Citrus Sinensis ID: 027421

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220---

MLDRLRLHVYPKEPLTCAKLTQYASLKLETKRRAKPTLHLLHVGRRKEKLRSAEAGAAADPKHKESSAMEVSGLDSDGKEFKNAEEMWREQIGEDGEQQEKKTQWYREGISYWEGVEASVDGVLGGFGNVNEVDIKGSEAFLQMLLSDRFPNARNNQHLVALDCGSGIGRITKNLLIRYFNEVDLLEPVSHFLDAARESLAPENHMAPDMHKATNFFCVPLQV

cccccccccccccccHHHHHHcccccHHHHHccccccEEEEEcccHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHccccccccHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHccccccccccccEEEEEcccccccHHHHHHHHccccEEEEcccHHHHHHHHHHHccccccccccccccEEEEccccc

ccccEEEEEcccccccHHHHHHHHHHHHHHHHcccccEEEEEEEcccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccHHHHHHHHHHHHHccccccccccccccccccccHHcHHHHHHHHHHcccccccccccEEEEEccccccHHcHHHHHHHHccEcEccccHHHHHHHHHHHccccccccccccEEEEEcccccc

mldrlrlhvypkepltcaklTQYASLKLEtkrrakptlhllhvGRRKEKlrsaeagaaadpkhkessamevsgldsdgkefKNAEEMWREQIGEDGEQQEKKTQWYREGISYWEGVEASVDGvlggfgnvnevdIKGSEAFLQMLLSdrfpnarnnqHLVALDCGSGIGRITKNLLIRYFnevdllepvSHFLDAAReslapenhmapdmhkatnffcvplqv

mldrlrlhvypkepltcakltqyaslkletkrrakptlhllhvgrrkeklrsaeagaaadpkhkessamevsgldsdgkEFKNAEEMWReqigedgeqqekKTQWYREGISYWEGVEASVDGVLGGFGNVNEVDIKGSEAFLQMLLSDRFPNARNNQHLVALDCGSGIGRITKNLLIRYFNEVDLLEPVSHFLDAARESLAPENHMAPDMHKATNFFCVPLQV

*****RLHVYPKEPLTCAKLTQYASLKLE********LHLLH*************************************************************QWYREGISYWEGVEASVDGVLGGFGNVNEVDIKGSEAFLQMLLSDRFPNARNNQHLVALDCGSGIGRITKNLLIRYFNEVDLLEPVSHFLDAA*****************TNFFCV****

**DRLRLHVYPKEPLTCAKLTQYASLKLETKRRAKPTLHLLHVGRR***************************LDSDGKEFKNAEEMWR**************QWYREGISYWEGVEASVDGVLGGFGNVNEVDIKGSEAFLQMLL***********HLVALDCGSGIGRITKNLLIRYFNEVDLLEPVSHFLDAARES**********MHKATNFFCVPLQV

MLDRLRLHVYPKEPLTCAKLTQYASLKLETKRRAKPTLHLLHVGR*********************************KEFKNAEEMWREQI***********QWYREGISYWEGVEASVDGVLGGFGNVNEVDIKGSEAFLQMLLSDRFPNARNNQHLVALDCGSGIGRITKNLLIRYFNEVDLLEPVSHFLDAARESLAPENHMAPDMHKATNFFCVPLQV

*LDRLRLHVYPKEPLTCAKLTQYASLKLETKRRAKPTLHLLHVGRRKEK********************************KN*EEMWREQIGEDGEQQEKKTQWYREGISYWEGVEASVDGVLGGFGNVNEVDIKGSEAFLQMLLSDRFPNARNNQHLVALDCGSGIGRITKNLLIRYFNEVDLLEPVSHFLDAARESLAPENHMAPDMHKATNFFCVPLQV

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		223	2.2.26 [Sep-21-2011]
Q5PP70		276	Alpha N-terminal protein	no	no	0.668	0.539	0.709	3e-58
A2XMJ1		307	Alpha N-terminal protein	N/A	no	0.681	0.495	0.505	5e-46
Q10CT5		307	Alpha N-terminal protein	no	no	0.681	0.495	0.5	6e-45
Q55DH6		270	Alpha N-terminal protein	yes	no	0.623	0.514	0.374	3e-21
B1H2P7		224	N-terminal Xaa-Pro-Lys N-	yes	no	0.529	0.526	0.404	1e-20
Q4KL94		224	N-terminal Xaa-Pro-Lys N-	N/A	no	0.529	0.526	0.412	2e-20
Q6NWX7		223	N-terminal Xaa-Pro-Lys N-	yes	no	0.511	0.511	0.422	3e-20
Q4KLE6		223	N-terminal Xaa-Pro-Lys N-	N/A	no	0.524	0.524	0.380	8e-19
Q9BV86		223	N-terminal Xaa-Pro-Lys N-	yes	no	0.524	0.524	0.396	1e-18
Q2T9N3		223	N-terminal Xaa-Pro-Lys N-	yes	no	0.524	0.524	0.404	2e-18

>sp\|Q5PP70\|NTM1_ARATH Alpha N-terminal protein methyltransferase 1 OS=Arabidopsis thaliana GN=At5g44450 PE=2 SV=1	Back alignment and function desciption

 Score =  224 bits (572), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 110/155 (70%), Positives = 127/155 (81%), Gaps = 6/155 (3%)

Query: 69  MEVSGLDSDGKEFKNAEEMWREQIGEDGEQQEKKTQWYREGISYWEGVEASVDGVLGGFG 128
           M++ G+DS+GKEF + +EMWRE+IGE  E   KKTQWYR+G+SYWEGVEASVDGVLGG+G
Sbjct: 1   MDICGVDSEGKEFNSVQEMWREEIGEGDET--KKTQWYRDGVSYWEGVEASVDGVLGGYG 58

Query: 129 NVNEVDIKGSEAFLQMLLSDRFPN-ARNNQHLVALDCGSGIGRITKNLLIRYFNEVDLLE 187
           +VN+ DI GSE FL+ LL +R  N    NQHLVALDCGSGIGRITKNLLIRYFNEVDLLE
Sbjct: 59  HVNDADIIGSEVFLKTLLQERLVNNVGANQHLVALDCGSGIGRITKNLLIRYFNEVDLLE 118

Query: 188 PVSHFLDAARESLAPENHMAPDMHKATNFFCVPLQ 222
           PV+ FLDAARE+LA       + HKATNFFCVPLQ
Sbjct: 119 PVAQFLDAARENLAS---AGSETHKATNFFCVPLQ 150

Alpha-N-methyltransferase that methylates the N-terminus of target proteins containing the N-terminal motif [Ala/Pro/Ser]-Pro-Lys when the initiator Met is cleaved. Specifically catalyzes mono-, di- or tri-methylation of exposed alpha-amino group of Ala or Ser residue in the [Ala/Ser]-Pro-Lys motif and mono- or di-methylation of Pro in the Pro-Pro-Lys motif.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: 2EC: 4EC: 4

>sp\|A2XMJ1\|NTM1_ORYSI Alpha N-terminal protein methyltransferase 1 OS=Oryza sativa subsp. indica GN=OsI_13745 PE=3 SV=1	Back alignment and function description

>sp\|Q10CT5\|NTM1_ORYSJ Alpha N-terminal protein methyltransferase 1 OS=Oryza sativa subsp. japonica GN=Os03g0780900 PE=2 SV=2	Back alignment and function description

>sp\|Q55DH6\|NTM1_DICDI Alpha N-terminal protein methyltransferase 1 OS=Dictyostelium discoideum GN=DDB_G0269658 PE=3 SV=1	Back alignment and function description

>sp\|B1H2P7\|NTM1A_XENTR N-terminal Xaa-Pro-Lys N-methyltransferase 1 OS=Xenopus tropicalis GN=ntmt1 PE=2 SV=1	Back alignment and function description

>sp\|Q4KL94\|NT1AA_XENLA N-terminal Xaa-Pro-Lys N-methyltransferase 1-A OS=Xenopus laevis GN=ntmt1-a PE=2 SV=1	Back alignment and function description

>sp\|Q6NWX7\|NTM1A_DANRE N-terminal Xaa-Pro-Lys N-methyltransferase 1 OS=Danio rerio GN=ntmt1 PE=2 SV=1	Back alignment and function description

>sp\|Q4KLE6\|NT1AB_XENLA N-terminal Xaa-Pro-Lys N-methyltransferase 1-B OS=Xenopus laevis GN=ntmt1-b PE=2 SV=1	Back alignment and function description

>sp\|Q9BV86\|NTM1A_HUMAN N-terminal Xaa-Pro-Lys N-methyltransferase 1 OS=Homo sapiens GN=NTMT1 PE=1 SV=3	Back alignment and function description

>sp\|Q2T9N3\|NTM1A_BOVIN N-terminal Xaa-Pro-Lys N-methyltransferase 1 OS=Bos taurus GN=NTMT1 PE=2 SV=3	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		223
255586233		276	Protein C9orf32, putative [Ricinus commu	0.672	0.543	0.779	2e-64
224115626		276	predicted protein [Populus trichocarpa]	0.672	0.543	0.714	4e-60
297791381		335	hypothetical protein ARALYDRAFT_494541 [	0.686	0.456	0.707	2e-59
356528088		336	PREDICTED: alpha N-terminal protein meth	0.820	0.544	0.595	2e-58
449433531		275	PREDICTED: alpha N-terminal protein meth	0.672	0.545	0.694	2e-57
145358849		334	methyltransferase [Arabidopsis thaliana]	0.681	0.455	0.702	2e-57
75321280		276	RecName: Full=Alpha N-terminal protein m	0.668	0.539	0.709	1e-56
356510746		278	PREDICTED: alpha N-terminal protein meth	0.672	0.539	0.692	2e-56
358348179		348	Methyltransferase-like protein 11A [Medi	0.672	0.431	0.636	6e-52
9758698		252	unnamed protein product [Arabidopsis tha	0.587	0.519	0.737	4e-50

>gi\|255586233\|ref\|XP_002533771.1\| Protein C9orf32, putative [Ricinus communis] gi\|223526308\|gb\|EEF28616.1\| Protein C9orf32, putative [Ricinus communis]	Back alignment and taxonomy information

 Score =  251 bits (640), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 120/154 (77%), Positives = 132/154 (85%), Gaps = 4/154 (2%)

Query: 69  MEVSGLDSDGKEFKNAEEMWREQIGEDGEQQEKKTQWYREGISYWEGVEASVDGVLGGFG 128
           MEV+G DSDG+EFKNAEEMWREQ G DG    KKTQWYR+G+SYW+GVEASVDGVLGG+G
Sbjct: 1   MEVTGTDSDGREFKNAEEMWREQTG-DGT---KKTQWYRDGVSYWQGVEASVDGVLGGYG 56

Query: 129 NVNEVDIKGSEAFLQMLLSDRFPNARNNQHLVALDCGSGIGRITKNLLIRYFNEVDLLEP 188
            VN+ DIKGSEAFLQ L S+ F +    +HLVALDCGSGIGR+TKNLLIRYFNEVDLLEP
Sbjct: 57  QVNDADIKGSEAFLQTLFSELFVDGGLGRHLVALDCGSGIGRVTKNLLIRYFNEVDLLEP 116

Query: 189 VSHFLDAARESLAPENHMAPDMHKATNFFCVPLQ 222
           VSHFLDAAR+SL  ENHMA D HKATNFFC PLQ
Sbjct: 117 VSHFLDAARDSLINENHMASDTHKATNFFCTPLQ 150

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|224115626\|ref\|XP_002317082.1\| predicted protein [Populus trichocarpa] gi\|222860147\|gb\|EEE97694.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|297791381\|ref\|XP_002863575.1\| hypothetical protein ARALYDRAFT_494541 [Arabidopsis lyrata subsp. lyrata] gi\|297309410\|gb\|EFH39834.1\| hypothetical protein ARALYDRAFT_494541 [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|356528088\|ref\|XP_003532637.1\| PREDICTED: alpha N-terminal protein methyltransferase 1-like [Glycine max]	Back alignment and taxonomy information

>gi\|449433531\|ref\|XP_004134551.1\| PREDICTED: alpha N-terminal protein methyltransferase 1-like [Cucumis sativus] gi\|449506765\|ref\|XP_004162842.1\| PREDICTED: alpha N-terminal protein methyltransferase 1-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|145358849\|ref\|NP_199258.3\| methyltransferase [Arabidopsis thaliana] gi\|332007727\|gb\|AED95110.1\| methyltransferase [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|75321280\|sp\|Q5PP70.1\|NTM1_ARATH RecName: Full=Alpha N-terminal protein methyltransferase 1; AltName: Full=X-Pro-Lys N-terminal protein methyltransferase 1; Short=NTM1 gi\|56121880\|gb\|AAV74221.1\| At5g44450 [Arabidopsis thaliana] gi\|57222192\|gb\|AAW39003.1\| At5g44450 [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|356510746\|ref\|XP_003524095.1\| PREDICTED: alpha N-terminal protein methyltransferase 1-like [Glycine max]	Back alignment and taxonomy information

>gi\|358348179\|ref\|XP_003638126.1\| Methyltransferase-like protein 11A [Medicago truncatula] gi\|355504061\|gb\|AES85264.1\| Methyltransferase-like protein 11A [Medicago truncatula]	Back alignment and taxonomy information

>gi\|9758698\|dbj\|BAB09152.1\| unnamed protein product [Arabidopsis thaliana]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		223
DICTYBASE\|DDB_G0269658		270	DDB_G0269658 "Methyltransferas	0.632	0.522	0.379	2.3e-23
UNIPROTKB\|B1H2P7		224	ntmt1 "N-terminal Xaa-Pro-Lys	0.529	0.526	0.404	6.3e-21
UNIPROTKB\|Q4KL94		224	ntmt1-a "N-terminal Xaa-Pro-Ly	0.529	0.526	0.412	1e-20
ZFIN\|ZDB-GENE-040426-2055		223	ntmt1 "N-terminal Xaa-Pro-Lys	0.511	0.511	0.422	3.5e-20
UNIPROTKB\|F1MKD1		223	METTL11A "Uncharacterized prot	0.511	0.511	0.414	1.9e-19
UNIPROTKB\|Q4KLE6		223	ntmt1-b "N-terminal Xaa-Pro-Ly	0.524	0.524	0.380	5.1e-19
UNIPROTKB\|Q9BV86		223	NTMT1 "N-terminal Xaa-Pro-Lys	0.511	0.511	0.398	8.3e-19
UNIPROTKB\|Q2T9N3		223	NTMT1 "N-terminal Xaa-Pro-Lys	0.511	0.511	0.406	1.4e-18
UNIPROTKB\|D2H163		223	NTMT1 "N-terminal Xaa-Pro-Lys	0.511	0.511	0.406	1.7e-18
UNIPROTKB\|F1RQG3		223	NTMT1 "Uncharacterized protein	0.511	0.511	0.398	2.2e-18

DICTYBASE\|DDB_G0269658 DDB_G0269658 "Methyltransferase-like protein 11A" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

 Score = 269 (99.8 bits), Expect = 2.3e-23, P = 2.3e-23
 Identities = 58/153 (37%), Positives = 91/153 (59%)

Query:    72 SGLDSDGKEFKNAEEMWREQI-GEDGEQQEKKTQWYREGISYWEGVEASVDGVLGGFGNV 130
             SGLD +G  + N E++W++++ G+D + ++K   WY+    YW+GVEA+VDG+LGG   V
Sbjct:    24 SGLDGEGNTYINIEDLWKKELEGKDNKMEDK---WYKSADEYWKGVEATVDGMLGGLAQV 80

Query:   131 NEVDIKGSEAFLQMLLSDRFPNARNNQHLVALDCGSGIGRITKNLLIRY-FNEVDLLEPV 189
             + +D+  S+ F+Q  +         N +L ALDCG+GIGR+ K  L+   F  VDL+E  
Sbjct:    81 SPIDVVASKVFIQDFIKGTDSRPPINLNL-ALDCGAGIGRVAKEFLLPIGFKNVDLVEQN 139

Query:   190 SHFLDAARESLAPENHMAPDMHKATNFFCVPLQ 222
               FLD A+     +N    D ++  N++ V LQ
Sbjct:   140 KLFLDKAKS----DNFK--DDNRVENYYAVGLQ 166

GO:0008168 "methyltransferase activity" evidence=IEA

GO:0032259 "methylation" evidence=IEA

GO:0016740 "transferase activity" evidence=IEA

UNIPROTKB\|B1H2P7 ntmt1 "N-terminal Xaa-Pro-Lys N-methyltransferase 1" [Xenopus (Silurana) tropicalis (taxid:8364)]	Back alignment and assigned GO terms

UNIPROTKB\|Q4KL94 ntmt1-a "N-terminal Xaa-Pro-Lys N-methyltransferase 1-A" [Xenopus laevis (taxid:8355)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-040426-2055 ntmt1 "N-terminal Xaa-Pro-Lys N-methyltransferase 1" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

UNIPROTKB\|F1MKD1 METTL11A "Uncharacterized protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|Q4KLE6 ntmt1-b "N-terminal Xaa-Pro-Lys N-methyltransferase 1-B" [Xenopus laevis (taxid:8355)]	Back alignment and assigned GO terms

UNIPROTKB\|Q9BV86 NTMT1 "N-terminal Xaa-Pro-Lys N-methyltransferase 1" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|Q2T9N3 NTMT1 "N-terminal Xaa-Pro-Lys N-methyltransferase 1" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|D2H163 NTMT1 "N-terminal Xaa-Pro-Lys N-methyltransferase 1" [Ailuropoda melanoleuca (taxid:9646)]	Back alignment and assigned GO terms

UNIPROTKB\|F1RQG3 NTMT1 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	2.1.1	LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	eugene3.00111342	hypothetical protein (276 aa)
		(Populus trichocarpa)
Predicted Functional Partners:
	gw1.V.3607.1	phosphoserine transaminase (EC-2.6.1.52) (378 aa)	•	0.411

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		223
pfam05891		217	pfam05891, Methyltransf_PK, AdoMet dependent proli	2e-55

>gnl\|CDD\|218798 pfam05891, Methyltransf_PK, AdoMet dependent proline di-methyltransferase	Back alignment and domain information

 Score =  175 bits (446), Expect = 2e-55
 Identities = 64/122 (52%), Positives = 86/122 (70%), Gaps = 8/122 (6%)

Query: 101 KKTQWYREGISYWEGVEASVDGVLGGFGNVNEVDIKGSEAFLQMLLSDRFPNARNNQHLV 160
            + Q+Y + I+YWEGV A+VDG+LGG+G+V+++D+ GS  FL+ LL +R P     +HLV
Sbjct: 1   DEEQFYSKAIAYWEGVSATVDGMLGGYGHVSDIDVNGSRNFLRRLLRERLPGK--RRHLV 58

Query: 161 ALDCGSGIGRITKNLLIRYFNEVDLLEPVSHFLDAARESLAPENHMAPDMHKATNFFCVP 220
           ALDCG+GIGR+TKNLL+  F++VDL+EPV  FL  A+E LA          K  NFFCV 
Sbjct: 59  ALDCGAGIGRVTKNLLLPLFSKVDLVEPVEDFLAKAKEYLAEGK------KKVGNFFCVG 112

Query: 221 LQ 222
           LQ
Sbjct: 113 LQ 114

This protein is expressed in the tail neuron PVT and in uterine cells in C. elegans [worm-base]. In Saccharomyces cerevisiae this is AdoMet dependent proline di-methyltransferase. This enzyme catalyzes the di-methylation of ribosomal proteins Rpl12 and Rps25 at N-terminal proline residues. The methyltransferases described here specifically recognise the N-terminal X-Pro-Lys sequence motif, and they may account for nearly all previously described eukaryotic protein N-terminal methylation reactions. A number of other yeast and human proteins also share the recognition motif and may be similarly modified. As with other methyltransferases, this family carries the characteristic GxGxG motif. Length = 217

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		223
PF05891		218	Methyltransf_PK: AdoMet dependent proline di-methy	100.0
KOG3178		342	consensus Hydroxyindole-O-methyltransferase and re	99.71
PF12847		112	Methyltransf_18: Methyltransferase domain; PDB: 3G	98.4
PRK11207		197	tellurite resistance protein TehB; Provisional	98.12
PLN02336		475	phosphoethanolamine N-methyltransferase	98.11
PTZ00098		263	phosphoethanolamine N-methyltransferase; Provision	98.06
TIGR02469		124	CbiT precorrin-6Y C5,15-methyltransferase (decarbo	98.04
PF08241		95	Methyltransf_11: Methyltransferase domain; InterPr	98.03
PLN02396		322	hexaprenyldihydroxybenzoate methyltransferase	98.02
PRK11036		255	putative S-adenosyl-L-methionine-dependent methylt	97.98
PRK01683		258	trans-aconitate 2-methyltransferase; Provisional	97.97
TIGR00477		195	tehB tellurite resistance protein TehB. Part of a	97.97
PF13649		101	Methyltransf_25: Methyltransferase domain; PDB: 3B	97.95
PF08242		99	Methyltransf_12: Methyltransferase domain; InterPr	97.93
smart00650		169	rADc Ribosomal RNA adenine dimethylases.	97.91
PRK07402		196	precorrin-6B methylase; Provisional	97.88
PF13847		152	Methyltransf_31: Methyltransferase domain; PDB: 3T	97.88
PRK15001		378	SAM-dependent 23S ribosomal RNA mG1835 methyltrans	97.86
PRK10258		251	biotin biosynthesis protein BioC; Provisional	97.83
PRK00107		187	gidB 16S rRNA methyltransferase GidB; Reviewed	97.83
TIGR00080		215	pimt protein-L-isoaspartate(D-aspartate) O-methylt	97.83
TIGR02752		231	MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me	97.82
PF05219		265	DREV: DREV methyltransferase; InterPro: IPR007884	97.8
PRK00811		283	spermidine synthase; Provisional	97.8
TIGR02021		219	BchM-ChlM magnesium protoporphyrin O-methyltransfe	97.79
COG2226		238	UbiE Methylase involved in ubiquinone/menaquinone	97.79
PF05175		170	MTS: Methyltransferase small domain; InterPro: IPR	97.78
PRK00274		272	ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1	97.78
PRK05785		226	hypothetical protein; Provisional	97.75
TIGR03587		204	Pse_Me-ase pseudaminic acid biosynthesis-associate	97.75
PRK08287		187	cobalt-precorrin-6Y C(15)-methyltransferase; Valid	97.74
TIGR01444		143	fkbM_fam methyltransferase, FkbM family. Members o	97.73
PRK15451		247	tRNA cmo(5)U34 methyltransferase; Provisional	97.69
PRK14103		255	trans-aconitate 2-methyltransferase; Provisional	97.69
PRK13942		212	protein-L-isoaspartate O-methyltransferase; Provis	97.68
TIGR00138		181	gidB 16S rRNA methyltransferase GidB. GidB (glucos	97.67
PLN02233		261	ubiquinone biosynthesis methyltransferase	97.67
PF01209		233	Ubie_methyltran: ubiE/COQ5 methyltransferase famil	97.65
TIGR00755		253	ksgA dimethyladenosine transferase. Alternate name	97.65
PRK00121		202	trmB tRNA (guanine-N(7)-)-methyltransferase; Revie	97.64
PRK12335		287	tellurite resistance protein TehB; Provisional	97.64
PRK13168		443	rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe	97.62
PRK00312		212	pcm protein-L-isoaspartate O-methyltransferase; Re	97.61
PRK10909		199	rsmD 16S rRNA m(2)G966-methyltransferase; Provisio	97.59
PRK07580		230	Mg-protoporphyrin IX methyl transferase; Validated	97.58
COG2813		300	RsmC 16S RNA G1207 methylase RsmC [Translation, ri	97.58
TIGR00740		239	methyltransferase, putative. A simple BLAST search	97.57
PRK06202		232	hypothetical protein; Provisional	97.57
PRK09489		342	rsmC 16S ribosomal RNA m2G1207 methyltransferase;	97.55
TIGR00406		288	prmA ribosomal protein L11 methyltransferase. Ribo	97.52
PLN02585		315	magnesium protoporphyrin IX methyltransferase	97.52
PF13489		161	Methyltransf_23: Methyltransferase domain; PDB: 3J	97.52
PRK05134		233	bifunctional 3-demethylubiquinone-9 3-methyltransf	97.51
TIGR00091		194	tRNA (guanine-N(7)-)-methyltransferase. In E. coli	97.5
PRK14896		258	ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1	97.49
PLN02336		475	phosphoethanolamine N-methyltransferase	97.49
TIGR00479		431	rumA 23S rRNA (uracil-5-)-methyltransferase RumA.	97.46
PRK00517		250	prmA ribosomal protein L11 methyltransferase; Revi	97.46
TIGR03438		301	probable methyltransferase. This model represents	97.43
PRK03522		315	rumB 23S rRNA methyluridine methyltransferase; Rev	97.42
TIGR00537		179	hemK_rel_arch HemK-related putative methylase. The	97.41
PRK13944		205	protein-L-isoaspartate O-methyltransferase; Provis	97.4
PRK00377		198	cbiT cobalt-precorrin-6Y C(15)-methyltransferase;	97.37
PTZ00338		294	dimethyladenosine transferase-like protein; Provis	97.36
TIGR00452		314	methyltransferase, putative. Known examples to dat	97.36
PRK00216		239	ubiE ubiquinone/menaquinone biosynthesis methyltra	97.35
PF03848		192	TehB: Tellurite resistance protein TehB; InterPro:	97.35
PRK05031		362	tRNA (uracil-5-)-methyltransferase; Validated	97.35
PF05401		201	NodS: Nodulation protein S (NodS); InterPro: IPR00	97.33
PLN02244		340	tocopherol O-methyltransferase	97.33
TIGR01983		224	UbiG ubiquinone biosynthesis O-methyltransferase.	97.31
KOG1270		282	consensus Methyltransferases [Coenzyme transport a	97.28
TIGR00417		270	speE spermidine synthase. the SpeE subunit of sper	97.28
PRK13943		322	protein-L-isoaspartate O-methyltransferase; Provis	97.26
TIGR01934		223	MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis	97.25
TIGR02143		353	trmA_only tRNA (uracil-5-)-methyltransferase. This	97.25
PRK14968		188	putative methyltransferase; Provisional	97.21
PRK15068		322	tRNA mo(5)U34 methyltransferase; Provisional	97.2
COG2263		198	Predicted RNA methylase [Translation, ribosomal st	97.2
COG2227		243	UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-	97.19
TIGR02072		240	BioC biotin biosynthesis protein BioC. This enzyme	97.19
PHA01634		156	hypothetical protein	97.19
PRK15128		396	23S rRNA m(5)C1962 methyltransferase; Provisional	97.15
PF13659		117	Methyltransf_26: Methyltransferase domain; PDB: 3G	97.14
PRK14967		223	putative methyltransferase; Provisional	97.14
PF00398		262	RrnaAD: Ribosomal RNA adenine dimethylase; InterPr	97.14
PRK04266		226	fibrillarin; Provisional	97.09
TIGR02081		194	metW methionine biosynthesis protein MetW. This pr	97.09
cd02440		107	AdoMet_MTases S-adenosylmethionine-dependent methy	97.05
PRK08317		241	hypothetical protein; Provisional	97.04
PRK11873		272	arsM arsenite S-adenosylmethyltransferase; Reviewe	97.04
TIGR03534		251	RF_mod_PrmC protein-(glutamine-N5) methyltransfera	97.02
PLN02366		308	spermidine synthase	97.01
TIGR03840		213	TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d	97.01
PRK11705		383	cyclopropane fatty acyl phospholipid synthase; Pro	97.0
PRK14902		444	16S rRNA methyltransferase B; Provisional	96.96
TIGR00478		228	tly hemolysin TlyA family protein. Hemolysins are	96.96
TIGR00446		264	nop2p NOL1/NOP2/sun family putative RNA methylase.	96.95
PF02353		273	CMAS: Mycolic acid cyclopropane synthetase; InterP	96.93
TIGR00095		189	RNA methyltransferase, RsmD family. This model rep	96.93
COG2242		187	CobL Precorrin-6B methylase 2 [Coenzyme metabolism	96.84
PRK14901		434	16S rRNA methyltransferase B; Provisional	96.83
TIGR02085		374	meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer	96.81
PRK09328		275	N5-glutamine S-adenosyl-L-methionine-dependent met	96.79
PRK11783		702	rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi	96.77
PRK03612		521	spermidine synthase; Provisional	96.77
KOG3010		261	consensus Methyltransferase [General function pred	96.75
COG2518		209	Pcm Protein-L-isoaspartate carboxylmethyltransfera	96.74
PRK10901		427	16S rRNA methyltransferase B; Provisional	96.72
TIGR03533		284	L3_gln_methyl protein-(glutamine-N5) methyltransfe	96.72
PLN02490		340	MPBQ/MSBQ methyltransferase	96.71
COG0030		259	KsgA Dimethyladenosine transferase (rRNA methylati	96.71
PF01135		209	PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl	96.71
PRK14903		431	16S rRNA methyltransferase B; Provisional	96.68
PRK13255		218	thiopurine S-methyltransferase; Reviewed	96.67
PF05958		352	tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferas	96.66
PRK11088		272	rrmA 23S rRNA methyltransferase A; Provisional	96.66
TIGR00536		284	hemK_fam HemK family putative methylases. The gene	96.64
TIGR03704		251	PrmC_rel_meth putative protein-(glutamine-N5) meth	96.6
PRK14121		390	tRNA (guanine-N(7)-)-methyltransferase; Provisiona	96.6
PHA03411		279	putative methyltransferase; Provisional	96.59
smart00828		224	PKS_MT Methyltransferase in polyketide synthase (P	96.57
TIGR00563		426	rsmB ribosomal RNA small subunit methyltransferase	96.51
PRK14904		445	16S rRNA methyltransferase B; Provisional	96.51
COG2230		283	Cfa Cyclopropane fatty acid synthase and related m	96.35
PRK11805		307	N5-glutamine S-adenosyl-L-methionine-dependent met	96.34
PF06325		295	PrmA: Ribosomal protein L11 methyltransferase (Prm	96.31
PRK04457		262	spermidine synthase; Provisional	96.31
COG4106		257	Tam Trans-aconitate methyltransferase [General fun	96.29
PRK14966		423	unknown domain/N5-glutamine S-adenosyl-L-methionin	96.27
PRK01544		506	bifunctional N5-glutamine S-adenosyl-L-methionine-	96.22
TIGR01177		329	conserved hypothetical protein TIGR01177. This fam	96.22
TIGR00438		188	rrmJ cell division protein FtsJ.	96.21
COG2890		280	HemK Methylase of polypeptide chain release factor	96.19
TIGR02716		306	C20_methyl_CrtF C-20 methyltransferase BchU. Membe	95.96
PRK01581		374	speE spermidine synthase; Validated	95.95
PRK06922		677	hypothetical protein; Provisional	95.91
PTZ00146		293	fibrillarin; Provisional	95.9
COG2264		300	PrmA Ribosomal protein L11 methylase [Translation,	95.88
PLN02823		336	spermine synthase	95.61
PRK11188		209	rrmJ 23S rRNA methyltransferase J; Provisional	95.59
KOG4300		252	consensus Predicted methyltransferase [General fun	95.54
PHA03412		241	putative methyltransferase; Provisional	95.51
PLN02781		234	Probable caffeoyl-CoA O-methyltransferase	95.51
PF03602		183	Cons_hypoth95: Conserved hypothetical protein 95;	95.47
KOG0820		315	consensus Ribosomal RNA adenine dimethylase [RNA p	95.4
COG4976		287	Predicted methyltransferase (contains TPR repeat)	95.38
PF09445		163	Methyltransf_15: RNA cap guanine-N2 methyltransfer	95.23
PF09243		274	Rsm22: Mitochondrial small ribosomal subunit Rsm22	94.91
KOG3987		288	consensus Uncharacterized conserved protein DREV/C	94.9
PRK04148		134	hypothetical protein; Provisional	94.89
smart00138		264	MeTrc Methyltransferase, chemotaxis proteins. Meth	94.72
PRK00050		296	16S rRNA m(4)C1402 methyltranserfase; Provisional	94.66
PF08704		247	GCD14: tRNA methyltransferase complex GCD14 subuni	94.55
COG4123		248	Predicted O-methyltransferase [General function pr	94.45
PF02636		252	Methyltransf_28: Putative S-adenosyl-L-methionine-	94.45
PF13679		141	Methyltransf_32: Methyltransferase domain	94.4
COG0500		257	SmtA SAM-dependent methyltransferases [Secondary m	94.4
PF01596		205	Methyltransf_3: O-methyltransferase; InterPro: IPR	94.24
PF08003		315	Methyltransf_9: Protein of unknown function (DUF16	94.24
KOG1540		296	consensus Ubiquinone biosynthesis methyltransferas	94.22
PRK11727		321	23S rRNA mA1618 methyltransferase; Provisional	94.05
COG2265		432	TrmA SAM-dependent methyltransferases related to t	93.95
PLN02672		1082	methionine S-methyltransferase	93.93
PLN03075		296	nicotianamine synthase; Provisional	93.89
PF02475		200	Met_10: Met-10+ like-protein; InterPro: IPR003402	93.71
PF01564		246	Spermine_synth: Spermine/spermidine synthase; Inte	93.53
COG4122		219	Predicted O-methyltransferase [General function pr	93.5
PRK04338		382	N(2),N(2)-dimethylguanosine tRNA methyltransferase	93.36
PF05050		167	Methyltransf_21: Methyltransferase FkbM domain; In	93.3
PLN02476		278	O-methyltransferase	93.3
COG2519		256	GCD14 tRNA(1-methyladenosine) methyltransferase an	93.21
COG0357		215	GidB Predicted S-adenosylmethionine-dependent meth	92.25
PF10294		173	Methyltransf_16: Putative methyltransferase; Inter	91.72
COG3963		194	Phospholipid N-methyltransferase [Lipid metabolism	91.64
COG0421		282	SpeE Spermidine synthase [Amino acid transport and	91.57
KOG1541		270	consensus Predicted protein carboxyl methylase [Ge	91.29
KOG2940		325	consensus Predicted methyltransferase [General fun	91.2
KOG1499		346	consensus Protein arginine N-methyltransferase PRM	90.41
PF02527		184	GidB: rRNA small subunit methyltransferase G; Inte	90.39
PF07021		193	MetW: Methionine biosynthesis protein MetW; InterP	90.36
PF08123		205	DOT1: Histone methylation protein DOT1 ; InterPro:	90.28
PF02390		195	Methyltransf_4: Putative methyltransferase ; Inter	89.91
KOG2904		328	consensus Predicted methyltransferase [General fun	89.9
KOG1500		517	consensus Protein arginine N-methyltransferase CAR	89.33
PRK10742		250	putative methyltransferase; Provisional	89.16
TIGR00308		374	TRM1 tRNA(guanine-26,N2-N2) methyltransferase. Thi	88.6
PRK11933		470	yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF;	88.59
COG0742		187	N6-adenine-specific methylase [DNA replication, re	87.54
PF01728		181	FtsJ: FtsJ-like methyltransferase; InterPro: IPR00	87.07
COG1565		370	Uncharacterized conserved protein [Function unknow	86.88
PLN02589		247	caffeoyl-CoA O-methyltransferase	86.01
PRK13256		226	thiopurine S-methyltransferase; Reviewed	85.96
TIGR03439		319	methyl_EasF probable methyltransferase domain, Eas	85.59
PF05185		448	PRMT5: PRMT5 arginine-N-methyltransferase; InterPr	85.58
PRK11760		357	putative 23S rRNA C2498 ribose 2'-O-ribose methylt	84.39
PRK00536		262	speE spermidine synthase; Provisional	84.23
COG4076		252	Predicted RNA methylase [General function predicti	84.03
PF04816		205	DUF633: Family of unknown function (DUF633) ; Inte	83.93
PF05724		218	TPMT: Thiopurine S-methyltransferase (TPMT); Inter	83.21
COG1189		245	Predicted rRNA methylase [Translation, ribosomal s	82.74
KOG2899		288	consensus Predicted methyltransferase [General fun	81.32
KOG3191		209	consensus Predicted N6-DNA-methyltransferase [Tran	81.17
PF00891		241	Methyltransf_2: O-methyltransferase; InterPro: IPR	80.75

>PF05891 Methyltransf_PK: AdoMet dependent proline di-methyltransferase; InterPro: IPR008576 This family consists of several eukaryotic proteins of unknown function that are S-adenosyl-L-methionine-dependent methyltransferase-like	Back alignment and domain information

Probab=100.00  E-value=3.9e-40  Score=287.96  Aligned_cols=114  Identities=50%  Similarity=0.930  Sum_probs=94.0

Q ss_pred             hhhhhhhhhhcccCCccchhccccCCCcccccchhhHHHHHHHHhcCCCCCcCCCcceeeeccCCCcccccHHHHhhcCC
Q 027421          102 KTQWYREGISYWEGVEASVDGVLGGFGNVNEVDIKGSEAFLQMLLSDRFPNARNNQHLVALDCGSGIGRITKNLLIRYFN  181 (223)
Q Consensus       102 k~~~Y~~a~~YWe~veaTvdGMLGGf~~vs~~Di~~Sr~FL~~L~~~~~~~~~~~~~~rALDcGAGIGRVTk~LLl~~f~  181 (223)
                      +..||.++.+||++++||+|||||||++||++||++|+.||++|..+..+  ......+||||||||||||++||+++|+
T Consensus         2 ~~~~y~~a~~YW~~v~atvdGMLGG~~~is~~Di~gS~~FL~~l~~~~~~--~~~~~~~alDcGAGIGRVTk~lLl~~f~   79 (218)
T PF05891_consen    2 KKIWYEKAKEYWENVPATVDGMLGGFGHISRIDIQGSRNFLKKLKRGRKP--GKPKFNRALDCGAGIGRVTKGLLLPVFD   79 (218)
T ss_dssp             HCHHHHHHHHHHHTS-SSHHHHTTT-GGGHHHHHHHHHHHHHCCCT-----------SEEEEET-TTTHHHHHTCCCC-S
T ss_pred             cccHHHHHHHHHcCCCCCccccccCCCCCChHHHHHHHHHHHHHHhhccc--CCCCcceEEecccccchhHHHHHHHhcC
Confidence            46899999999999999999999999999999999999999999875322  2346789999999999999999999999


Q ss_pred             eeEEecCcHHHHHHHHHhhCccCCCCCCCCCcceEEEccCCC
Q 027421          182 EVDLLEPVSHFLDAARESLAPENHMAPDMHKATNFFCVPLQV  223 (223)
Q Consensus       182 ~VDlVEP~e~Fle~Ake~l~~~~~~~~~~~kv~nf~cvgLQ~  223 (223)
                      +||||||+++|+++|+++++.      +..++++|||+|||+
T Consensus        80 ~VDlVEp~~~Fl~~a~~~l~~------~~~~v~~~~~~gLQ~  115 (218)
T PF05891_consen   80 EVDLVEPVEKFLEQAKEYLGK------DNPRVGEFYCVGLQD  115 (218)
T ss_dssp             EEEEEES-HHHHHHHHHHTCC------GGCCEEEEEES-GGG
T ss_pred             EeEEeccCHHHHHHHHHHhcc------cCCCcceEEecCHhh
Confidence            999999999999999999955      347999999999996

; GO: 0008168 methyltransferase activity; PDB: 1XTP_A 2EX4_B.

>KOG3178 consensus Hydroxyindole-O-methyltransferase and related SAM-dependent methyltransferases [General function prediction only]	Back alignment and domain information

>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A	Back alignment and domain information

>PRK11207 tellurite resistance protein TehB; Provisional	Back alignment and domain information

>PLN02336 phosphoethanolamine N-methyltransferase	Back alignment and domain information

>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional	Back alignment and domain information

>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit	Back alignment and domain information

>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals	Back alignment and domain information

>PLN02396 hexaprenyldihydroxybenzoate methyltransferase	Back alignment and domain information

>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional	Back alignment and domain information

>PRK01683 trans-aconitate 2-methyltransferase; Provisional	Back alignment and domain information

>TIGR00477 tehB tellurite resistance protein TehB	Back alignment and domain information

>PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A	Back alignment and domain information

>PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals	Back alignment and domain information

>smart00650 rADc Ribosomal RNA adenine dimethylases	Back alignment and domain information

>PRK07402 precorrin-6B methylase; Provisional	Back alignment and domain information

>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A	Back alignment and domain information

>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional	Back alignment and domain information

>PRK10258 biotin biosynthesis protein BioC; Provisional	Back alignment and domain information

>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed	Back alignment and domain information

>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase	Back alignment and domain information

>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase	Back alignment and domain information

>PF05219 DREV: DREV methyltransferase; InterPro: IPR007884 This family contains DREV protein homologues from several eukaryotes	Back alignment and domain information

>PRK00811 spermidine synthase; Provisional	Back alignment and domain information

>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase	Back alignment and domain information

>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism]	Back alignment and domain information

>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases	Back alignment and domain information

>PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed	Back alignment and domain information

>PRK05785 hypothetical protein; Provisional	Back alignment and domain information

>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase	Back alignment and domain information

>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated	Back alignment and domain information

>TIGR01444 fkbM_fam methyltransferase, FkbM family	Back alignment and domain information

>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional	Back alignment and domain information

>PRK14103 trans-aconitate 2-methyltransferase; Provisional	Back alignment and domain information

>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional	Back alignment and domain information

>TIGR00138 gidB 16S rRNA methyltransferase GidB	Back alignment and domain information

>PLN02233 ubiquinone biosynthesis methyltransferase	Back alignment and domain information

>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities []	Back alignment and domain information

>TIGR00755 ksgA dimethyladenosine transferase	Back alignment and domain information

>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed	Back alignment and domain information

>PRK12335 tellurite resistance protein TehB; Provisional	Back alignment and domain information

>PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed	Back alignment and domain information

>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed	Back alignment and domain information

>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional	Back alignment and domain information

>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated	Back alignment and domain information

>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>TIGR00740 methyltransferase, putative	Back alignment and domain information

>PRK06202 hypothetical protein; Provisional	Back alignment and domain information

>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional	Back alignment and domain information

>TIGR00406 prmA ribosomal protein L11 methyltransferase	Back alignment and domain information

>PLN02585 magnesium protoporphyrin IX methyltransferase	Back alignment and domain information

>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C	Back alignment and domain information

>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional	Back alignment and domain information

>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase	Back alignment and domain information

>PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional	Back alignment and domain information

>PLN02336 phosphoethanolamine N-methyltransferase	Back alignment and domain information

>TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA	Back alignment and domain information

>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed	Back alignment and domain information

>TIGR03438 probable methyltransferase	Back alignment and domain information

>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed	Back alignment and domain information

>TIGR00537 hemK_rel_arch HemK-related putative methylase	Back alignment and domain information

>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional	Back alignment and domain information

>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional	Back alignment and domain information

>PTZ00338 dimethyladenosine transferase-like protein; Provisional	Back alignment and domain information

>TIGR00452 methyltransferase, putative	Back alignment and domain information

>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed	Back alignment and domain information

>PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB	Back alignment and domain information

>PRK05031 tRNA (uracil-5-)-methyltransferase; Validated	Back alignment and domain information

>PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins	Back alignment and domain information

>PLN02244 tocopherol O-methyltransferase	Back alignment and domain information

>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase	Back alignment and domain information

>KOG1270 consensus Methyltransferases [Coenzyme transport and metabolism]	Back alignment and domain information

>TIGR00417 speE spermidine synthase	Back alignment and domain information

>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional	Back alignment and domain information

>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases	Back alignment and domain information

>TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase	Back alignment and domain information

>PRK14968 putative methyltransferase; Provisional	Back alignment and domain information

>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional	Back alignment and domain information

>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism]	Back alignment and domain information

>TIGR02072 BioC biotin biosynthesis protein BioC	Back alignment and domain information

>PHA01634 hypothetical protein	Back alignment and domain information

>PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional	Back alignment and domain information

>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A	Back alignment and domain information

>PRK14967 putative methyltransferase; Provisional	Back alignment and domain information

>PF00398 RrnaAD: Ribosomal RNA adenine dimethylase; InterPro: IPR001737 This family of proteins include rRNA adenine dimethylases (e	Back alignment and domain information

>PRK04266 fibrillarin; Provisional	Back alignment and domain information

>TIGR02081 metW methionine biosynthesis protein MetW	Back alignment and domain information

>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy)	Back alignment and domain information

>PRK08317 hypothetical protein; Provisional	Back alignment and domain information

>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed	Back alignment and domain information

>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific	Back alignment and domain information

>PLN02366 spermidine synthase	Back alignment and domain information

>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family	Back alignment and domain information

>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional	Back alignment and domain information

>PRK14902 16S rRNA methyltransferase B; Provisional	Back alignment and domain information

>TIGR00478 tly hemolysin TlyA family protein	Back alignment and domain information

>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase	Back alignment and domain information

>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4)	Back alignment and domain information

>TIGR00095 RNA methyltransferase, RsmD family	Back alignment and domain information

>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism]	Back alignment and domain information

>PRK14901 16S rRNA methyltransferase B; Provisional	Back alignment and domain information

>TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB	Back alignment and domain information

>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional	Back alignment and domain information

>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional	Back alignment and domain information

>PRK03612 spermidine synthase; Provisional	Back alignment and domain information

>KOG3010 consensus Methyltransferase [General function prediction only]	Back alignment and domain information

>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK10901 16S rRNA methyltransferase B; Provisional	Back alignment and domain information

>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific	Back alignment and domain information

>PLN02490 MPBQ/MSBQ methyltransferase	Back alignment and domain information

>COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2	Back alignment and domain information

>PRK14903 16S rRNA methyltransferase B; Provisional	Back alignment and domain information

>PRK13255 thiopurine S-methyltransferase; Reviewed	Back alignment and domain information

>PF05958 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferase; InterPro: IPR010280 This family consists of (uracil-5-)-methyltransferases 2	Back alignment and domain information

>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional	Back alignment and domain information

>TIGR00536 hemK_fam HemK family putative methylases	Back alignment and domain information

>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific	Back alignment and domain information

>PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional	Back alignment and domain information

>PHA03411 putative methyltransferase; Provisional	Back alignment and domain information

>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes	Back alignment and domain information

>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB	Back alignment and domain information

>PRK14904 16S rRNA methyltransferase B; Provisional	Back alignment and domain information

>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional	Back alignment and domain information

>PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences	Back alignment and domain information

>PRK04457 spermidine synthase; Provisional	Back alignment and domain information

>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only]	Back alignment and domain information

>PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional	Back alignment and domain information

>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed	Back alignment and domain information

>TIGR01177 conserved hypothetical protein TIGR01177	Back alignment and domain information

>TIGR00438 rrmJ cell division protein FtsJ	Back alignment and domain information

>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU	Back alignment and domain information

>PRK01581 speE spermidine synthase; Validated	Back alignment and domain information

>PRK06922 hypothetical protein; Provisional	Back alignment and domain information

>PTZ00146 fibrillarin; Provisional	Back alignment and domain information

>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PLN02823 spermine synthase	Back alignment and domain information

>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional	Back alignment and domain information

>KOG4300 consensus Predicted methyltransferase [General function prediction only]	Back alignment and domain information

>PHA03412 putative methyltransferase; Provisional	Back alignment and domain information

>PLN02781 Probable caffeoyl-CoA O-methyltransferase	Back alignment and domain information

>PF03602 Cons_hypoth95: Conserved hypothetical protein 95; InterPro: IPR004398 This entry contains Ribosomal RNA small subunit methyltransferase D as well as the putative rRNA methyltransferase YlbH	Back alignment and domain information

>KOG0820 consensus Ribosomal RNA adenine dimethylase [RNA processing and modification]	Back alignment and domain information

>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only]	Back alignment and domain information

>PF09445 Methyltransf_15: RNA cap guanine-N2 methyltransferase; InterPro: IPR019012 RNA cap guanine-N2 methyltransferases such as Schizosaccharomyces pombe (Fission yeast) trimethylguanosine synthase (Tgs1) and Giardia lamblia (Giardia intestinalis) Tgs2, catalyse the methylation step(s) for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure [, , ]

Back alignment and domain information

>PF09243 Rsm22: Mitochondrial small ribosomal subunit Rsm22; InterPro: IPR015324 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms	Back alignment and domain information

>KOG3987 consensus Uncharacterized conserved protein DREV/CGI-81 [Function unknown]	Back alignment and domain information

>PRK04148 hypothetical protein; Provisional	Back alignment and domain information

>smart00138 MeTrc Methyltransferase, chemotaxis proteins	Back alignment and domain information

>PRK00050 16S rRNA m(4)C1402 methyltranserfase; Provisional	Back alignment and domain information

>PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA []	Back alignment and domain information

>COG4123 Predicted O-methyltransferase [General function prediction only]	Back alignment and domain information

>PF02636 Methyltransf_28: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR003788 This entry describes proteins of unknown function	Back alignment and domain information

>PF13679 Methyltransf_32: Methyltransferase domain	Back alignment and domain information

>COG0500 SmtA SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only]	Back alignment and domain information

>PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases	Back alignment and domain information

>PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals	Back alignment and domain information

>KOG1540 consensus Ubiquinone biosynthesis methyltransferase COQ5 [Coenzyme transport and metabolism]	Back alignment and domain information

>PRK11727 23S rRNA mA1618 methyltransferase; Provisional	Back alignment and domain information

>COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PLN02672 methionine S-methyltransferase	Back alignment and domain information

>PLN03075 nicotianamine synthase; Provisional	Back alignment and domain information

>PF02475 Met_10: Met-10+ like-protein; InterPro: IPR003402 This entry represents the Trm5 family	Back alignment and domain information

>PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2	Back alignment and domain information

>COG4122 Predicted O-methyltransferase [General function prediction only]	Back alignment and domain information

>PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional	Back alignment and domain information

>PF05050 Methyltransf_21: Methyltransferase FkbM domain; InterPro: IPR007744 This entry contains proteins of unknown function	Back alignment and domain information

>PLN02476 O-methyltransferase	Back alignment and domain information

>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>COG0357 GidB Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PF10294 Methyltransf_16: Putative methyltransferase; InterPro: IPR019410 There are a number of unidentified genes that have a high probability of coding for methyltransferases	Back alignment and domain information

>COG3963 Phospholipid N-methyltransferase [Lipid metabolism]	Back alignment and domain information

>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism]	Back alignment and domain information

>KOG1541 consensus Predicted protein carboxyl methylase [General function prediction only]	Back alignment and domain information

>KOG2940 consensus Predicted methyltransferase [General function prediction only]	Back alignment and domain information

>KOG1499 consensus Protein arginine N-methyltransferase PRMT1 and related enzymes [Posttranslational modification, protein turnover, chaperones; Transcription; Signal transduction mechanisms]	Back alignment and domain information

>PF02527 GidB: rRNA small subunit methyltransferase G; InterPro: IPR003682 This entry represents a rRNA small subunit methyltransferase G	Back alignment and domain information

>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins	Back alignment and domain information

>PF08123 DOT1: Histone methylation protein DOT1 ; InterPro: IPR013110 The DOT1 domain regulates gene expression by methylating histone H3 []	Back alignment and domain information

>PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2	Back alignment and domain information

>KOG2904 consensus Predicted methyltransferase [General function prediction only]	Back alignment and domain information

>KOG1500 consensus Protein arginine N-methyltransferase CARM1 [Posttranslational modification, protein turnover, chaperones; Transcription]	Back alignment and domain information

>PRK10742 putative methyltransferase; Provisional	Back alignment and domain information

>TIGR00308 TRM1 tRNA(guanine-26,N2-N2) methyltransferase	Back alignment and domain information

>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed	Back alignment and domain information

>COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair]	Back alignment and domain information

>PF01728 FtsJ: FtsJ-like methyltransferase; InterPro: IPR002877 RrmJ (FtsJ) is a well conserved heat shock protein present in prokaryotes, archaea, and eukaryotes	Back alignment and domain information

>COG1565 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PLN02589 caffeoyl-CoA O-methyltransferase	Back alignment and domain information

>PRK13256 thiopurine S-methyltransferase; Reviewed	Back alignment and domain information

>TIGR03439 methyl_EasF probable methyltransferase domain, EasF family	Back alignment and domain information

>PF05185 PRMT5: PRMT5 arginine-N-methyltransferase; InterPro: IPR007857 The human homologue of Saccharomyces cerevisiae Skb1 (Shk1 kinase-binding protein 1) is a protein methyltransferase []	Back alignment and domain information

>PRK11760 putative 23S rRNA C2498 ribose 2'-O-ribose methyltransferase; Provisional	Back alignment and domain information

>PRK00536 speE spermidine synthase; Provisional	Back alignment and domain information

>COG4076 Predicted RNA methylase [General function prediction only]	Back alignment and domain information

>PF04816 DUF633: Family of unknown function (DUF633) ; InterPro: IPR006901 This is a family of uncharacterised bacterial proteins	Back alignment and domain information

>PF05724 TPMT: Thiopurine S-methyltransferase (TPMT); InterPro: IPR008854 This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes	Back alignment and domain information

>COG1189 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG2899 consensus Predicted methyltransferase [General function prediction only]	Back alignment and domain information

>KOG3191 consensus Predicted N6-DNA-methyltransferase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		223
1xtp_A		254	Structural Analysis Of Leishmania Major Lmaj004091a		4e-25
2ex4_A		241	Crystal Structure Of Human Methyltransferase Ad-003		3e-20

>pdb|1XTP|A Chain A, Structural Analysis Of Leishmania Major Lmaj004091aaa, A Sam-dependent Methyltransferase Of The Duf858/pfam05891 Family Length = 254

Back alignment and structure

Iteration: 1

Score = 110 bits (276), Expect = 4e-25, Method: Compositional matrix adjust. Identities = 61/147 (41%), Positives = 89/147 (60%), Gaps = 11/147 (7%) Query: 56 GAAADPKHKESS-AMEVSGLDSDGKEFKNAEEMWREQIGEDGEQQEKKTQWYREGISYWE 114 G + P + SS + +SG D++GK +++ +E W+ ++ D EK WY + + YW Sbjct: 1 GPGSXPSKEASSRNLPISGRDTNGKTYRSTDEXWKAELTGDLYDPEK--GWYGKALEYWR 58 Query: 115 GVEASVDGVLGGFGNVNEVDIKGSEAFLQMLLSDRFPNARNNQHLVALDCGSGIGRITKN 174 V A+V GVLGG +V++VDI+GS F+ L P ++ ALDCG+GIGRITKN Sbjct: 59 TVPATVSGVLGGXDHVHDVDIEGSRNFIASL-----PGHGTSR---ALDCGAGIGRITKN 110 Query: 175 LLIRYFNEVDLLEPVSHFLDAARESLA 201 LL + + DLLEPV H L+ A+ LA Sbjct: 111 LLTKLYATTDLLEPVKHXLEEAKRELA 137

PyMOL of 1xtp

>pdb|2EX4|A Chain A, Crystal Structure Of Human Methyltransferase Ad-003 In Complex With S-adenosyl-l-homocysteine Length = 241

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		223
1xtp_A		254	LMAJ004091AAA; SGPP, structural genomics, PSI, pro	9e-40
2ex4_A		241	Adrenal gland protein AD-003; methyltransferase, s	3e-31

>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Length = 254	Back alignment and structure

 Score =  136 bits (343), Expect = 9e-40
 Identities = 58/162 (35%), Positives = 87/162 (53%), Gaps = 18/162 (11%)

Query: 61  PKHKESSAMEVSGLDSDGKEFKNAEEMWREQIGEDGEQQEKKTQWYREGISYWEGVEASV 120
            K   S  + +SG D++GK +++ +EMW+ ++   G+  + +  WY + + YW  V A+V
Sbjct: 7   SKEASSRNLPISGRDTNGKTYRSTDEMWKAEL--TGDLYDPEKGWYGKALEYWRTVPATV 64

Query: 121 DGVLGGFGNVNEVDIKGSEAFLQMLLSDRFPNARNNQHLVALDCGSGIGRITKNLLIRYF 180
            GVLGG  +V++VDI+GS  F+  L               ALDCG+GIGRITKNLL + +
Sbjct: 65  SGVLGGMDHVHDVDIEGSRNFIASLPGHGTSR--------ALDCGAGIGRITKNLLTKLY 116

Query: 181 NEVDLLEPVSHFLDAARESLAPENHMAPDMHKATNFFCVPLQ 222
              DLLEPV H L+ A+  LA              F    ++
Sbjct: 117 ATTDLLEPVKHMLEEAKRELAG--------MPVGKFILASME 150

PyMOL of 1xtp

>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Length = 241	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		223
1xtp_A		254	LMAJ004091AAA; SGPP, structural genomics, PSI, pro	99.81
2ex4_A		241	Adrenal gland protein AD-003; methyltransferase, s	99.35
3iv6_A		261	Putative Zn-dependent alcohol dehydrogenase; alpha	98.46
3mti_A		185	RRNA methylase; SAM-dependent, PSI, MCSG, structur	98.42
3orh_A		236	Guanidinoacetate N-methyltransferase; structura ge	98.36
3hnr_A		220	Probable methyltransferase BT9727_4108; structural	98.31
3ujc_A		266	Phosphoethanolamine N-methyltransferase; parasite;	98.27
3l8d_A		242	Methyltransferase; structural genomics, PSI, nysgr	98.25
2p7i_A		250	Hypothetical protein; putative methyltransferase,	98.24
2fpo_A		202	Methylase YHHF; structural genomics, putative meth	98.23
2ift_A		201	Putative methylase HI0767; NESG, Y767_haein, struc	98.23
1pjz_A		203	Thiopurine S-methyltransferase; polymorphism, S-ad	98.22
3m70_A		286	Tellurite resistance protein TEHB homolog; structu	98.21
3ggd_A		245	SAM-dependent methyltransferase; YP_325210.1, stru	98.2
3ofk_A		216	Nodulation protein S; NODS, N-methyltransferase, S	98.19
3h2b_A		203	SAM-dependent methyltransferase; alpha-beta protei	98.18
3hm2_A		178	Precorrin-6Y C5,15-methyltransferase; alpha-beta-s	98.18
3p9n_A		189	Possible methyltransferase (methylase); RV2966C, a	98.17
4hg2_A		257	Methyltransferase type 11; structural genomics, PS	98.15
1vl5_A		260	Unknown conserved protein BH2331; putative methylt	98.12
1dus_A		194	MJ0882; hypothetical protein, methanococcus jannas	98.11
2yxd_A		183	Probable cobalt-precorrin-6Y C(15)-methyltransfer	98.11
3e05_A		204	Precorrin-6Y C5,15-methyltransferase (decarboxyla;	98.1
4gek_A		261	TRNA (CMO5U34)-methyltransferase; structural genom	98.1
3dh0_A		219	SAM dependent methyltransferase; cystal structure,	98.1
1nkv_A		256	Hypothetical protein YJHP; structural genomics, PS	98.09
3bus_A		273	REBM, methyltransferase; rebeccamycin synthesis; H	98.08
3e23_A		211	Uncharacterized protein RPA2492; alpha-beta protei	98.07
3lbf_A		210	Protein-L-isoaspartate O-methyltransferase; modifi	98.07
3hem_A		302	Cyclopropane-fatty-acyl-phospholipid synthase 2; p	98.07
3i9f_A		170	Putative type 11 methyltransferase; structural gen	98.06
3jwg_A		219	HEN1, methyltransferase type 12; 1.90A {Clostridiu	98.06
3njr_A		204	Precorrin-6Y methylase; methyltransferase, decarbo	98.06
1xxl_A		239	YCGJ protein; structural genomics, protein structu	98.04
2cmg_A		262	Spermidine synthase; transferase, putrescine amino	98.03
2fhp_A		187	Methylase, putative; alpha-beta-alpha sandwich, st	98.03
3g5t_A		299	Trans-aconitate 3-methyltransferase; structural ge	98.02
2p35_A		259	Trans-aconitate 2-methyltransferase; SAM dependent	98.02
2i62_A		265	Nicotinamide N-methyltransferase; structural genom	98.02
3g2m_A		299	PCZA361.24; SAM-dependent methyltransferase, glyco	98.01
3dtn_A		234	Putative methyltransferase MM_2633; structural gen	98.01
2esr_A		177	Methyltransferase; structural genomics, hypothetic	98.01
2p8j_A		209	S-adenosylmethionine-dependent methyltransferase;	98.0
3grz_A		205	L11 mtase, ribosomal protein L11 methyltransferase	98.0
3ou2_A		218	SAM-dependent methyltransferase; O-methyltransfera	98.0
2pxx_A		215	Uncharacterized protein MGC2408; structural genomi	97.99
2a14_A		263	Indolethylamine N-methyltransferase; SGC,INMT, str	97.98
2kw5_A		202	SLR1183 protein; structural genomics, northeast st	97.98
3tqs_A		255	Ribosomal RNA small subunit methyltransferase A; p	97.97
3jwh_A		217	HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena	97.97
3g89_A		249	Ribosomal RNA small subunit methyltransferase G; 1	97.96
1wzn_A		252	SAM-dependent methyltransferase; structural genomi	97.96
3gdh_A		241	Trimethylguanosine synthase homolog; M7G, CAP, dim	97.96
1l3i_A		192	Precorrin-6Y methyltransferase/putative decarboxyl	97.96
1wy7_A		207	Hypothetical protein PH1948; seven-stranded beta s	97.95
3e8s_A		227	Putative SAM dependent methyltransferase; NP_74470	97.95
3f4k_A		257	Putative methyltransferase; structural genomics, P	97.95
1zx0_A		236	Guanidinoacetate N-methyltransferase; structural g	97.95
3sm3_A		235	SAM-dependent methyltransferases; NESG, structural	97.94
2o57_A		297	Putative sarcosine dimethylglycine methyltransfera	97.94
1ws6_A		171	Methyltransferase; structural genomics, riken stru	97.94
3m33_A		226	Uncharacterized protein; structural genomics, PSI-	97.93
1kpg_A		287	CFA synthase;, cyclopropane-fatty-acyl-phospholipi	97.93
2xvm_A		199	Tellurite resistance protein TEHB; antibiotic resi	97.92
3g5l_A		253	Putative S-adenosylmethionine dependent methyltran	97.92
1qam_A		244	ERMC' methyltransferase; rRNA methyltransferase ER	97.91
1zq9_A		285	Probable dimethyladenosine transferase; SGC, struc	97.91
1xdz_A		240	Methyltransferase GIDB; MCSG, protein structure in	97.91
2fk8_A		318	Methoxy mycolic acid synthase 4; S-adenosylmethion	97.91
1jsx_A		207	Glucose-inhibited division protein B; methyltransf	97.9
3bkw_A		243	MLL3908 protein, S-adenosylmethionine dependent me	97.9
2frn_A		278	Hypothetical protein PH0793; structural genomics,	97.89
2yxe_A		215	Protein-L-isoaspartate O-methyltransferase; rossma	97.89
2aot_A		292	HMT, histamine N-methyltransferase; classic methyl	97.89
3ccf_A		279	Cyclopropane-fatty-acyl-phospholipid synthase; YP_	97.89
3kkz_A		267	Uncharacterized protein Q5LES9; putative methyltra	97.88
3cgg_A		195	SAM-dependent methyltransferase; NP_600671.1, meth	97.88
3mgg_A		276	Methyltransferase; NYSGXRC, PSI-II, protein struct	97.88
3bxo_A		239	N,N-dimethyltransferase; desosamine, sugar, carboh	97.87
4htf_A		285	S-adenosylmethionine-dependent methyltransferase;	97.87
2gb4_A		252	Thiopurine S-methyltransferase; 18204406, thiopuri	97.87
3a27_A		272	TYW2, uncharacterized protein MJ1557; wybutosine m	97.87
1vbf_A		231	231AA long hypothetical protein-L-isoaspartate O-	97.87
1ri5_A		298	MRNA capping enzyme; methyltransferase, M7G, messe	97.86
3eey_A		197	Putative rRNA methylase; rRNA methylation, S-adeno	97.86
2g72_A		289	Phenylethanolamine N-methyltransferase; HET: SAM F	97.85
1fbn_A		230	MJ fibrillarin homologue; MJ proteins, ribosomal R	97.85
3bt7_A		369	TRNA (uracil-5-)-methyltransferase; methyluridine,	97.84
2h1r_A		299	Dimethyladenosine transferase, putative; SGC toron	97.84
3d2l_A		243	SAM-dependent methyltransferase; ZP_00538691.1, st	97.84
2hnk_A		239	SAM-dependent O-methyltransferase; modified rossma	97.84
1ve3_A		227	Hypothetical protein PH0226; dimer, riken structur	97.83
1xj5_A		334	Spermidine synthase 1; structural genomics, protei	97.83
3mq2_A		218	16S rRNA methyltransferase; methyltranferase, ribo	97.83
3dlc_A		219	Putative S-adenosyl-L-methionine-dependent methylt	97.83
3thr_A		293	Glycine N-methyltransferase; GNMT, folate, methylt	97.83
1ne2_A		200	Hypothetical protein TA1320; structural genomics,	97.82
2yqz_A		263	Hypothetical protein TTHA0223; RNA methyltransfera	97.82
1jg1_A		235	PIMT;, protein-L-isoaspartate O-methyltransferase;	97.81
3tr6_A		225	O-methyltransferase; cellular processes; HET: SAH;	97.81
1y8c_A		246	S-adenosylmethionine-dependent methyltransferase;	97.81
3dxy_A		218	TRNA (guanine-N(7)-)-methyltransferase; rossmann f	97.81
3pfg_A		263	N-methyltransferase; N,N-dimethyltransferase, SAM	97.81
2gs9_A		211	Hypothetical protein TT1324; methyl transferase, s	97.81
2fca_A		213	TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac	97.8
2o07_A		304	Spermidine synthase; structural genomics, structur	97.79
1iy9_A		275	Spermidine synthase; rossmann fold, structural gen	97.79
3opn_A		232	Putative hemolysin; structural genomics, PSI-2, pr	97.78
3lcc_A		235	Putative methyl chloride transferase; halide methy	97.77
3duw_A		223	OMT, O-methyltransferase, putative; alternating of	97.77
3uzu_A		279	Ribosomal RNA small subunit methyltransferase A; s	97.76
3evz_A		230	Methyltransferase; NYSGXRC, NEW YORK SGX research	97.76
3vc1_A		312	Geranyl diphosphate 2-C-methyltransferase; rossman	97.76
1nt2_A		210	Fibrillarin-like PRE-rRNA processing protein; adeM	97.75
3bwc_A		304	Spermidine synthase; SAM, SGPP, structura genomics	97.75
3fut_A		271	Dimethyladenosine transferase; methyltransferase,	97.75
3mb5_A		255	SAM-dependent methyltransferase; RNA methyltransfe	97.74
1yzh_A		214	TRNA (guanine-N(7)-)-methyltransferase; alpha-beta	97.74
2vdw_A		302	Vaccinia virus capping enzyme D1 subunit; nucleoti	97.74
2vdv_E		246	TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl	97.73
3dr5_A		221	Putative O-methyltransferase; Q8NRD3, CGL1119, PF0	97.73
3ntv_A		232	MW1564 protein; rossmann fold, putative methyltran	97.73
3c3p_A		210	Methyltransferase; NP_951602.1, structural genomic	97.73
2i7c_A		283	Spermidine synthase; transferase, structural genom	97.73
1qyr_A		252	KSGA, high level kasugamycin resistance protein, S	97.72
1g8a_A		227	Fibrillarin-like PRE-rRNA processing protein; rRNA	97.71
2pjd_A		343	Ribosomal RNA small subunit methyltransferase C; g	97.7
3tfw_A		248	Putative O-methyltransferase; PSI-biology, nysgrc,	97.7
3ege_A		261	Putative methyltransferase from antibiotic biosyn	97.7
3bgv_A		313	MRNA CAP guanine-N7 methyltransferase; alternative	97.69
2avn_A		260	Ubiquinone/menaquinone biosynthesis methyltransfe	97.69
1uwv_A		433	23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m	97.69
2b2c_A		314	Spermidine synthase; beta-alpha, transferase; 2.50	97.68
2avd_A		229	Catechol-O-methyltransferase; structural genomics,	97.68
4dzr_A		215	Protein-(glutamine-N5) methyltransferase, release	97.66
2gpy_A		233	O-methyltransferase; structural genomics, PSI, pro	97.66
2yvl_A		248	TRMI protein, hypothetical protein; tRNA, methyltr	97.65
3u81_A		221	Catechol O-methyltransferase; neurotransmitter deg	97.65
2pbf_A		227	Protein-L-isoaspartate O-methyltransferase beta-A	97.64
3ftd_A		249	Dimethyladenosine transferase; KSGA, rossmann-like	97.64
3adn_A		294	Spermidine synthase; aminopropyltransferase, polya	97.64
4dcm_A		375	Ribosomal RNA large subunit methyltransferase G; 2	97.64
3g07_A		292	7SK snRNA methylphosphate capping enzyme; structur	97.64
3p2e_A		225	16S rRNA methylase; methyltransferase, transferase	97.64
2pwy_A		258	TRNA (adenine-N(1)-)-methyltransferase; mtase, ado	97.63
1i1n_A		226	Protein-L-isoaspartate O-methyltransferase; S-aden	97.62
3gru_A		295	Dimethyladenosine transferase; rossman fold, ribos	97.62
1mjf_A		281	Spermidine synthase; spermidine synthetase, struct	97.61
1m6y_A		301	S-adenosyl-methyltransferase MRAW; SAM-dependent m	97.61
2h00_A		254	Methyltransferase 10 domain containing protein; st	97.61
2b78_A		385	Hypothetical protein SMU.776; structure genomics,	97.6
3bkx_A		275	SAM-dependent methyltransferase; YP_807781.1, cycl	97.59
1dl5_A		317	Protein-L-isoaspartate O-methyltransferase; isoasp	97.59
3lpm_A		259	Putative methyltransferase; structural genomics, p	97.58
3cc8_A		230	Putative methyltransferase; structural genomics, j	97.57
1i9g_A		280	Hypothetical protein RV2118C; mtase, adoMet, cryst	97.57
1uir_A		314	Polyamine aminopropyltransferase; spermidien synth	97.56
2pt6_A		321	Spermidine synthase; transferase, structural genom	97.56
1yb2_A		275	Hypothetical protein TA0852; structural genomics,	97.55
3dli_A		240	Methyltransferase; PSI-II, NYSGXRC, structural gen	97.55
1inl_A		296	Spermidine synthase; beta-barrel, rossman fold, st	97.54
2b3t_A		276	Protein methyltransferase HEMK; translation termin	97.54
1yub_A		245	Ermam, rRNA methyltransferase; MLS antibiotics; NM	97.54
3gu3_A		284	Methyltransferase; alpha-beta protein, structural	97.52
3r0q_C		376	Probable protein arginine N-methyltransferase 4.2;	97.51
3q87_B		170	N6 adenine specific DNA methylase; SAM-methyltrans	97.51
3c0k_A		396	UPF0064 protein YCCW; PUA domain, adoMet dependent	97.5
3bzb_A		281	Uncharacterized protein; RED ALGA, protein structu	97.5
2igt_A		332	SAM dependent methyltransferase; alpha-beta sandwi	97.5
3ocj_A		305	Putative exported protein; structural genomics, PS	97.5
3cbg_A		232	O-methyltransferase; cyanobacterium; HET: SAH FER	97.49
4azs_A		569	Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15	97.48
4e2x_A		416	TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s	97.47
4df3_A		233	Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase;	97.47
2ipx_A		233	RRNA 2'-O-methyltransferase fibrillarin; FBL, stru	97.47
3c3y_A		237	Pfomt, O-methyltransferase; plant secondary metabo	97.46
3ckk_A		235	TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-	97.46
2r6z_A		258	UPF0341 protein in RSP 3' region; alpha-beta prote	97.46
2nxc_A		254	L11 mtase, ribosomal protein L11 methyltransferase	97.46
3ajd_A		274	Putative methyltransferase MJ0026; tRNA, M5C, ross	97.46
1wxx_A		382	TT1595, hypothetical protein TTHA1280; thermus the	97.45
1ixk_A		315	Methyltransferase; open beta sheet; 1.90A {Pyrococ	97.44
1p91_A		269	Ribosomal RNA large subunit methyltransferase A; R	97.44
2jjq_A		425	Uncharacterized RNA methyltransferase pyrab10780;	97.43
2y1w_A		348	Histone-arginine methyltransferase CARM1; histone	97.43
2b25_A		336	Hypothetical protein; structural genomics, methyl	97.43
1o54_A		277	SAM-dependent O-methyltransferase; TM0748, structu	97.43
2fyt_A		340	Protein arginine N-methyltransferase 3; structural	97.43
3q7e_A		349	Protein arginine N-methyltransferase 1; HET: SAH;	97.41
1r18_A		227	Protein-L-isoaspartate(D-aspartate)-O-methyltrans;	97.4
2as0_A		396	Hypothetical protein PH1915; RNA methyltransferase	97.39
2ozv_A		260	Hypothetical protein ATU0636; structural genomics,	97.38
1nv8_A		284	HEMK protein; class I adoMet-dependent methyltrans	97.38
3fpf_A		298	Mtnas, putative uncharacterized protein; thermonic	97.37
1sui_A		247	Caffeoyl-COA O-methyltransferase; rossmann fold, p	97.37
3kr9_A		225	SAM-dependent methyltransferase; class I rossmann-	97.37
3dmg_A		381	Probable ribosomal RNA small subunit methyltransf;	97.35
3r3h_A		242	O-methyltransferase, SAM-dependent; structural gen	97.35
2oxt_A		265	Nucleoside-2'-O-methyltransferase; flavivirus, vir	97.35
3fzg_A		200	16S rRNA methylase; methyltransferase, plasmid, tr	97.31
3k6r_A		278	Putative transferase PH0793; structural genomics,	97.31
3hp7_A		291	Hemolysin, putative; structural genomics, APC64019	97.31
3gnl_A		244	Uncharacterized protein, DUF633, LMOF2365_1472; st	97.31
3ll7_A		410	Putative methyltransferase; methytransferase, stru	97.3
1o9g_A		250	RRNA methyltransferase; antibiotic resistance, Se-	97.29
4dmg_A		393	Putative uncharacterized protein TTHA1493; rRNA, m	97.29
4fsd_A		383	Arsenic methyltransferase; rossmann fold; 1.75A {C	97.27
3lec_A		230	NADB-rossmann superfamily protein; PSI, MCSG, stru	97.27
3v97_A		703	Ribosomal RNA large subunit methyltransferase L; Y	97.25
2yx1_A		336	Hypothetical protein MJ0883; methyl transferase, t	97.22
1g6q_1		328	HnRNP arginine N-methyltransferase; SAM-binding do	97.18
2oyr_A		258	UPF0341 protein YHIQ; alpha-beta protein, structur	97.16
1u2z_A		433	Histone-lysine N-methyltransferase, H3 lysine-79 s	97.14
3id6_C		232	Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase;	97.13
3htx_A		950	HEN1; HEN1, small RNA methyltransferase, protein-R	97.13
2wa2_A		276	Non-structural protein 5; transferase, S-adenosyl-	97.06
2yxl_A		450	PH0851 protein, 450AA long hypothetical FMU protei	97.02
2frx_A		479	Hypothetical protein YEBU; rossmann-type S-adenosy	97.01
3tma_A		354	Methyltransferase; thump domain; 2.05A {Thermus th	97.0
3b3j_A		480	Histone-arginine methyltransferase CARM1; protein	96.99
3gjy_A		317	Spermidine synthase; APC62791, structural genomics	96.95
1x19_A		359	CRTF-related protein; methyltransferase, bacterioc	96.95
2qe6_A		274	Uncharacterized protein TFU_2867; putative methylt	96.92
2qm3_A		373	Predicted methyltransferase; putative methyltransf	96.9
1vlm_A		219	SAM-dependent methyltransferase; possible histamin	96.9
3m4x_A		456	NOL1/NOP2/SUN family protein; mtase domain, PUA do	96.89
3tm4_A		373	TRNA (guanine N2-)-methyltransferase TRM14; rossma	96.88
2qfm_A		364	Spermine synthase; spermidine aminopropyltransfera	96.87
2p41_A		305	Type II methyltransferase; vizier, viral enzymes i	96.8
3uwp_A		438	Histone-lysine N-methyltransferase, H3 lysine-79;	96.79
2nyu_A		196	Putative ribosomal RNA methyltransferase 2; SAM, s	96.79
2b9e_A		309	NOL1/NOP2/SUN domain family, member 5 isoform 2; m	96.77
2plw_A		201	Ribosomal RNA methyltransferase, putative; malaria	96.73
4hc4_A		376	Protein arginine N-methyltransferase 6; HRMT1L6, S	96.7
2r3s_A		335	Uncharacterized protein; methyltransferase domain,	96.66
2bm8_A		236	Cephalosporin hydroxylase CMCI; cephamycin biosynt	96.66
1qzz_A		374	RDMB, aclacinomycin-10-hydroxylase; anthracycline,	96.66
3dp7_A		363	SAM-dependent methyltransferase; structural genomi	96.61
3m6w_A		464	RRNA methylase; rRNA methyltransferase, 5-methylcy	96.6
1ej0_A		180	FTSJ; methyltransferase, adoMet, adenosyl methioni	96.53
1tw3_A		360	COMT, carminomycin 4-O-methyltransferase; anthracy	96.49
3i53_A		332	O-methyltransferase; CO-complex, rossmann-like fol	96.41
3mcz_A		352	O-methyltransferase; adomet_mtases, S-adenosylmeth	96.24
3gwz_A		369	MMCR; methyltransferase, mitomycin, S-adenosyl met	96.17
1sqg_A		429	SUN protein, FMU protein; rossmann-fold, mixed bet	96.17
1af7_A		274	Chemotaxis receptor methyltransferase CHER; chemot	96.07
2ip2_A		334	Probable phenazine-specific methyltransferase; pyo	96.06
3dou_A		191	Ribosomal RNA large subunit methyltransferase J; c	96.03
3axs_A		392	Probable N(2),N(2)-dimethylguanosine tRNA methylt	96.03
1i4w_A		353	Mitochondrial replication protein MTF1; mitochondr	95.98
2py6_A		409	Methyltransferase FKBM; YP_546752.1, structural ge	95.97
2zig_A		297	TTHA0409, putative modification methylase; methylt	95.96
2zfu_A		215	Nucleomethylin, cerebral protein 1; nucleolar prot	95.84
2dul_A		378	N(2),N(2)-dimethylguanosine tRNA methyltransferas;	95.83
1fp2_A		352	Isoflavone O-methyltransferase; protein-product co	95.79
3frh_A		253	16S rRNA methylase; methyltransferase domain, heli	95.69
2f8l_A		344	Hypothetical protein LMO1582; structural genomics,	95.34
3lcv_B		281	Sisomicin-gentamicin resistance methylase SGM; ant	95.21
3giw_A		277	Protein of unknown function DUF574; rossmann-fold	95.19
1fp1_D		372	Isoliquiritigenin 2'-O-methyltransferase; protein-	95.02
1wg8_A		285	Predicted S-adenosylmethionine-dependent methyltra	94.87
3lkz_A		321	Non-structural protein 5; flavivirus, methyltransf	94.8
3o4f_A		294	Spermidine synthase; aminopropyltransferase, polya	94.79
1zg3_A		358	Isoflavanone 4'-O-methyltransferase; rossman fold,	94.69
3p9c_A		364	Caffeic acid O-methyltransferase; S-adenosylmethio	94.69
3reo_A		368	(ISO)eugenol O-methyltransferase; directed evoluti	94.68
3k0b_A		393	Predicted N6-adenine-specific DNA methylase; methy	94.4
4a6d_A		353	Hydroxyindole O-methyltransferase; melatonin, circ	94.26
3ldu_A		385	Putative methylase; structural genomics, PSI-2, pr	94.05
3c6k_A		381	Spermine synthase; spermidine aminopropyltransfera	93.68
2ih2_A		421	Modification methylase TAQI; DNA, DNA methyltransf	93.61
3lst_A		348	CALO1 methyltransferase; calicheamicin, enediyne,	93.42
3evf_A		277	RNA-directed RNA polymerase NS5; NS5 methyltransfe	93.36
3ldg_A		384	Putative uncharacterized protein SMU.472; YPSC, me	93.19
3gcz_A		282	Polyprotein; flavivirus, RNA capping, methyltransf	92.42
3eld_A		300	Methyltransferase; flavivirus, RNA capping, guanyl	92.37
2k4m_A		153	TR8_protein, UPF0146 protein MTH_1000; alpha+beta,	92.32
1g60_A		260	Adenine-specific methyltransferase MBOIIA; structu	91.47
3cvo_A		202	Methyltransferase-like protein of unknown functio;	91.36
3p8z_A		267	Mtase, non-structural protein 5; methyltransferase	91.27
2okc_A		445	Type I restriction enzyme stysji M protein; NP_813	90.11
2px2_A		269	Genome polyprotein [contains: capsid protein C (co	88.92
3sso_A		419	Methyltransferase; macrolide, natural product, ros	87.47
2ld4_A		176	Anamorsin; methyltransferase-like fold, alpha/beta	85.16
1zkd_A		387	DUF185; NESG, RPR58, structural genomics, PSI, pro	84.49
4auk_A		375	Ribosomal RNA large subunit methyltransferase M; Y	83.56
1g55_A		343	DNA cytosine methyltransferase DNMT2; human DNA me	83.18
3v97_A		703	Ribosomal RNA large subunit methyltransferase L; Y	82.62
2c7p_A		327	Modification methylase HHAI; DNA methyltransferase	81.15

>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42	Back alignment and structure

Probab=99.81  E-value=3.3e-20  Score=152.58  Aligned_cols=129  Identities=43%  Similarity=0.845  Sum_probs=109.4

Q ss_pred             CCcccccccccCCCCCcccCHHHHHHHHhccCCchhhhhhhhhhhhhhcccCCccchhccccCCCcccccchhhHHHHHH
Q 027421           64 KESSAMEVSGLDSDGKEFKNAEEMWREQIGEDGEQQEKKTQWYREGISYWEGVEASVDGVLGGFGNVNEVDIKGSEAFLQ  143 (223)
Q Consensus        64 ~~~~~~~~~G~Ds~g~~y~sw~EmWk~e~~~d~~~~~~k~~~Y~~a~~YWe~veaTvdGMLGGf~~vs~~Di~~Sr~FL~  143 (223)
                      ..|.+|+++|.|++|+.|++|+++|++++.....  .....||..+.+||+....+.++|++++..++..+....+.|+.
T Consensus        10 ~~~~~~~~~g~d~~~~~~~~~~~~w~~~~~~~~~--~~~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~   87 (254)
T 1xtp_A           10 ASSRNLPISGRDTNGKTYRSTDEMWKAELTGDLY--DPEKGWYGKALEYWRTVPATVSGVLGGMDHVHDVDIEGSRNFIA   87 (254)
T ss_dssp             ---CCCCCCEEETTSCEESCHHHHHHHHSCSCTT--CTTTCHHHHHHHHHHTSCSSHHHHTTTCGGGHHHHHHHHHHHHH
T ss_pred             CCcccccccccCCCCcccccHHHHHHHHHhcccc--ccchhhhhhhhhHHhcCCccccceecCcCccCHHHHHHHHHHHH
Confidence            3477899999999999999999999999876322  22335999999999999999999999999999999888888988


Q ss_pred             HHhcCCCCCcCCCcceeeeccCCCcccccHHHHhhcCCeeEEecCcHHHHHHHHHhhCc
Q 027421          144 MLLSDRFPNARNNQHLVALDCGSGIGRITKNLLIRYFNEVDLLEPVSHFLDAARESLAP  202 (223)
Q Consensus       144 ~L~~~~~~~~~~~~~~rALDcGAGIGRVTk~LLl~~f~~VDlVEP~e~Fle~Ake~l~~  202 (223)
                      .+..        .+..++||+|||.|+++..|+...+.+|+.||+++.|++.|++++..
T Consensus        88 ~l~~--------~~~~~vLDiG~G~G~~~~~l~~~~~~~v~~vD~s~~~~~~a~~~~~~  138 (254)
T 1xtp_A           88 SLPG--------HGTSRALDCGAGIGRITKNLLTKLYATTDLLEPVKHMLEEAKRELAG  138 (254)
T ss_dssp             TSTT--------CCCSEEEEETCTTTHHHHHTHHHHCSEEEEEESCHHHHHHHHHHTTT
T ss_pred             hhcc--------cCCCEEEEECCCcCHHHHHHHHhhcCEEEEEeCCHHHHHHHHHHhcc
Confidence            7743        23468999999999999997777688899999999999999998743

PyMOL of 1xtp

>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42	Back alignment and structure

>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides}	Back alignment and structure

>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A*	Back alignment and structure

>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A*	Back alignment and structure

>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian}	Back alignment and structure

>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A*	Back alignment and structure

>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis}	Back alignment and structure

>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A	Back alignment and structure

>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46	Back alignment and structure

>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46	Back alignment and structure

>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36	Back alignment and structure

>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae}	Back alignment and structure

>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413}	Back alignment and structure

>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A*	Back alignment and structure

>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032}	Back alignment and structure

>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae}	Back alignment and structure

>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis}	Back alignment and structure

>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans}	Back alignment and structure

>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41	Back alignment and structure

>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4	Back alignment and structure

>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii}	Back alignment and structure

>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0	Back alignment and structure

>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A*	Back alignment and structure

>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus}	Back alignment and structure

>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21	Back alignment and structure

>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes}	Back alignment and structure

>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris}	Back alignment and structure

>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli}	Back alignment and structure

>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A*	Back alignment and structure

>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus}	Back alignment and structure

>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A	Back alignment and structure

>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus}	Back alignment and structure

>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A*	Back alignment and structure

>2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A	Back alignment and structure

>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46	Back alignment and structure

>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae}	Back alignment and structure

>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str}	Back alignment and structure

>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A*	Back alignment and structure

>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A*	Back alignment and structure

>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei}	Back alignment and structure

>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46	Back alignment and structure

>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum}	Back alignment and structure

>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp}	Back alignment and structure

>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A*	Back alignment and structure

>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens}	Back alignment and structure

>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15	Back alignment and structure

>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A	Back alignment and structure

>3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0	Back alignment and structure

>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A	Back alignment and structure

>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A*	Back alignment and structure

>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43	Back alignment and structure

>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A*	Back alignment and structure

>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A*	Back alignment and structure

>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32	Back alignment and structure

>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440}	Back alignment and structure

>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A*	Back alignment and structure

>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A*	Back alignment and structure

>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei}	Back alignment and structure

>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18	Back alignment and structure

>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46	Back alignment and structure

>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans}	Back alignment and structure

>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A*	Back alignment and structure

>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A*	Back alignment and structure

>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str}	Back alignment and structure

>1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A	Back alignment and structure

>1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24	Back alignment and structure

>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20	Back alignment and structure

>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A*	Back alignment and structure

>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20	Back alignment and structure

>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti}	Back alignment and structure

>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A*	Back alignment and structure

>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii}	Back alignment and structure

>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A*	Back alignment and structure

>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413}	Back alignment and structure

>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A*	Back alignment and structure

>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032}	Back alignment and structure

>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei}	Back alignment and structure

>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae}	Back alignment and structure

>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli}	Back alignment and structure

>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A*	Back alignment and structure

>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii}	Back alignment and structure

>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7	Back alignment and structure

>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A*	Back alignment and structure

>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405}	Back alignment and structure

>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ...	Back alignment and structure

>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A	Back alignment and structure

>3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli}	Back alignment and structure

>2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum}	Back alignment and structure

>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15}	Back alignment and structure

>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans}	Back alignment and structure

>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43	Back alignment and structure

>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A	Back alignment and structure

>3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP}	Back alignment and structure

>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis}	Back alignment and structure

>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A*	Back alignment and structure

>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32	Back alignment and structure

>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A	Back alignment and structure

>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A*	Back alignment and structure

>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0	Back alignment and structure

>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43	Back alignment and structure

>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A*	Back alignment and structure

>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A*	Back alignment and structure

>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus}	Back alignment and structure

>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53	Back alignment and structure

>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A*	Back alignment and structure

>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17	Back alignment and structure

>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp}	Back alignment and structure

>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana}	Back alignment and structure

>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A*	Back alignment and structure

>3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei}	Back alignment and structure

>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus}	Back alignment and structure

>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A*	Back alignment and structure

>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3	Back alignment and structure

>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A*	Back alignment and structure

>3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A*	Back alignment and structure

>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C*	Back alignment and structure

>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53	Back alignment and structure

>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus}	Back alignment and structure

>2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E	Back alignment and structure

>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum}	Back alignment and structure

>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus}	Back alignment and structure

>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca}	Back alignment and structure

>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A*	Back alignment and structure

>1qyr_A KSGA, high level kasugamycin resistance protein, S-adenosylMet; adenosine dimethyltransferase, rRNA modification, transferase, translation; 2.10A {Escherichia coli} SCOP: c.66.1.24 PDB: 4adv_V 3tpz_A	Back alignment and structure

>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A	Back alignment and structure

>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli}	Back alignment and structure

>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp}	Back alignment and structure

>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413}	Back alignment and structure

>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A*	Back alignment and structure

>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41	Back alignment and structure

>1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A*	Back alignment and structure

>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17	Back alignment and structure

>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1	Back alignment and structure

>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp}	Back alignment and structure

>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans}	Back alignment and structure

>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus}	Back alignment and structure

>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ...	Back alignment and structure

>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum}	Back alignment and structure

>3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, anti resistance, methyltransferase, RNA-binding; 1.44A {Aquifex aeolicus} PDB: 3ftc_A 3fte_A 3ftf_A* 3r9x_B*	Back alignment and structure

>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli}	Back alignment and structure

>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens}	Back alignment and structure

>3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A*	Back alignment and structure

>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus}	Back alignment and structure

>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A*	Back alignment and structure

>3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A*	Back alignment and structure

>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A*	Back alignment and structure

>1m6y_A S-adenosyl-methyltransferase MRAW; SAM-dependent methyltransferase fold, protein-cofactor product complex, structural genomics, PSI; HET: SAH; 1.90A {Thermotoga maritima} SCOP: a.60.13.1 c.66.1.23 PDB: 1n2x_A*	Back alignment and structure

>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54	Back alignment and structure

>2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A*	Back alignment and structure

>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei}	Back alignment and structure

>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1	Back alignment and structure

>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes}	Back alignment and structure

>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus}	Back alignment and structure

>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13	Back alignment and structure

>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A*	Back alignment and structure

>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A*	Back alignment and structure

>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13	Back alignment and structure

>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus}	Back alignment and structure

>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A*	Back alignment and structure

>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A*	Back alignment and structure

>1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24	Back alignment and structure

>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A	Back alignment and structure

>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana}	Back alignment and structure

>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi}	Back alignment and structure

>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12}	Back alignment and structure

>3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae}	Back alignment and structure

>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51	Back alignment and structure

>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis}	Back alignment and structure

>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP}	Back alignment and structure

>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A*	Back alignment and structure

>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A*	Back alignment and structure

>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix}	Back alignment and structure

>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens}	Back alignment and structure

>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum}	Back alignment and structure

>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens}	Back alignment and structure

>2r6z_A UPF0341 protein in RSP 3' region; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 1.80A {Neisseria gonorrhoeae}	Back alignment and structure

>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A*	Back alignment and structure

>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A	Back alignment and structure

>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A*	Back alignment and structure

>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38	Back alignment and structure

>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33	Back alignment and structure

>2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A*	Back alignment and structure

>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A	Back alignment and structure

>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13	Back alignment and structure

>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13	Back alignment and structure

>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A*	Back alignment and structure

>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A*	Back alignment and structure

>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7	Back alignment and structure

>2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51	Back alignment and structure

>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str}	Back alignment and structure

>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A*	Back alignment and structure

>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A*	Back alignment and structure

>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A*	Back alignment and structure

>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A*	Back alignment and structure

>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A*	Back alignment and structure

>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp}	Back alignment and structure

>2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus}	Back alignment and structure

>3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli}	Back alignment and structure

>3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A*	Back alignment and structure

>3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus}	Back alignment and structure

>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str}	Back alignment and structure

>3ll7_A Putative methyltransferase; methytransferase, structural genomics, MCSG, PSI-2, protein initiative; HET: MSE; 1.80A {Porphyromonas gingivalis}	Back alignment and structure

>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A	Back alignment and structure

>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus}	Back alignment and structure

>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A	Back alignment and structure

>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae}	Back alignment and structure

>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A*	Back alignment and structure

>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A*	Back alignment and structure

>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6	Back alignment and structure

>2oyr_A UPF0341 protein YHIQ; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Shigella flexneri 2A} SCOP: c.66.1.55 PDB: 2pgx_A 2pkw_A	Back alignment and structure

>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31	Back alignment and structure

>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E*	Back alignment and structure

>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana}	Back alignment and structure

>2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A*	Back alignment and structure

>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii}	Back alignment and structure

>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli}	Back alignment and structure

>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus}	Back alignment and structure

>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus}	Back alignment and structure

>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032}	Back alignment and structure

>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A*	Back alignment and structure

>2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca}	Back alignment and structure

>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638}	Back alignment and structure

>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41	Back alignment and structure

>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium}	Back alignment and structure

>3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A*	Back alignment and structure

>2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A*	Back alignment and structure

>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A*	Back alignment and structure

>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens}	Back alignment and structure

>2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38	Back alignment and structure

>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum}	Back alignment and structure

>4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens}	Back alignment and structure

>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme}	Back alignment and structure

>2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A*	Back alignment and structure

>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A*	Back alignment and structure

>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus}	Back alignment and structure

>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A*	Back alignment and structure

>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A*	Back alignment and structure

>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A*	Back alignment and structure

>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A*	Back alignment and structure

>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis}	Back alignment and structure

>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A*	Back alignment and structure

>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A	Back alignment and structure

>1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A*	Back alignment and structure

>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa}	Back alignment and structure

>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0	Back alignment and structure

>3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A*	Back alignment and structure

>1i4w_A Mitochondrial replication protein MTF1; mitochondrial transcription factor, transcription initiation; 2.60A {Saccharomyces cerevisiae} SCOP: c.66.1.24	Back alignment and structure

>2py6_A Methyltransferase FKBM; YP_546752.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.15A {Methylobacillus flagellatus KT} SCOP: c.66.1.56	Back alignment and structure

>2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A	Back alignment and structure

>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens}	Back alignment and structure

>2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A*	Back alignment and structure

>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A*	Back alignment and structure

>3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A*	Back alignment and structure

>2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45	Back alignment and structure

>3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A*	Back alignment and structure

>3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A*	Back alignment and structure

>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A*	Back alignment and structure

>1wg8_A Predicted S-adenosylmethionine-dependent methyltransferase; S-adenosyl-methyltransferase, MRAW; HET: SAM; 2.00A {Thermus thermophilus} SCOP: a.60.13.1 c.66.1.23	Back alignment and structure

>3lkz_A Non-structural protein 5; flavivirus, methyltransferase, inhibitor, P nucleotide-binding, RNA replication, viral protein; HET: SFG; 2.00A {West nile virus}	Back alignment and structure

>3o4f_A Spermidine synthase; aminopropyltransferase, polyamine synthase, rossmann fold, P biosynthesis, spermidine biosynthesis, transferase; 2.90A {Escherichia coli}	Back alignment and structure

>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A*	Back alignment and structure

>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A*	Back alignment and structure

>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A*	Back alignment and structure

>3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str}	Back alignment and structure

>4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A*	Back alignment and structure

>3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile}	Back alignment and structure

>3c6k_A Spermine synthase; spermidine aminopropyltransferase, SPMSY, structural genomics, structural genomics consortium, SGC, phosphoprotein; HET: SPD MTA; 1.95A {Homo sapiens} PDB: 3c6m_A*	Back alignment and structure

>2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A*	Back alignment and structure

>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora}	Back alignment and structure

>3evf_A RNA-directed RNA polymerase NS5; NS5 methyltransferase, RNA CAP binding, binding, capsid protein; HET: GTA SAH; 1.45A {Yellow fever virus} SCOP: c.66.1.0 PDB: 3evb_A* 3evc_A* 3evd_A* 3eve_A* 3eva_A*	Back alignment and structure

>3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans}	Back alignment and structure

>3gcz_A Polyprotein; flavivirus, RNA capping, methyltransferase, viral enzyme STR ATP-binding, nucleotide-binding, RNA replication, structura genomics; HET: SAM; 1.70A {Yokose virus}	Back alignment and structure

>3eld_A Methyltransferase; flavivirus, RNA capping, guanylyltransfer viral enzyme structure; HET: SFG; 1.90A {Wesselsbron virus} PDB: 3elu_A* 3elw_A* 3ely_A* 3emb_A* 3emd_A*	Back alignment and structure

>2k4m_A TR8_protein, UPF0146 protein MTH_1000; alpha+beta, rossman fold, structural genomics, PSI-2; NMR {Methanothermobacterthermautotrophicus str}	Back alignment and structure

>1g60_A Adenine-specific methyltransferase MBOIIA; structural genomics, DNA methylation, S- adenosylmethionine, PSI, protein structure initiative; HET: SAM; 1.74A {Moraxella bovis} SCOP: c.66.1.11	Back alignment and structure

>3cvo_A Methyltransferase-like protein of unknown functio; rossman fold, structural genomics, joint center for structur genomics, JCSG; HET: MSE PG4; 1.80A {Silicibacter pomeroyi dss-3}	Back alignment and structure

>3p8z_A Mtase, non-structural protein 5; methyltransferase, RNA, ER, transferase-transferase inhibito; HET: 36A SAH; 1.70A {Dengue virus 3} SCOP: c.66.1.25 PDB: 3p97_A* 2xbm_A* 3evg_A*	Back alignment and structure

>2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45	Back alignment and structure

>2px2_A Genome polyprotein [contains: capsid protein C (core protein); envelope protein M...; methyltransferase, SAH; HET: SAH; 2.00A {Murray valley encephalitis virus} PDB: 2px4_A* 2px5_A* 2pxa_A* 2pxc_A* 2px8_A* 2oy0_A*	Back alignment and structure

>3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A*	Back alignment and structure

>2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A	Back alignment and structure

>1zkd_A DUF185; NESG, RPR58, structural genomics, PSI, protein structure INI northeast structural genomics consortium, unknown function; 2.10A {Rhodopseudomonas palustris} SCOP: c.66.1.52	Back alignment and structure

>4auk_A Ribosomal RNA large subunit methyltransferase M; YGDE; HET: TLA PGE; 1.90A {Escherichia coli} PDB: 4atn_A* 4b17_A*	Back alignment and structure

>1g55_A DNA cytosine methyltransferase DNMT2; human DNA methyltransferase homologue; HET: DNA SAH; 1.80A {Homo sapiens} SCOP: c.66.1.26	Back alignment and structure

>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A*	Back alignment and structure

>2c7p_A Modification methylase HHAI; DNA methyltransferase, methyltransferase, base flipping, restriction system, transferase; HET: 5CM A1P SAH EPE CIT; 1.7A {Haemophilus haemolyticus} SCOP: c.66.1.26 PDB: 10mh_A* 1m0e_A* 1mht_A* 1hmy_A* 1skm_A* 2c7o_A* 2c7q_A* 2hmy_B* 2hr1_A* 3eeo_A* 3mht_A* 4mht_A* 5mht_A* 6mht_A* 7mht_A* 8mht_A* 9mht_A* 2zcj_A* 2z6u_A* 2z6q_A* ...	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		223
d1xtpa_		254	c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa	2e-33
d2ex4a1		222	c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (	1e-18

>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Length = 254	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: AD-003 protein-like
domain: Hypothetical protein Lmaj004091aaa (LmjF30.0810)
species: Leishmania major [TaxId: 5664]

 Score =  118 bits (297), Expect = 2e-33
 Identities = 54/133 (40%), Positives = 79/133 (59%), Gaps = 10/133 (7%)

Query: 62  KHKESSAMEVSGLDSDGKEFKNAEEMWREQIGEDGEQQEKKTQWYREGISYWEGVEASVD 121
           K   S  + +SG D++GK +++ +EMW+ ++  D    + +  WY + + YW  V A+V 
Sbjct: 8   KEASSRNLPISGRDTNGKTYRSTDEMWKAELTGDLY--DPEKGWYGKALEYWRTVPATVS 65

Query: 122 GVLGGFGNVNEVDIKGSEAFLQMLLSDRFPNARNNQHLVALDCGSGIGRITKNLLIRYFN 181
           GVLGG  +V++VDI+GS  F+  L               ALDCG+GIGRITKNLL + + 
Sbjct: 66  GVLGGMDHVHDVDIEGSRNFIASLPGHGTSR--------ALDCGAGIGRITKNLLTKLYA 117

Query: 182 EVDLLEPVSHFLD 194
             DLLEPV H L+
Sbjct: 118 TTDLLEPVKHMLE 130

PyMOL of d1xtpa_

>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Length = 222	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		223
d1xtpa_		254	Hypothetical protein Lmaj004091aaa (LmjF30.0810) {	100.0
d2ex4a1		222	Adrenal gland protein AD-003 (C9orf32) {Human (Hom	99.82
d1pjza_		201	Thiopurine S-methyltransferase {Pseudomonas syring	98.79
d1wzna1		251	Hypothetical methyltransferase PH1305 {Archaeon Py	98.73
d1xxla_		234	Hypothetical protein YcgJ {Bacillus subtilis [TaxI	98.54
d2i6ga1		198	Putative methyltransferase TehB {Salmonella typhim	98.54
d1vl5a_		231	Hypothetical protein BH2331 {Bacillus halodurans [	98.53
d1ve3a1		226	Hypothetical protein PH0226 {Archaeon Pyrococcus h	98.53
d1y8ca_		246	Putative methyltransferase CAC2371 {Clostridium ac	98.5
d2avna1		246	Hypothetical methyltransferase TM1389 {Thermotoga	98.48
d1zx0a1		229	Guanidinoacetate methyltransferase {Human (Homo sa	98.39
d1l3ia_		186	Precorrin-6Y methyltransferase (CbiT) {Archaeon Me	98.38
d1xvaa_		292	Glycine N-methyltransferase {Rat (Rattus norvegicu	98.36
d1im8a_		225	Hypothetical protein HI0319 (YecO) {Haemophilus in	98.36
d2nxca1		254	PrmA-like protein TTHA0656 (TT0836) {Thermus therm	98.35
d1dusa_		194	Hypothetical protein MJ0882 {Archaeon Methanococcu	98.32
d2o57a1		282	Putative sarcosine dimethylglycine methyltransfera	98.26
d1nkva_		245	Hypothetical Protein YjhP {Escherichia coli [TaxId	98.23
d2p7ia1		225	Hypothetical protein ECA1738 {Erwinia carotovora [	98.23
d2a14a1		257	Indolethylamine N-methyltransferase, INMT {Human (	98.22
d1ri5a_		252	mRNA cap (Guanine N-7) methyltransferase {Fungus (	98.21
d2g72a1		263	Phenylethanolamine N-methyltransferase, PNMTase {H	98.14
d2bzga1		229	Thiopurine S-methyltransferase {Human (Homo sapien	98.08
d1jqea_		280	Histamine methyltransferase {Human (Homo sapiens)	98.07
d2fk8a1		280	Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri	98.04
d1dl5a1		213	Protein-L-isoaspartyl O-methyltransferase {Thermot	97.88
d1nt2a_		209	Fibrillarin homologue {Archaeon Archaeoglobus fulg	97.86
d2esra1		152	Putative methyltransferase SPy1538 {Streptococcus	97.85
d2fpoa1		183	Methylase YhhF {Escherichia coli [TaxId: 562]}	97.82
d2gh1a1		281	Methyltransferase BC2162 {Bacillus cereus [TaxId:	97.8
d1qama_		235	rRNA adenine dimethylase {Bacillus subtilis, Ermc'	97.78
d1wy7a1		201	Hypothetical protein PH1948 {Archaeon Pyrococcus h	97.75
d1g8sa_		230	Fibrillarin homologue {Archaeon Methanococcus jann	97.74
d1vbfa_		224	Protein-L-isoaspartyl O-methyltransferase {Sulfolo	97.73
d1vlma_		208	Possible histamine N-methyltransferase TM1293 {The	97.72
d1o54a_		266	Hypothetical protein TM0748 {Thermotoga maritima [	97.71
d1g8aa_		227	Fibrillarin homologue {Archaeon Pyrococcus horikos	97.62
d1ne2a_		197	Hypothetical protein Ta1320 {Archaeon Thermoplasma	97.61
d1kpga_		285	CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]}	97.56
d1kpia_		291	CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]}	97.56
d1yb2a1		250	Hypothetical protein Ta0852 {Thermoplasma acidophi	97.48
d2frna1		260	Hypothetical protein PH0793 {Pyrococcus horikoshii	97.45
d1ws6a1		171	Methyltransferase TTHA0928 {Thermus thermophilus [	97.39
d1p91a_		268	rRNA methyltransferase RlmA {Escherichia coli [Tax	97.32
d1uwva2		358	rRNA (Uracil-5-)-methyltransferase RumA, catalytic	97.31
d2fyta1		311	Protein arginine N-methyltransferase 3, PRMT3 {Hum	97.31
d1jg1a_		215	Protein-L-isoaspartyl O-methyltransferase {Archaeo	97.31
d1wxxa2		318	Hypothetical protein TTHA1280, middle and C-termin	97.3
d1yuba_		245	rRNA adenine dimethylase {Streptococcus pneumoniae	97.29
d1i1na_		224	Protein-L-isoaspartyl O-methyltransferase {Human (	97.28
d2fhpa1		182	Putative methylase EF2452 {Enterococcus faecalis [	97.25
d1i9ga_		264	Probable methyltransferase Rv2118c {Mycobacterium	97.23
d1zq9a1		278	Probable dimethyladenosine transferase {Human (Hom	97.22
d1qyra_		252	High level kasugamycin resistance protein KsgA {Es	97.2
d2fcaa1		204	tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil	97.2
d2as0a2		324	Hypothetical protein PH1915, middle and C-terminal	97.18
d2b25a1		324	Hypothetical protein FLJ20628 {Human (Homo sapiens	97.17
d1u2za_		406	Catalytic, N-terminal domain of histone methyltran	97.16
d1oria_		316	Protein arginine N-methyltransferase 1, PRMT1 {Rat	97.06
d1g6q1_		328	Arginine methyltransferase, HMT1 {Baker's yeast (S	96.95
d1nw3a_		328	Catalytic, N-terminal domain of histone methyltran	96.95
d1m6ya2		192	TM0872, methyltransferase domain {Thermotoga marit	96.77
d2b3ta1		274	N5-glutamine methyltransferase, HemK {Escherichia	96.76
d2igta1		309	Putative methyltransferase Atu0340 {Agrobacterium	96.76
d1r18a_		223	Protein-L-isoaspartyl O-methyltransferase {Fruit f	96.76
d2ifta1		183	Putative methylase HI0767 {Haemophilus influenzae	96.71
d1yzha1		204	tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep	96.67
d1qzza2		256	Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu	96.62
d1i4wa_		322	Transcription factor sc-mtTFB {Baker's yeast (Sacc	96.52
d1mjfa_		276	Putative spermidine synthetase PF0127 (SpeE) {Arch	96.39
d1tw3a2		253	Carminomycin 4-O-methyltransferase {Streptomyces p	96.33
d1uira_		312	Spermidine synthase {Thermus thermophilus [TaxId:	96.1
d2h00a1		250	Methyltransferase 10 domain containing protein MET	95.94
d2b78a2		317	Hypothetical protein SMu776, middle and C-terminal	95.42
d1inla_		295	Spermidine synthase {Thermotoga maritima [TaxId: 2	94.99
d2cl5a1		214	Catechol O-methyltransferase, COMT {Rat (Rattus no	94.89
d1iy9a_		274	Spermidine synthase {Bacillus subtilis [TaxId: 142	94.89
d2avda1		219	COMT domain-containing protein 1, COMTD1 {Human (H	94.82
d2o07a1		285	Spermidine synthase {Human (Homo sapiens) [TaxId:	94.82
d1nv8a_		271	N5-glutamine methyltransferase, HemK {Thermotoga m	94.82
d2b2ca1		312	Spermidine synthase {Caenorhabditis elegans [TaxId	94.63
d1xj5a_		290	Spermidine synthase {Thale cress (Arabidopsis thal	93.74
d1jsxa_		207	Glucose-inhibited division protein B (GidB) {Esche	93.41
d2oyra1		250	Hypothetical protein YhiQ {Shigella flexneri [TaxI	92.8
d2py6a1		395	Methyltransferase FkbM {Methylobacillus flagellatu	92.65
d1susa1		227	Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag	89.51
d2p41a1		257	An RNA cap (nucleoside-2'-O-)-methyltransferase do	88.75
d2ih2a1		223	DNA methylase TaqI, N-terminal domain {Thermus aqu	85.48
d1zkda1		365	Hypothetical protein RPA4359 {Rhodopseudomonas pal	85.22
d1xdza_		239	Glucose-inhibited division protein B (GidB) {Bacil	84.15
d1wg8a2		182	TM0872, methyltransferase domain {Thermus thermoph	83.93
d2b9ea1		293	NOL1R {Human (Homo sapiens) [TaxId: 9606]}	81.73
d1kyza2		243	Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra	81.05

>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: AD-003 protein-like
domain: Hypothetical protein Lmaj004091aaa (LmjF30.0810)
species: Leishmania major [TaxId: 5664]

Probab=100.00  E-value=3.6e-36  Score=256.88  Aligned_cols=145  Identities=40%  Similarity=0.783  Sum_probs=126.4

Q ss_pred             CCCCCcccccccccCCCCCcccCHHHHHHHHhccCCchhhhhhhhhhhhhhcccCCccchhccccCCCcccccchhhHHH
Q 027421           61 PKHKESSAMEVSGLDSDGKEFKNAEEMWREQIGEDGEQQEKKTQWYREGISYWEGVEASVDGVLGGFGNVNEVDIKGSEA  140 (223)
Q Consensus        61 ~~~~~~~~~~~~G~Ds~g~~y~sw~EmWk~e~~~d~~~~~~k~~~Y~~a~~YWe~veaTvdGMLGGf~~vs~~Di~~Sr~  140 (223)
                      .+..++.++.++|.|++|++|+|.++||++++..+.+  ....+||.++.+||+++++|+|||||||+++|++|+..|+.
T Consensus         7 ~~~~~~~~~~~~g~d~~g~~~~~~~~~~~~~~~~~~~--~~~~~~Y~~~~~yW~~~~~t~~~mlgg~~~~~~~d~~~s~~   84 (254)
T d1xtpa_           7 SKEASSRNLPISGRDTNGKTYRSTDEMWKAELTGDLY--DPEKGWYGKALEYWRTVPATVSGVLGGMDHVHDVDIEGSRN   84 (254)
T ss_dssp             ------CCCCCCEEETTSCEESCHHHHHHHHSCSCTT--CTTTCHHHHHHHHHHTSCSSHHHHTTTCGGGHHHHHHHHHH
T ss_pred             ccccccccccccccCCCCCEeccHHHHHHHHhccccc--ccchhhhhchhhhhhcCchhcccccCCccccchhhHHHHHH
Confidence            3455677999999999999999999999999987655  45668999999999999999999999999999999999999


Q ss_pred             HHHHHhcCCCCCcCCCcceeeeccCCCcccccHHHHhhcCCeeEEecCcHHHHHHHHHhhCccCCCCCCCCCcceEEEcc
Q 027421          141 FLQMLLSDRFPNARNNQHLVALDCGSGIGRITKNLLIRYFNEVDLLEPVSHFLDAARESLAPENHMAPDMHKATNFFCVP  220 (223)
Q Consensus       141 FL~~L~~~~~~~~~~~~~~rALDcGAGIGRVTk~LLl~~f~~VDlVEP~e~Fle~Ake~l~~~~~~~~~~~kv~nf~cvg  220 (223)
                      ||+.+..        ....+|||||||+||+|++||.+.|.+|++|||++.|++.|++++..        .+..+|+|..
T Consensus        85 fl~~l~~--------~~~~~vLD~GcG~G~~t~~ll~~~~~~v~~vD~s~~~l~~a~~~~~~--------~~~~~~~~~d  148 (254)
T d1xtpa_          85 FIASLPG--------HGTSRALDCGAGIGRITKNLLTKLYATTDLLEPVKHMLEEAKRELAG--------MPVGKFILAS  148 (254)
T ss_dssp             HHHTSTT--------CCCSEEEEETCTTTHHHHHTHHHHCSEEEEEESCHHHHHHHHHHTTT--------SSEEEEEESC
T ss_pred             HHhhCCC--------CCCCeEEEecccCChhhHHHHhhcCceEEEEcCCHHHHHhhhccccc--------cccceeEEcc
Confidence            9998765        23468999999999999999999999999999999999999999855        5677899988


Q ss_pred             CCC
Q 027421          221 LQV  223 (223)
Q Consensus       221 LQ~  223 (223)
                      +|+
T Consensus       149 ~~~  151 (254)
T d1xtpa_         149 MET  151 (254)
T ss_dssp             GGG
T ss_pred             ccc
Confidence            763

PyMOL of d1xtpa_

>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]}	Back information, alignment and structure

>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]}	Back information, alignment and structure

>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]}	Back information, alignment and structure

>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]}	Back information, alignment and structure

>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]}	Back information, alignment and structure

>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]}	Back information, alignment and structure

>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]}	Back information, alignment and structure

>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]}	Back information, alignment and structure

>d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]}	Back information, alignment and structure

>d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]}	Back information, alignment and structure

>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]}	Back information, alignment and structure

>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1yuba_ c.66.1.24 (A:) rRNA adenine dimethylase {Streptococcus pneumoniae, Ermam [TaxId: 1313]}	Back information, alignment and structure

>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]}	Back information, alignment and structure

>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1zq9a1 c.66.1.24 (A:36-313) Probable dimethyladenosine transferase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1qyra_ c.66.1.24 (A:) High level kasugamycin resistance protein KsgA {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]}	Back information, alignment and structure

>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]}	Back information, alignment and structure

>d1i4wa_ c.66.1.24 (A:) Transcription factor sc-mtTFB {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]}	Back information, alignment and structure

>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]}	Back information, alignment and structure

>d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]}	Back information, alignment and structure

>d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1jsxa_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2oyra1 c.66.1.55 (A:1-250) Hypothetical protein YhiQ {Shigella flexneri [TaxId: 623]}	Back information, alignment and structure

>d2py6a1 c.66.1.56 (A:14-408) Methyltransferase FkbM {Methylobacillus flagellatus [TaxId: 405]}	Back information, alignment and structure

>d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]}	Back information, alignment and structure

>d2p41a1 c.66.1.25 (A:8-264) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Dengue virus 2 [TaxId: 11060]}	Back information, alignment and structure

>d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]}	Back information, alignment and structure

>d1zkda1 c.66.1.52 (A:2-366) Hypothetical protein RPA4359 {Rhodopseudomonas palustris [TaxId: 1076]}	Back information, alignment and structure

>d1xdza_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]}	Back information, alignment and structure