Citrus Sinensis ID: 027472

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220---
MASSSSSSNSPCAACKLLRRKCQPECVFAPYFPPDQPQKFANVHKVFGASNVTKLLNELQPSQREDAVNSLAYEAEMRLRDPVYGCVGVISFLQHRLRQLQMDLSCAKSELSKYQNLGHAGLIAAAHHHHHHQNMGMNLIGGAGGGGRDHHFHHHFFPRDHHPNNNHNHNQHHQMIRGFDGAAAANGNNYDATLLAAGIGQFTQFQQPRAAAGDDRRSSIDPS
ccccccccccccHHHHHHHcccccccccccccccccHHHHHHHHHHHccHHHHHHHHHcccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccHHccccccccccccccccccccccccccc
************AACKLLRRKCQPECVFAPYFPPDQPQKFANVHKVFGASNVTKLLNELQPSQREDAVNSLAYEAEMRLRDPVYGCVGVISFLQHRLRQLQMDLSCAKSELSK*************************************HFHHHFF******************IRGFDGAAAANGNNYDATLLAAGIGQFTQ*******************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASSSSSSNSPCAACKLLRRKCQPECVFAPYFPPDQPQKFANVHKVFGASNVTKLLNELQPSQREDAVNSLAYEAEMRLRDPVYGCVGVxxxxxxxxxxxxxxxxxxxxxxxxxxxxGHAGLIAAAHHHHHHQNMGMNLIGGAGGGGRDHHFHHHFFPRDHHPNNNHNHNQHHQMIRGFDGAAAANGNNYDATLLAAGIGQFTQFQQPRAAAGDDRRSSIDPS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
LOB domain-containing protein 6 Negative regulator of cell proliferation in the adaxial side of leaves. Regulates the formation of a symmetric lamina and the establishment of venation. Positively regulates LATERAL ORGAN BOUNDARIES (LOB) within the shoot apex, and the class III HD-ZIP genes REV, PHB, and PHV. Interacts directly with ASYMMETRIC LEAVES 1 (AS1) to repress the knox homeobox genes BP/KNAT1, KNAT2, and KNAT6 and the abaxial determinants ARF3/ETT, KAN2 and YAB5. May act in parallel with the RDR6-SGS3-AGO7 pathway, an endogenous RNA silencing pathway, to regulate the leaf morphogenesis.confidentO04479
LOB domain-containing protein 6 Negative regulator of cell proliferation in the adaxial side of leaves. Regulates the formation of a symmetric lamina and the establishment of venation.probableQ8LQH4

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted