Citrus Sinensis ID: 027470


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220---
MGRGKIEIKRIENPTNRQVTYSKRRNGIFKKAQELTVLCDAKVSLIMFSNTGKFHEYISPTTTTKKMFDQYQKSLGVDLWSTHYAKMQESYRKLKEINNKLRKDIRQRMGEDLDDLTFEELRGLEQNMSSSAATVRERKFHVIKTQTDTYKKKVRNLEERHGNILLDFETKYDDPHYGLVDNGDYQSAMALANGASNLYAFRMQQQNLHQGTGGYGSSDLTLA
ccccccccHccccccccccccccccccHHHHHcHHHHcccccEEEEEECccccEEEcccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHccccccccccccccccccccccccccccccccc
MGRGKIEIKRIENPTNRQVTYSKRRNGIFKKAQELTVLCDAKVSLIMFSNTGKFHEYISPTTTTKKMFDQYQKSLGVDLWSTHYAKMQESYRKLKEINNKLRKDIRQRMGEDLDDLTFEELRGLEQNMSSSAATVRERKFHVIKTQTDTYKKKVRNLEERHGNILLDFETKYDDPHYGLVDNGDYQSAMALANGASNLYAFRMQ************S*DLTL*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGRGKIEIKRIENPTNRQVTYSKRRNGIFKKAQELTVLCDAKVSLIMFSNTGKFHEYISPTTTTKKMFDQYQKSLGVDLWSTHxxxxxxxxxxxxxxxxxxxxxIRQRMGEDLDDLTFEELRGLEQNMSSSAATVRERKFHVIKTQTDTYKKKVRNLEERHGNILLDFETKYDDPHYGLVDNGDYQSAMALANGASNLYAFRMQQQNLHQGTGGYGSSDLTLA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
MADS-box transcription factor 16 Probable transcription factor involved in the development of floral organs. Required for normal development of lodicules and stamens (whorls 2 and 3). May function as an heterodimer with MADS4.probableQ944S9
Floral homeotic protein APETALA 3 Probable transcription factor involved in the genetic control of flower development. Is required for normal development of petals and stamens in the wild-type flower. Forms an heterodimer with PISTILLATA that is required for autoregulation of both AP3 and PI genes. AP3/PI heterodimer interacts with APETALA1 or SEPALLATA3 to form a ternary complex that could be responsible for the regulation of the genes involved in the flower development. AP3/PI heterodimer activates the expression of NAP.probableP35632
MADS-box protein CMB2 probableQ42498

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1MNM, chain A
Confidence level:very confident
Coverage over the Query: 1-82
View the alignment between query and template
View the model in PyMOL
Template: 2JEE, chain A
Confidence level:probable
Coverage over the Query: 116-163
View the alignment between query and template
View the model in PyMOL