp             CCEEEEECTTCHHHHHHHHHHHHTTC---CCEEEECCSHHHHHHHHHHHHTTTCCSSCC-CSSCEEEETTEEEESHHHHH
T ss_pred             eEEEEEEcCCChhHHHHHHHHHHcCC---CceEEEeecCCChhHHHHHHHHhCCCCCCC-CccCEEEECCEEEeChHHHH
Confidence            46788889999999999999988753   466665544322    111 1223200000 12334445999999999999


Q ss_pred             HHHHHc
Q 027420          157 RLYEEV  162 (223)
Q Consensus       157 ~Il~~l  162 (223)
                      .+++.+
T Consensus        80 ~~~~~~   85 (89)
T 3msz_A           80 ANADKI   85 (89)
T ss_dssp             HTHHHH
T ss_pred             HHHHHH
Confidence            987753

PyMOL of 3msz

>1fov_A Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53, electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 3grx_A*	Back alignment and structure

>1kte_A Thioltransferase; redox-active center, electron transport, acetylation; 2.20A {Sus scrofa} SCOP: c.47.1.1 PDB: 1jhb_A 1b4q_A*	Back alignment and structure

>3qmx_A Glutaredoxin A, glutaredoxin 3; electron transport; 1.82A {Synechocystis SP} SCOP: c.47.1.0	Back alignment and structure

>2khp_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Brucella melitensis}	Back alignment and structure

>2klx_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Bartonella henselae}	Back alignment and structure

>1aba_A Glutaredoxin; electron transport; HET: MES; 1.45A {Enterobacteria phage T4} SCOP: c.47.1.1 PDB: 1aaz_A 1de1_A 1de2_A	Back alignment and structure

>2l57_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, PSI protein structure initiative; NMR {Clostridium perfringens}	Back alignment and structure

>2hze_A Glutaredoxin-1; thioredoxin fold, arsenic, dimethylarsenite., electron trans oxidoreductase; 1.80A {Ectromelia virus} PDB: 2hzf_A 2hze_B	Back alignment and structure

>2lqo_A Putative glutaredoxin RV3198.1/MT3292; TRX fold, oxidoreductase; NMR {Mycobacterium tuberculosis}	Back alignment and structure

>3ipz_A Monothiol glutaredoxin-S14, chloroplastic; electron transport, PL redox-active center, transit peptide, transport, oxidoreduc; 2.40A {Arabidopsis thaliana} PDB: 2lku_A	Back alignment and structure

>1zzo_A RV1677; thioredoxin fold, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 1.60A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 3ios_A	Back alignment and structure

>1wik_A Thioredoxin-like protein 2; picot homology 2 domain, picot protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1	Back alignment and structure

>3c1r_A Glutaredoxin-1; oxidized form, oxidoreductase, cytoplasm, electron transport, redox-active center, transport; HET: MES; 2.00A {Saccharomyces cerevisiae} PDB: 3c1s_A* 2jac_A*	Back alignment and structure

>2yan_A Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {Homo sapiens}	Back alignment and structure

>1lu4_A Soluble secreted antigen MPT53; thioredoxin-like fold, structural genomics, PSI, protein structure initiative; 1.12A {Mycobacterium tuberculosis} SCOP: c.47.1.10	Back alignment and structure

>2cq9_A GLRX2 protein, glutaredoxin 2; glutathione-S-transferase, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1r7h_A NRDH-redoxin; thioredoxin, glutaredoxin, redox protein, domain swapping, electron transport; 2.69A {Corynebacterium ammoniagenes} SCOP: c.47.1.1	Back alignment and structure

>3gx8_A Monothiol glutaredoxin-5, mitochondrial; TRX fold, electron transport, mitochondrion, redox-active center, transit peptide, transport; 1.67A {Saccharomyces cerevisiae}	Back alignment and structure

>3ha9_A Uncharacterized thioredoxin-like protein; PSI, MCSG, structural G midwest center for structural genomics, protein structure initiative; 1.70A {Aeropyrum pernix}	Back alignment and structure

>3h8q_A Thioredoxin reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC, developmental protein, differentiation; 2.21A {Homo sapiens} SCOP: c.47.1.0	Back alignment and structure

>3ctg_A Glutaredoxin-2; reduced form, electron transport, mitochondrion, redox-activ transit peptide, transport, oxidoreductase; 1.50A {Saccharomyces cerevisiae} PDB: 3ctf_A 3d4m_A 3d5j_A*	Back alignment and structure

>2lrn_A Thiol:disulfide interchange protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, oxidoreductase; NMR {Bacteroides SP}	Back alignment and structure

>2ht9_A Glutaredoxin-2; thioredoxin fold, iron-sulfur cluster, 2Fe2S, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: GSH; 1.90A {Homo sapiens} PDB: 2fls_A*	Back alignment and structure

>2b5x_A YKUV protein, TRXY; thioredoxin-like, oxidoreductase; NMR {Bacillus subtilis} SCOP: c.47.1.10 PDB: 2b5y_A	Back alignment and structure

>3rhb_A ATGRXC5, glutaredoxin-C5, chloroplastic; thioredoxin fold, thiol-disulfide oxidoreductase, glutaredox oxidoreductase; HET: GSH; 1.20A {Arabidopsis thaliana} PDB: 3rhc_A* 3fz9_A* 3fza_A*	Back alignment and structure

>1ego_A Glutaredoxin; electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 1egr_A 1grx_A* 1qfn_A	Back alignment and structure

>4evm_A Thioredoxin family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.51A {Streptococcus pneumoniae}	Back alignment and structure

>3erw_A Sporulation thiol-disulfide oxidoreductase A; thioredoxin-like fold, RESA-like fold, dithiol, STOA, redox-active center; 2.50A {Bacillus subtilis} SCOP: c.47.1.0	Back alignment and structure

>2vlu_A Thioredoxin, thioredoxin H isoform 2.; oxidoreductase, thioredoxin-fold, protein disulfide reductase; 1.70A {Hordeum vulgare var} PDB: 2vlt_A 2vlv_A 2iwt_A*	Back alignment and structure

>3zyw_A Glutaredoxin-3; metal binding protein; 1.84A {Homo sapiens}	Back alignment and structure

>2e7p_A Glutaredoxin; thioredoxin fold, poplar, electron transport; HET: GSH; 2.10A {Populus tremula x populus tremuloides} PDB: 1z7p_A 1z7r_A	Back alignment and structure

>1t1v_A SH3BGRL3, SH3 domain-binding glutamic acid-rich protein-LIK; glutaredoxin, thioredoxin fold, protein 3D-structure, X-RAY crystallography; 1.60A {Mus musculus} SCOP: c.47.1.14 PDB: 1j0f_A 1sj6_A	Back alignment and structure

>1h75_A Glutaredoxin-like protein NRDH; electron transport, thioredoxin, redox protein; 1.7A {Escherichia coli} SCOP: c.47.1.1	Back alignment and structure

>1t00_A Thioredoxin, TRX; redox regulation, multifunction macromolecule, electron transport; 1.51A {Streptomyces coelicolor}	Back alignment and structure

>3ia1_A THIO-disulfide isomerase/thioredoxin; oxidoreductase, PSI-2, NYSGXRC, structu genomics, protein structure initiative; 1.76A {Thermus thermophilus}	Back alignment and structure

>2ct6_A SH3 domain-binding glutamic acid-rich-like protein 2; SH3BGRL2,FASH3, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1xfl_A Thioredoxin H1; AT3G51030, structural genomics, protein structure initiative, CESG, center for eukaryotic structural genomics; NMR {Arabidopsis thaliana} SCOP: c.47.1.1	Back alignment and structure

>2oe3_A Thioredoxin-3; electron transport, alpha/beta sandwich, oxidized, dimer; 1.80A {Saccharomyces cerevisiae} PDB: 2oe1_A 2oe0_A	Back alignment and structure

>3fk8_A Disulphide isomerase; APC61824.1, xylella fastidiosa temecul structural genomics, PSI-2, protein structure initiative; 1.30A {Xylella fastidiosa}	Back alignment and structure

>1kng_A Thiol:disulfide interchange protein CYCY; thioredoxin fold, cytochrome C maturation, atomic resolution oxidoreductase; 1.14A {Bradyrhizobium japonicum} SCOP: c.47.1.10	Back alignment and structure

>3hdc_A Thioredoxin family protein; ATCC53774, DSM 7210, , structural genomics, PSI-2, protein structure initiative; 1.77A {Geobacter metallireducens gs-15}	Back alignment and structure

>2e0q_A Thioredoxin; electron transport; 1.49A {Sulfolobus tokodaii} PDB: 3hhv_A	Back alignment and structure

>2f9s_A Thiol-disulfide oxidoreductase RESA; thioredoxin-like protein; HET: MSE; 1.40A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1st9_A 1su9_A 2h1d_A 2h1b_A 2h1a_A 2h19_A 2h1g_A 3c71_A 3c73_A	Back alignment and structure

>3ic4_A Glutaredoxin (GRX-1); structural genomics, PSI, MCSG, protein structure initiative, midwest center for structural genomic oxidoreductase; 1.70A {Archaeoglobus fulgidus}	Back alignment and structure

>1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10	Back alignment and structure

>3hxs_A Thioredoxin, TRXP; electron transport; 2.00A {Bacteroides fragilis} PDB: 3hyp_A	Back alignment and structure

>1dby_A Chloroplast thioredoxin M CH2; thioredoxin CH2, chloroplastic thioredoxin, oxidoreductase; NMR {Chlamydomonas reinhardtii} SCOP: c.47.1.1	Back alignment and structure

>3fkf_A Thiol-disulfide oxidoreductase; structural genomics, PSI-2, structure initiative, midwest center for structural genomic oxidoreductase; 2.20A {Bacteroides fragilis}	Back alignment and structure

>2vm1_A Thioredoxin, thioredoxin H isoform 1.; oxidoreductase, protein disulfide reductase, thioredoxin-FOL; 1.7A {Hordeum vulgare var} PDB: 2vm2_A	Back alignment and structure

>2l5l_A Thioredoxin; structural genomics, electron transport, PSI-2, protein STRU initiative; NMR {Bacteroides vulgatus}	Back alignment and structure

>1r26_A Thioredoxin; redox-active disulfide, electron transport; 1.40A {Trypanosoma} SCOP: c.47.1.1	Back alignment and structure

>2l6c_A Thioredoxin; oxidoreductase; NMR {Desulfovibrio vulgaris} PDB: 2l6d_A	Back alignment and structure

>1w4v_A Thioredoxin, mitochondrial; antioxidant enzyme, mitochondrion, electron TRA oxidoreductase; 1.80A {Homo sapiens} PDB: 1uvz_A 1w89_A	Back alignment and structure

>2vim_A Thioredoxin, TRX; thioredoxin fold, oxidoreductase; 1.38A {Fasciola hepatica}	Back alignment and structure

>1syr_A Thioredoxin; SGPP, structural genomics, PSI, protein structure initiative structural genomics of pathogenic protozoa consortium; 2.95A {Plasmodium falciparum} SCOP: c.47.1.1	Back alignment and structure

>2pu9_C TRX-F, thioredoxin F-type, chloroplast; protein-protein complex, iron-sulfur, electron transport; 1.65A {Spinacia oleracea} PDB: 2pvo_C 1f9m_A	Back alignment and structure

>1xwb_A Thioredoxin; dimerization, redox regulation, THI X-RAY electron transport; 2.20A {Drosophila melanogaster} SCOP: c.47.1.1 PDB: 1xw9_A 1xwc_A 1xwa_A	Back alignment and structure

>2wci_A Glutaredoxin-4; redox-active center, iron-sulfur cluster scaffolder, Fe2S2, homodimer, transport, glutathione, thioredoxin fold; HET: GSH; 1.90A {Escherichia coli} PDB: 1yka_A	Back alignment and structure

>1ep7_A Thioredoxin CH1, H-type; electron transport; 2.10A {Chlamydomonas reinhardtii} SCOP: c.47.1.1 PDB: 1tof_A 1ep8_A	Back alignment and structure

>1fo5_A Thioredoxin; disulfide oxidoreductase, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; NMR {Methanocaldococcus jannaschii} SCOP: c.47.1.1	Back alignment and structure

>1ti3_A Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Populus tremula} SCOP: c.47.1.1	Back alignment and structure

>3f3q_A Thioredoxin-1; His TAG, electron transport, cytoplasm, deoxyribonucleotide synthesis, golgi apparatus, membrane, nucleus; 1.76A {Saccharomyces cerevisiae} PDB: 3f3r_A* 2i9h_A 2fa4_A 2hsy_A 3pin_A 4dss_B	Back alignment and structure

>2l5o_A Putative thioredoxin; structural genomics, unknown function, PSI-2, protein struct initiative; NMR {Neisseria meningitidis serogroup B}	Back alignment and structure

>1thx_A Thioredoxin, thioredoxin 2; oxido-reductase, electron transport; 1.60A {Nostoc SP} SCOP: c.47.1.1	Back alignment and structure

>3die_A Thioredoxin, TRX; electron transport, SWAP domain, redox enzymology, oxidoreductase, redox-active center, transport; 1.85A {Staphylococcus aureus} SCOP: c.47.1.1 PDB: 2o7k_A 2o85_A 2o89_A 2o87_A	Back alignment and structure

>3l4n_A Monothiol glutaredoxin-6; C-terminal domain of GRX6, oxidoreductase; HET: GSH; 1.50A {Saccharomyces cerevisiae}	Back alignment and structure

>2wz9_A Glutaredoxin-3; protein binding; 1.55A {Homo sapiens} PDB: 2diy_A	Back alignment and structure

>2trx_A Thioredoxin; electron transport; 1.68A {Escherichia coli} SCOP: c.47.1.1 PDB: 1skr_B* 1skw_B* 1sl0_B* 1sks_B* 1sl2_B* 1t7p_B* 1t8e_B* 1tk0_B* 1tk5_B* 1tk8_B* 1tkd_B* 1sl1_B* 1x9s_B* 1x9w_B* 1xoa_A 1xob_A 1zyq_B* 2ajq_B* 2bto_T* 2h6x_A ...	Back alignment and structure

>1fb6_A Thioredoxin M; electron transport; 2.10A {Spinacia oleracea} SCOP: c.47.1.1 PDB: 1fb0_A 1gl8_A 2puk_C	Back alignment and structure

>3m9j_A Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} SCOP: c.47.1.1 PDB: 3m9k_A 2hsh_A 1erv_A 2ifq_A 2ifq_B 1auc_A 1eru_A 1ert_A 3kd0_A 1aiu_A 3trx_A 4trx_A 1trs_A 1tru_A 1trv_A 1trw_A 3e3e_A* 1cqg_A 1cqh_A 1mdi_A ...	Back alignment and structure

>2cvb_A Probable thiol-disulfide isomerase/thioredoxin; redox protein, structural genomics, riken struc genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.47.1.10 PDB: 2ywo_A	Back alignment and structure

>2lja_A Putative thiol-disulfide oxidoreductase; structural genomics, unknown function, thioredoxin-like; NMR {Bacteroides vulgatus}	Back alignment and structure

>1nsw_A Thioredoxin, TRX; thermostability, electron transport; 1.90A {Alicyclobacillus acidocaldarius} SCOP: c.47.1.1 PDB: 1rqm_A 1quw_A 1nw2_A	Back alignment and structure

>2fwh_A Thiol:disulfide interchange protein DSBD; thioredoxin-like, C-terminal domain, reduced form at PH7, oxidoreductase; 0.99A {Escherichia coli} SCOP: c.47.1.1 PDB: 2fwe_A 2fwf_A 2fwg_A 1vrs_D 1uc7_A	Back alignment and structure

>2i4a_A Thioredoxin; acidophIle, disulfide exchange, oxidoreductase; 1.00A {Acetobacter aceti}	Back alignment and structure

>3nzn_A Glutaredoxin; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics, rossmann fold; 1.10A {Methanosarcina mazei}	Back alignment and structure

>2lrt_A Uncharacterized protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, nysgrc, PSI-biology; NMR {Bacteroides vulgatus}	Back alignment and structure

>2i1u_A Thioredoxin, TRX, MPT46; redox protein, electron transport; 1.30A {Mycobacterium tuberculosis} PDB: 3nof_A 3o6t_A* 2l4q_A 2l59_A	Back alignment and structure

>3uvt_A Thioredoxin domain-containing protein 5; thioredoxin-like fold, isomerase; 2.00A {Homo sapiens} PDB: 2diz_A 3uj1_A	Back alignment and structure

>3or5_A Thiol:disulfide interchange protein, thioredoxin protein; PSI-II, structural genomics, protein structure initiative; 1.66A {Chlorobaculum tepidum} SCOP: c.47.1.0	Back alignment and structure

>2k8s_A Thioredoxin; dimer, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Nitrosomonas europaea}	Back alignment and structure

>2yzu_A Thioredoxin; redox protein, electron transport, structural genomics; 1.90A {Thermus thermophilus} PDB: 2cvk_A	Back alignment and structure

>3tco_A Thioredoxin (TRXA-1); disulfide oxidoreductase, oxidoreductase; 1.90A {Sulfolobus solfataricus} SCOP: c.47.1.0	Back alignment and structure

>1nho_A Probable thioredoxin; beta sheet, alpha helix, oxidoreductase; NMR {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.47.1.1	Back alignment and structure

>3kcm_A Thioredoxin family protein; SGX, thioredoxin protein, PSI, structural genomics, protein initiative; 2.45A {Geobacter metallireducens gs-15}	Back alignment and structure

>2xc2_A Thioredoxinn; oxidoreductase, protein disulfide reductase; 1.56A {Schistosoma mansoni} PDB: 2xbq_A 2xbi_A	Back alignment and structure

>3drn_A Peroxiredoxin, bacterioferritin comigratory prote homolog; bacterioferritin comigratory protein, oxidore; HET: CIT; 2.15A {Sulfolobus solfataricus} SCOP: c.47.1.0	Back alignment and structure

>3d22_A TRXH4, thioredoxin H-type; electron transport, cytoplasm, redox-active center, transport, oxidoreductase; 1.60A {Populus trichocarpa x populusdeltoides} PDB: 3d21_A	Back alignment and structure

>1xvw_A Hypothetical protein RV2238C/MT2298; thioredoxin fold, oxidized cystein sulfenic acid, structural genomics, PSI; 1.90A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1xxu_A	Back alignment and structure

>3gl3_A Putative thiol:disulfide interchange protein DSBE; oxidoreductase, PSI-II, structural genomics, protein structure initiative; 2.09A {Chlorobium tepidum tls}	Back alignment and structure

>3d6i_A Monothiol glutaredoxin-3; thioredoxin-like, electron transport, redox- active center, transport, oxidoreductase; HET: CME; 1.50A {Saccharomyces cerevisiae}	Back alignment and structure

>1faa_A Thioredoxin F; electron transport; 1.85A {Spinacia oleracea} SCOP: c.47.1.1	Back alignment and structure

>3gyk_A 27KDA outer membrane protein; APC61738.2, silicibacter pomeroyi DSS-3, thioredoxin-like, oxidoreductase, structural genomics, PSI-2; HET: MSE; 1.76A {Silicibacter pomeroyi}	Back alignment and structure

>3raz_A Thioredoxin-related protein; structural genomics, PSI-2, protein structure initiative; 2.00A {Neisseria meningitidis serogroup B}	Back alignment and structure

>1v98_A Thioredoxin; oxidoreductase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.82A {Thermus thermophilus}	Back alignment and structure

>3qfa_C Thioredoxin; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_C*	Back alignment and structure

>3cxg_A Putative thioredoxin; malaria, structural GEN oxidoreductase, structural genomics consortium, SGC; 2.00A {Plasmodium falciparum}	Back alignment and structure

>2j23_A Thioredoxin; immune protein, autoreactivity, cross-reactivity, IGE, fungi, epitope, allergen; 1.41A {Malassezia sympodialis}	Back alignment and structure

>3eur_A Uncharacterized protein; PSI2,MCSG, conserved protein, structural genomics, protein S initiative, midwest center for structural genomics; HET: MSE; 1.30A {Bacteroides fragilis}	Back alignment and structure

>2fgx_A Putative thioredoxin; NET3, NESG, GFT-glutaredoxin-like, structural genomics, PSI, protein structure initiative; NMR {Nitrosomonas europaea}	Back alignment and structure

>2ywi_A Hypothetical conserved protein; uncharacterized conserved protein, NPPSFA, national project protein structural and functional analyses; 1.60A {Geobacillus kaustophilus}	Back alignment and structure

>1i5g_A Tryparedoxin II; electron transport; HET: TS5; 1.40A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1o6j_A 1o81_A 1oc8_A 1oc9_B 1fg4_A 1oc9_A	Back alignment and structure

>2k6v_A Putative cytochrome C oxidase assembly protein; thioredoxin fold, electron transfer protein, metal binding protein, electron transport; NMR {Thermus thermophilus}	Back alignment and structure

>1ttz_A Conserved hypothetical protein; structural genomics, unknown function, PSI, protein structure initiative; 2.11A {Xanthomonas campestris} SCOP: c.47.1.1 PDB: 1xpv_A	Back alignment and structure

>1jfu_A Thiol:disulfide interchange protein TLPA; thioredoxin-like, double disulfide bridge, membrane protein; 1.60A {Bradyrhizobium japonicum} SCOP: c.47.1.10	Back alignment and structure

>3gnj_A Thioredoxin domain protein; APC92103, STR genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.99A {Desulfitobacterium hafniense dcb-2} SCOP: c.47.1.0	Back alignment and structure

>2b1k_A Thiol:disulfide interchange protein DSBE; C-terminal thioredoxin-like domain, N-terminal beta-sheet, fingerprint rigion, oxidoreductase; 1.90A {Escherichia coli} PDB: 3k8n_A 2g0f_A 1z5y_E 2b1l_A	Back alignment and structure

>3q18_A GSTO-2, glutathione S-transferase omega-2; glutathione transferase, dehydroascorbate reductase, reductase; 1.70A {Homo sapiens} PDB: 3q19_A* 3qag_A*	Back alignment and structure

>3s9f_A Tryparedoxin; thioredoxin fold, disulfide reductase, electron transport; 1.80A {Leishmania major}	Back alignment and structure

>4euy_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; 2.90A {Bacillus cereus}	Back alignment and structure

>3kh7_A Thiol:disulfide interchange protein DSBE; TRX-like, thiol-disulfide exchange, cell inner membrane, CYT C-type biogenesis, disulfide bond; 1.75A {Pseudomonas aeruginosa} PDB: 3kh9_A	Back alignment and structure

>1gh2_A Thioredoxin-like protein; redox-active center, electron transport; 2.22A {Homo sapiens} SCOP: c.47.1.1	Back alignment and structure

>1eej_A Thiol:disulfide interchange protein; oxidoreductase, protein disulfide isomerase, protein folding, redox protein, redox-active center; HET: MES; 1.90A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1tjd_A 1jzd_A 1jzo_A 1g0t_A 2iyj_A	Back alignment and structure

>2o8v_B Thioredoxin 1; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli}	Back alignment and structure

>2voc_A Thioredoxin; electron transport, homodimer, disulfide, transport, redox-active center; 1.50A {Bacillus subtilis} PDB: 2ipa_A 2gzy_A 2gzz_A	Back alignment and structure

>2ppt_A Thioredoxin-2; thiredoxin, zinc finger, oxidoreductase; 1.92A {Rhodobacter capsulatus}	Back alignment and structure

>2wul_A Glutaredoxin related protein 5; chromosome 14 open reading frame 87, oxidoreductase, thiored family, GLRX5, FLB4739; HET: GSH; 2.40A {Homo sapiens}	Back alignment and structure

>1o8x_A Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrotron radiation, disulfide bonds tryparedoxin, thioredoxin, trypanosome; 1.3A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1okd_A 1qk8_A 1o85_A 1o8w_A 1o7u_A 1ezk_A 1ewx_A	Back alignment and structure

>3ewl_A Uncharacterized conserved protein BF1870; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; 2.00A {Bacteroides fragilis}	Back alignment and structure

>2vup_A Glutathione peroxidase-like protein; oxidoreductase, trypanothione, dithiol-dependant peroxidase; 2.10A {Trypanosoma brucei}	Back alignment and structure

>3p2a_A Thioredoxin 2, putative thioredoxin-like protein; structural genomics, center for structural genomics of infec diseases, csgid; 2.19A {Yersinia pestis}	Back alignment and structure

>3gv1_A Disulfide interchange protein; neisseria gonorrhoeae (strain 700825 / FA 1090), DSBC, structural genomics, unknown funct 2; 2.00A {Neisseria gonorrhoeae}	Back alignment and structure

>3fz4_A Putative arsenate reductase; APC61768, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.38A {Streptococcus mutans UA159} SCOP: c.47.1.0	Back alignment and structure

>1o73_A Tryparedoxin; electron transport, trypanosomatid, thioredoxin; 2.28A {Trypanosoma brucei brucei} SCOP: c.47.1.10	Back alignment and structure

>3ul3_B Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 2.90A {Plasmodium falciparum}	Back alignment and structure

>3hcz_A Possible thiol-disulfide isomerase; APC61559.2, cytophaga hutchinsoni structural genomics, PSI-2, protein structure initiative; 1.88A {Cytophaga hutchinsonii}	Back alignment and structure

>3vln_A GSTO-1, glutathione S-transferase omega-1; GST fold, reductase; HET: ASC; 1.70A {Homo sapiens} PDB: 1eem_A* 3lfl_A*	Back alignment and structure

>1wjk_A C330018D20RIK protein; glutaredoxin, thioredoxin fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1	Back alignment and structure

>3eyt_A Uncharacterized protein SPOA0173; thioredoxin-like superfamily protein SPOA0173, silicibacter DSS, structural genomics, PSI-2; 1.95A {Silicibacter pomeroyi}	Back alignment and structure

>3hd5_A Thiol:disulfide interchange protein DSBA; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.35A {Bordetella parapertussis}	Back alignment and structure

>3lor_A Thiol-disulfide isomerase and thioredoxins; PSI, MCSG, structural genomics, midwest CE structural genomics; HET: MSE; 2.20A {Corynebacterium glutamicum}	Back alignment and structure

>3emx_A Thioredoxin; structural genomics, oxidoreductase, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.25A {Aeropyrum pernix}	Back alignment and structure

>1v58_A Thiol:disulfide interchange protein DSBG; reduced DSBG, redox protein, protein disulfide isomerase, thioredoxin fold; 1.70A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1v57_A 2h0i_A 2h0h_A 2h0g_A 2iy2_A	Back alignment and structure

>1t3b_A Thiol:disulfide interchange protein DSBC; oxidoreductase, protein disulfide isomerase, protein folding, redox protein; 2.50A {Haemophilus influenzae} SCOP: c.47.1.9 d.17.3.1	Back alignment and structure

>4hi7_A GI20122; GST, glutathione S-transferase, enzyme function initiative, structural genomics, unknown function; HET: GSH; 1.25A {Drosophila mojavensis}	Back alignment and structure

>2obi_A PHGPX, GPX-4, phospholipid hydroperoxide glutathione peroxidase (GPX4); human GPX4, selenoprotein, thioredoxin-fold, anti-oxidatve defense system; 1.55A {Homo sapiens}	Back alignment and structure

>3hz4_A Thioredoxin; NYSGXRC, PSI-II, reduced form, protein structure initiative, structural genomics; 2.30A {Methanosarcina mazei}	Back alignment and structure

>3ir4_A Glutaredoxin 2; glutathione, IDP00895, structural genomics, for structural genomics of infectious diseases, csgid, oxidoreductase; HET: MSE GSH; 1.20A {Salmonella enterica subsp} PDB: 1g7o_A	Back alignment and structure

>3fw2_A Thiol-disulfide oxidoreductase; structural genomics, APC61456.1, thiol-disulfide oxidoreduct TLPA-like family, PSI-2; 1.74A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3h93_A Thiol:disulfide interchange protein DSBA; disulfide bond, redox-active center, transcription regulator; HET: MSE GOL; 1.50A {Pseudomonas aeruginosa PAO1} SCOP: c.47.1.0	Back alignment and structure

>4glt_A Glutathione S-transferase-like protein; structural genomics, function initiative, EFI; HET: GSH; 2.20A {Methylobacillus flagellatus}	Back alignment and structure

>3hz8_A Thiol:disulfide interchange protein DSBA; thiol-oxidoreductase, disulfide bond; 1.45A {Neisseria meningitidis MC58} PDB: 3dvw_A 3a3t_A	Back alignment and structure

>3u5r_E Uncharacterized protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, hypothetical protein; 2.05A {Sinorhizobium meliloti}	Back alignment and structure

>2f51_A Thioredoxin; electron transport; 1.90A {Trichomonas vaginalis}	Back alignment and structure

>2ju5_A Thioredoxin disulfide isomerase; protein, oxidoreductase; NMR {Chlamydophila pneumoniae}	Back alignment and structure

>1psq_A Probable thiol peroxidase; structural genomics, NYSGXRC, PSI, structure initiative, NEW YORK SGX research center for STRU genomics; 2.30A {Streptococcus pneumoniae} SCOP: c.47.1.10	Back alignment and structure

>4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum}	Back alignment and structure

>3qav_A RHO-class glutathione S-transferase; cytosol; 2.10A {Laternula elliptica} PDB: 3qaw_A*	Back alignment and structure

>2p31_A CL683, glutathione peroxidase 7; thioredoxin fold, NPGPX, phospholipid hydroperoxidase, struc genomics, structural genomics consortium, SGC; 2.00A {Homo sapiens}	Back alignment and structure

>3l9v_A Putative thiol-disulfide isomerase or thioredoxin; thioredoxin-fold, SRGA, thiol-disulfide oxidoreductase, ISOM oxidoreductase; HET: PE8 P4C P6G; 2.15A {Salmonella enterica subsp} SCOP: c.47.1.0	Back alignment and structure

>3aps_A DNAJ homolog subfamily C member 10; thioredoxin fold, CXXC motif, endoplasmic reticulum, oxidore; 1.90A {Mus musculus}	Back alignment and structure

>2jad_A Yellow fluorescent protein glutaredoxin fusion protein; electron transport, redox- active center, yeast, GRX1P, transport; HET: PIA; 2.7A {Aequorea victoria}	Back alignment and structure

>2gs3_A PHGPX, GPX-4, phospholipid hydroperoxide glutathione peroxidase; GSHPX-4,phospholipid hydroperoxide; 1.90A {Homo sapiens}	Back alignment and structure

>3kp8_A Vkorc1/thioredoxin domain protein; blood coagulation, disulfide formation, redox partner, oxidoreductase; 1.66A {Synechococcus SP}	Back alignment and structure

>2rem_A Disulfide oxidoreductase; disulfide oxidoreductase, DSBA, thioredoxin fold, redox- active center; 1.90A {Xylella fastidiosa}	Back alignment and structure

>3tdg_A DSBG, putative uncharacterized protein; thioredoxin fold, reductase, oxidoreductase; HET: P6G; 2.10A {Helicobacter pylori}	Back alignment and structure

>3lwa_A Secreted thiol-disulfide isomerase; thioredoxin, PSI, MCSG, structural genomics, midwest center for structural genomics; 1.75A {Corynebacterium glutamicum}	Back alignment and structure

>3cmi_A Peroxiredoxin HYR1; thioredoxin-like fold, oxidoreductase, peroxidase, redox-ACT center; 2.02A {Saccharomyces cerevisiae}	Back alignment and structure

>3bby_A Uncharacterized GST-like protein YFCF; NP_416804.1, glutathione S-transferase, N-terminal domain, S genomics; 1.85A {Escherichia coli}	Back alignment and structure

>2yj7_A LPBCA thioredoxin; oxidoreductase; 1.65A {Synthetic construct}	Back alignment and structure

>1z6m_A Conserved hypothetical protein; structural genomics, MCSG,, protein structure initiative, midwest center for structural genomics; HET: MSE; 1.30A {Enterococcus faecalis} SCOP: c.47.1.13	Back alignment and structure

>4hoj_A REGF protein; GST, glutathione S-transferase, enzyme function initiative, structural genomics, transferase; HET: GSH; 1.40A {Neisseria gonorrhoeae}	Back alignment and structure

>2hnl_A Glutathione S-transferase 1; prostaglandin synthase, river BLI onchocerca volvulus, immune modulation; HET: GSH; 2.00A {Onchocerca volvulus}	Back alignment and structure

>2imi_A Epsilon-class glutathione S-transferase; HET: GSH; 1.40A {Anopheles gambiae} PDB: 2il3_A* 2imk_A*	Back alignment and structure

>1x5e_A Thioredoxin domain containing protein 1; TMX, TXNDC1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		223
d1ktea_		105	Glutaredoxin (Grx, thioltransferase) {Pig (Sus scr	94.56
d1eema2		98	Class omega GST {Human (Homo sapiens) [TaxId: 9606	93.33
d1e6ba2		80	Class zeta GST {Mouse-ear cress (Arabidopsis thali	93.32
d1g7oa2		75	Glutaredoxin 2 {Escherichia coli [TaxId: 562]}	93.23
d1gwca2		83	Class tau GST {Aegilops tauschii, also known as Tr	92.94
d1v2aa2		83	Class delta GST {Mosquito (Anopheles dirus b), iso	92.19
d1fova_		82	Glutaredoxin (Grx, thioltransferase) {Escherichia	92.18
d1k0ma2		86	Chloride intracellular channel 1 (clic1) {Human (H	92.02
d1ljra2		79	Class theta GST {Human (Homo sapiens) [TaxId: 9606	91.89
d1t3ba1		150	Disulfide bond isomerase, DsbC, C-terminal domain	91.76
d1eeja1		156	Disulfide bond isomerase, DsbC, C-terminal domain	91.46
d1v58a1		169	Thiol:disulfide interchange protein DsbG, C-termin	90.41
d1hyua4		96	Alkyl hydroperoxide reductase subunit F (AhpF), N-	90.09
d1nm3a1		74	C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus	89.58
d1k0da2		92	Yeast prion protein ure2p, nitrogen regulation fra	89.31
d1r7ha_		74	Glutaredoxin-like NRDH-redoxin {Corynebacterium am	88.8
d1h75a_		76	Glutaredoxin-like NRDH-redoxin {Escherichia coli [	88.56
d1r5aa2		85	Class delta GST {Mosquito (Anopheles dirus b), iso	88.18
d1axda2		80	Class phi GST {Maize (Zea mays), type I [TaxId: 45	87.2
d1gnwa2		84	Class phi GST {Mouse-ear cress (Arabidopsis thalia	86.23
d1wjka_		100	Thioredoxin-like structure containing protein C330	85.73
d1aw9a2		81	Class phi GST {Maize (Zea mays), type III [TaxId:	85.24
d1wika_		109	Thioredoxin-like protein 2 {Mouse (Mus musculus) [	85.04
d1z9ha2		113	Microsomal prostaglandin E synthase-2 {Crab-eating	84.69
d1abaa_		87	Glutaredoxin (Grx, thioltransferase) {Bacteriophag	83.9
d1jlva2		84	Class delta GST {Mosquito (Anopheles dirus b), iso	83.75
d1xfla_		114	Thioredoxin {Thale cress (Arabidopsis thaliana) [T	83.05
d2djja1		116	Protein disulfide isomerase, PDI {Fungi (Humicola	81.39
d1fw1a2		83	Class zeta GST {Human (Homo sapiens) [TaxId: 9606]	81.25
d1ti3a_		113	Thioredoxin {European aspen (Populus tremula), thi	81.14
d1oyja2		84	Class tau GST {Rice (Oryza sativa) [TaxId: 4530]}	80.85
d1zzoa1		134	Lipoprotein DsbF {Mycobacterium tuberculosis [TaxI	80.77
d1nhoa_		85	MTH807, thioredoxin/glutaredoxin-like protein {Arc	80.67
d1a8la2		107	Protein disulfide isomerase, PDI {Archaeon Pyrococ	80.57

>d1ktea_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Thioredoxin fold
superfamily: Thioredoxin-like
family: Thioltransferase
domain: Glutaredoxin (Grx, thioltransferase)
species: Pig (Sus scrofa) [TaxId: 9823]

Probab=94.56  E-value=0.044  Score=39.06  Aligned_cols=82  Identities=16%  Similarity=0.289  Sum_probs=50.7

Q ss_pred             CCCceEEEEcCCChhhHHHHHHHHhhcccCCCEEEEeCCChhhhHHHhCCCChhcccceEEEEEeCCeEEehHHHHHHHH
Q 027420           80 ENWKIKMLYDGDCPLCMREVNMLKERNKQYGTIKFVDISSDEYSIEENQGLDYKTVMGSIHAIVSDGTVVTDVEAFRRLY  159 (223)
Q Consensus        80 ~~~ki~VlYDG~CpLC~~~v~~L~~~d~~~~~I~fvdiqs~~~~~~~~~gld~e~~~~~lhvv~~dG~v~~G~dA~~~Il  159 (223)
                      .+.+++||-=..||+|.+..++|.+.......+.+.++............+....-...+-.+--+|+.+.|.+-+..+.
T Consensus        10 ~~~~Vviysk~~Cp~C~~ak~ll~~~~~~~~~~~~~e~d~~~d~~~~~~~l~~~~g~~tvPqIfi~g~~IGG~~el~~l~   89 (105)
T d1ktea_          10 QPGKVVVFIKPTCPFCRKTQELLSQLPFKEGLLEFVDITATSDTNEIQDYLQQLTGARTVPRVFIGKECIGGCTDLESMH   89 (105)
T ss_dssp             CTTCEEEEECSSCHHHHHHHHHHHHSCBCTTSEEEEEGGGSTTHHHHHHHHHHHHSCCCSCEEEETTEEEESHHHHHHHH
T ss_pred             ccCCEEEEECCCCchHHHHHHHHHHhCCccceeeeeecccccccHHHHHHHhhccCCCcCcEEEECCEEEecHHHHHHHH
Confidence            45678999999999999999999887654456778776432211100001111111122323345899999999877766


Q ss_pred             HH
Q 027420          160 EE  161 (223)
Q Consensus       160 ~~  161 (223)
                      ..
T Consensus        90 ~~   91 (105)
T d1ktea_          90 KR   91 (105)
T ss_dssp             HH
T ss_pred             HC
Confidence            54

PyMOL of d1ktea_

>d1eema2 c.47.1.5 (A:5-102) Class omega GST {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1e6ba2 c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1g7oa2 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1gwca2 c.47.1.5 (A:4-86) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]}	Back information, alignment and structure

>d1v2aa2 c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]}	Back information, alignment and structure

>d1fova_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli, Grx3 [TaxId: 562]}	Back information, alignment and structure

>d1k0ma2 c.47.1.5 (A:6-91) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ljra2 c.47.1.5 (A:1-79) Class theta GST {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1t3ba1 c.47.1.9 (A:61-210) Disulfide bond isomerase, DsbC, C-terminal domain {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1eeja1 c.47.1.9 (A:61-216) Disulfide bond isomerase, DsbC, C-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1v58a1 c.47.1.9 (A:62-230) Thiol:disulfide interchange protein DsbG, C-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1hyua4 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d1nm3a1 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1k0da2 c.47.1.5 (A:109-200) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1r7ha_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Corynebacterium ammoniagenes [TaxId: 1697]}	Back information, alignment and structure

>d1h75a_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1r5aa2 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]}	Back information, alignment and structure

>d1axda2 c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]}	Back information, alignment and structure

>d1gnwa2 c.47.1.5 (A:2-85) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1wjka_ c.47.1.1 (A:) Thioredoxin-like structure containing protein C330018D20Rik {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1aw9a2 c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]}	Back information, alignment and structure

>d1wika_ c.47.1.1 (A:) Thioredoxin-like protein 2 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1z9ha2 c.47.1.5 (A:100-212) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]}	Back information, alignment and structure

>d1abaa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Bacteriophage T4 [TaxId: 10665]}	Back information, alignment and structure

>d1jlva2 c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]}	Back information, alignment and structure

>d1xfla_ c.47.1.1 (A:) Thioredoxin {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d2djja1 c.47.1.2 (A:6-121) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]}	Back information, alignment and structure

>d1fw1a2 c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ti3a_ c.47.1.1 (A:) Thioredoxin {European aspen (Populus tremula), thioredoxin H [TaxId: 113636]}	Back information, alignment and structure

>d1oyja2 c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]}	Back information, alignment and structure

>d1zzoa1 c.47.1.10 (A:45-178) Lipoprotein DsbF {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1nhoa_ c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-like protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]}	Back information, alignment and structure

>d1a8la2 c.47.1.2 (A:120-226) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure