Citrus Sinensis ID: 027498

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220--
MAEESVKLLGYWASPFALRVKWALKLKGVHYEYVEENLPNKSPLLLRYNPVYKKIPVLVHNGKPLAESLLIIEYIDEAWKQNPLLPDDPYERANARFWAKFFDEKCVPEVMGAFASKGEEQEKAAKARENLKMLERALEGKPFFGGDKIGFLDIAVGWIGIWGRIVEEIAGVSLIDAETMPLLTAWLNNFLEVPVIKACIPSWHELLEHNKGFHKILTGSST
cccccEEEEcccccHHHHHHHHHHHHccccccEEEcccccccHHHHHHccccccccEEEEccEEEcHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHcccc
**EESVKLLGYWASPFALRVKWALKLKGVHYEYVEENLPNKSPLLLRYNPVYKKIPVLVHNGKPLAESLLIIEYIDEAWKQNPLLPDDPYERANARFWAKFFDEKCVPEVMGAFASKGEEQEKAAKARENLKMLERALEGKPFFGGDKIGFLDIAVGWIGIWGRIVEEIAGVSLIDAETMPLLTAWLNNFLEVPVIKACIPSWHELLEHNKGFHKILTG***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAEESVKLLGYWASPFALRVKWALKLKGVHYEYVEENLPNKSPLLLRYNPVYKKIPVLVHNGKPLAESLLIIEYIDEAWKQNPLLPDDPYERANARFWAKFFDEKCVPEVMGAFASxxxxxxxxxxxxxxxxxxxxxLEGKPFFGGDKIGFLDIAVGWIGIWGRIVEEIAGVSLIDAETMPLLTAWLNNFLEVPVIKACIPSWHELLEHNKGFHKILTGSST

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Glutathione S-transferase omega-1 Exhibits glutathione-dependent thiol transferase and dehydroascorbate reductase activities. Has S-(phenacyl)glutathione reductase activity. Has also glutathione S-transferase activity. Participates in the biotransformation of inorganic arsenic and reduces monomethylarsonic acid (MMA) and dimethylarsonic acid.probableP78417
Glutathione S-transferase U7 May be involved in the conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles and have a detoxification role against certain herbicides.probableQ9ZW24
Glutathione transferase GST 23 Involved in multiple disease resistance (MDR).probableQ9FQA3

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.5.-.-Transferring alkyl or aryl groups, other than methyl groups.probable
2.5.1.-5,10-methenyltetrahydromethanopterin hydrogenase.probable
2.5.1.18Transferred entry: 2.5.1.18.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1GWC, chain A
Confidence level:very confident
Coverage over the Query: 4-209
View the alignment between query and template
View the model in PyMOL