Citrus Sinensis ID: 027498
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 222 | ||||||
| 350538459 | 225 | uncharacterized protein LOC543815 [Solan | 0.995 | 0.982 | 0.663 | 3e-80 | |
| 388498238 | 223 | unknown [Medicago truncatula] | 1.0 | 0.995 | 0.659 | 5e-80 | |
| 356510141 | 221 | PREDICTED: LOW QUALITY PROTEIN: glutathi | 0.977 | 0.981 | 0.651 | 9e-80 | |
| 359492474 | 219 | PREDICTED: LOW QUALITY PROTEIN: glutathi | 0.959 | 0.972 | 0.668 | 2e-78 | |
| 225456069 | 225 | PREDICTED: probable glutathione S-transf | 0.954 | 0.942 | 0.569 | 7e-65 | |
| 225456073 | 225 | PREDICTED: probable glutathione S-transf | 0.959 | 0.946 | 0.562 | 1e-64 | |
| 242044996 | 222 | hypothetical protein SORBIDRAFT_02g02708 | 0.990 | 0.990 | 0.549 | 5e-64 | |
| 162459493 | 222 | glutathione transferase GST 23 [Zea mays | 0.990 | 0.990 | 0.545 | 6e-64 | |
| 414885837 | 230 | TPA: hypothetical protein ZEAMMB73_51802 | 0.981 | 0.947 | 0.55 | 7e-64 | |
| 399106951 | 221 | glutathione transferase 23 [Triticum aes | 0.986 | 0.990 | 0.529 | 3e-63 |
| >gi|350538459|ref|NP_001234088.1| uncharacterized protein LOC543815 [Solanum lycopersicum] gi|10567808|gb|AAG16758.1| putative glutathione S-transferase T3 [Solanum lycopersicum] | Back alignment and taxonomy information |
|---|
Score = 303 bits (777), Expect = 3e-80, Method: Compositional matrix adjust.
Identities = 148/223 (66%), Positives = 174/223 (78%), Gaps = 2/223 (0%)
Query: 1 MAEESVKLLGYWASPFALRVKWALKLKGVHYEYVEENLPNKSPLLLRYNPVYKKIPVLVH 60
MA E VKLLGYWASPFAL+V WALKLKG+ YEY EE+L NKSPLLL+YNPV+KKIPVLVH
Sbjct: 1 MASEKVKLLGYWASPFALKVHWALKLKGIEYEYQEEDLSNKSPLLLQYNPVHKKIPVLVH 60
Query: 61 NGKPLAESLLIIEYIDEAWKQNPLLPDDPYERANARFWAKFFDEKCVPEVMGAFASKGEE 120
NGKP+AESL+I+EYI+E WK NPLLP+DPYERA ARFWAKF D+KCVP + G FA G E
Sbjct: 61 NGKPIAESLVILEYIEETWKHNPLLPEDPYERAKARFWAKFVDDKCVPGIFGTFAKVGVE 120
Query: 121 QEKAAK-ARENLKMLERALEGKPFFGGDKIGFLDIAVGWIGIWGRIVEEIAGVSLIDAET 179
Q+K AK ARENLK+LE L K FFG KIGF+D+ WI W +IVEE+ + LIDAE
Sbjct: 121 QQKIAKEARENLKILEDELGKKHFFGDAKIGFMDVTSAWIICWAQIVEEVVDIRLIDAEE 180
Query: 180 MPLLTAWLNNFLE-VPVIKACIPSWHELLEHNKGFHKILTGSS 221
MP L +W N LE P++K C P +LLEHNKGFH++L S+
Sbjct: 181 MPSLVSWFQNVLEAAPILKECTPPKDKLLEHNKGFHEMLVASA 223
|
Source: Solanum lycopersicum Species: Solanum lycopersicum Genus: Solanum Family: Solanaceae Order: Solanales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|388498238|gb|AFK37185.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356510141|ref|XP_003523798.1| PREDICTED: LOW QUALITY PROTEIN: glutathione transferase GST 23-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|359492474|ref|XP_003634419.1| PREDICTED: LOW QUALITY PROTEIN: glutathione transferase GST 23-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225456069|ref|XP_002280532.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225456073|ref|XP_002280676.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|242044996|ref|XP_002460369.1| hypothetical protein SORBIDRAFT_02g027080 [Sorghum bicolor] gi|241923746|gb|EER96890.1| hypothetical protein SORBIDRAFT_02g027080 [Sorghum bicolor] | Back alignment and taxonomy information |
|---|
| >gi|162459493|ref|NP_001104994.1| glutathione transferase GST 23 [Zea mays] gi|75334191|sp|Q9FQA3.1|GST23_MAIZE RecName: Full=Glutathione transferase GST 23; AltName: Full=Glutathione transferase GST 36 gi|11385523|gb|AAG34844.1|AF244701_1 glutathione S-transferase GST 36 [Zea mays] gi|194702784|gb|ACF85476.1| unknown [Zea mays] gi|195628152|gb|ACG35906.1| glutathione S-transferase [Zea mays] gi|414885838|tpg|DAA61852.1| TPA: glutathione S-transferase GST 23 [Zea mays] | Back alignment and taxonomy information |
|---|
| >gi|414885837|tpg|DAA61851.1| TPA: hypothetical protein ZEAMMB73_518022, partial [Zea mays] | Back alignment and taxonomy information |
|---|
| >gi|399106951|gb|AFP20277.1| glutathione transferase 23 [Triticum aestivum] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 222 | ||||||
| TAIR|locus:2043112 | 227 | GSTU7 "AT2G29420" [Arabidopsis | 0.927 | 0.907 | 0.507 | 4.9e-53 | |
| TAIR|locus:2083544 | 224 | GSTU8 "AT3G09270" [Arabidopsis | 0.923 | 0.915 | 0.514 | 3.5e-52 | |
| TAIR|locus:2043017 | 224 | GSTU4 "AT2G29460" [Arabidopsis | 0.941 | 0.933 | 0.511 | 1.9e-51 | |
| TAIR|locus:2042987 | 224 | GSTU1 "AT2G29490" [Arabidopsis | 0.909 | 0.901 | 0.523 | 3.1e-51 | |
| TAIR|locus:2042997 | 225 | GSTU2 "AT2G29480" [Arabidopsis | 0.936 | 0.924 | 0.504 | 7.4e-50 | |
| TAIR|locus:2043032 | 224 | GSTU5 "AT2G29450" [Arabidopsis | 0.936 | 0.928 | 0.509 | 8.5e-49 | |
| TAIR|locus:2043007 | 225 | GSTU3 "AT2G29470" [Arabidopsis | 0.927 | 0.915 | 0.488 | 4.7e-48 | |
| TAIR|locus:2012773 | 227 | ERD9 "AT1G10370" [Arabidopsis | 0.950 | 0.929 | 0.461 | 6.9e-47 | |
| TAIR|locus:2043057 | 223 | GSTU6 "AT2G29440" [Arabidopsis | 0.954 | 0.950 | 0.479 | 1.6e-45 | |
| TAIR|locus:2012758 | 227 | GSTU18 "AT1G10360" [Arabidopsi | 0.932 | 0.911 | 0.451 | 5.6e-45 |
| TAIR|locus:2043112 GSTU7 "AT2G29420" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 549 (198.3 bits), Expect = 4.9e-53, P = 4.9e-53
Identities = 105/207 (50%), Positives = 138/207 (66%)
Query: 4 ESVKLLGYWASPFALRVKWALKLKGVHYEYVEENLPNKSPLLLRYNPVYKKIPVLVHNGK 63
E VKLLG WASPF+ R++ AL LKGV YE++E+++ NKS LLL+ NPV+K IPVLVHNGK
Sbjct: 8 EEVKLLGMWASPFSRRIEIALTLKGVSYEFLEQDITNKSSLLLQLNPVHKMIPVLVHNGK 67
Query: 64 PLAESLLIIEYIDEAWKQNPLLPDDPYERANARFWAKFFDEKCVPEVMGAFASKGEEQEK 123
P++ESL+I+EYIDE W+ NP+LP DPYER ARFW+KF DE+ M G+E++
Sbjct: 68 PISESLVILEYIDETWRDNPILPQDPYERTMARFWSKFVDEQIYVTAMKVVGKTGKERDA 127
Query: 124 AAKARENLKM-LERALEGKPFFGGDKIGFLDIAVGWIGIWGRIVEEIAGVSLIDAETMPL 182
+A +L M LE+ L GK F GG +GF+DI + W EEI GV ++ E P
Sbjct: 128 VVEATRDLLMFLEKELVGKDFLGGKSLGFVDIVATLVAFWLMRTEEIVGVKVVPVEKFPE 187
Query: 183 LTAWLNNFLEVPVIKACIPSWHELLEH 209
+ W+ N L VIK CIP E L++
Sbjct: 188 IHRWVKNLLGNDVIKKCIPPEDEHLKY 214
|
|
| TAIR|locus:2083544 GSTU8 "AT3G09270" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2043017 GSTU4 "AT2G29460" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2042987 GSTU1 "AT2G29490" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2042997 GSTU2 "AT2G29480" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2043032 GSTU5 "AT2G29450" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2043007 GSTU3 "AT2G29470" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2012773 ERD9 "AT1G10370" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2043057 GSTU6 "AT2G29440" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2012758 GSTU18 "AT1G10360" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00017766001 | SubName- Full=Chromosome chr17 scaffold_16, whole genome shotgun sequence; (225 aa) | ||||||||||
(Vitis vinifera) | |||||||||||
| GSVIVG00032791001 | • | 0.899 | |||||||||
| GOR | • | 0.899 | |||||||||
| GSVIVG00023686001 | • | 0.899 | |||||||||
| GSVIVG00022884001 | • | 0.899 | |||||||||
| GSVIVG00020491001 | • | 0.899 | |||||||||
| GSVIVG00016630001 | • | 0.899 | |||||||||
| GSVIVG00001920001 | • | 0.899 | |||||||||
| GSVIVG00000410001 | • | 0.899 | |||||||||
| GSVIVG00000409001 | • | 0.899 | |||||||||
| DHAR | • | 0.409 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 222 | |||
| cd03185 | 127 | cd03185, GST_C_Tau, C-terminal, alpha helical doma | 4e-53 | |
| cd03058 | 74 | cd03058, GST_N_Tau, GST_N family, Class Tau subfam | 5e-44 | |
| COG0625 | 211 | COG0625, Gst, Glutathione S-transferase [Posttrans | 9e-29 | |
| TIGR01262 | 210 | TIGR01262, maiA, maleylacetoacetate isomerase | 5e-22 | |
| pfam13417 | 75 | pfam13417, GST_N_3, Glutathione S-transferase, N-t | 9e-22 | |
| cd00570 | 71 | cd00570, GST_N_family, Glutathione S-transferase ( | 2e-18 | |
| pfam13409 | 68 | pfam13409, GST_N_2, Glutathione S-transferase, N-t | 3e-16 | |
| pfam02798 | 74 | pfam02798, GST_N, Glutathione S-transferase, N-ter | 4e-16 | |
| cd03042 | 73 | cd03042, GST_N_Zeta, GST_N family, Class Zeta subf | 5e-14 | |
| PRK10357 | 202 | PRK10357, PRK10357, putative glutathione S-transfe | 2e-09 | |
| cd03049 | 73 | cd03049, GST_N_3, GST_N family, unknown subfamily | 1e-08 | |
| PRK09481 | 211 | PRK09481, sspA, stringent starvation protein A; Pr | 2e-08 | |
| cd03056 | 73 | cd03056, GST_N_4, GST_N family, unknown subfamily | 1e-07 | |
| cd03046 | 76 | cd03046, GST_N_GTT1_like, GST_N family, Saccharomy | 2e-07 | |
| cd03053 | 76 | cd03053, GST_N_Phi, GST_N family, Class Phi subfam | 3e-07 | |
| PRK15113 | 214 | PRK15113, PRK15113, glutathione S-transferase; Pro | 5e-07 | |
| cd03055 | 89 | cd03055, GST_N_Omega, GST_N family, Class Omega su | 6e-07 | |
| cd03059 | 73 | cd03059, GST_N_SspA, GST_N family, Stringent starv | 8e-07 | |
| cd03054 | 72 | cd03054, GST_N_Metaxin, GST_N family, Metaxin subf | 5e-06 | |
| cd03060 | 71 | cd03060, GST_N_Omega_like, GST_N family, Omega-lik | 2e-05 | |
| cd03038 | 84 | cd03038, GST_N_etherase_LigE, GST_N family, Beta e | 3e-05 | |
| cd03184 | 124 | cd03184, GST_C_Omega, C-terminal, alpha helical do | 4e-05 | |
| cd03080 | 75 | cd03080, GST_N_Metaxin_like, GST_N family, Metaxin | 1e-04 | |
| cd00299 | 100 | cd00299, GST_C_family, C-terminal, alpha helical d | 2e-04 | |
| pfam00043 | 92 | pfam00043, GST_C, Glutathione S-transferase, C-ter | 4e-04 | |
| cd03050 | 76 | cd03050, GST_N_Theta, GST_N family, Class Theta su | 7e-04 | |
| pfam13410 | 69 | pfam13410, GST_C_2, Glutathione S-transferase, C-t | 7e-04 | |
| cd03043 | 73 | cd03043, GST_N_1, GST_N family, unknown subfamily | 0.002 | |
| cd03051 | 74 | cd03051, GST_N_GTT2_like, GST_N family, Saccharomy | 0.003 | |
| cd03180 | 110 | cd03180, GST_C_2, C-terminal, alpha helical domain | 0.004 | |
| cd03052 | 73 | cd03052, GST_N_GDAP1, GST_N family, Ganglioside-in | 0.004 | |
| cd10291 | 110 | cd10291, GST_C_YfcG_like, C-terminal, alpha helica | 0.004 | |
| cd03188 | 113 | cd03188, GST_C_Beta, C-terminal, alpha helical dom | 0.004 | |
| PLN02817 | 265 | PLN02817, PLN02817, glutathione dehydrogenase (asc | 0.004 |
| >gnl|CDD|198294 cd03185, GST_C_Tau, C-terminal, alpha helical domain of Class Tau Glutathione S-transferases | Back alignment and domain information |
|---|
Score = 166 bits (423), Expect = 4e-53
Identities = 65/127 (51%), Positives = 81/127 (63%), Gaps = 2/127 (1%)
Query: 89 PYERANARFWAKFFDEKCVPEVMGAFASKGEEQEKAAK-ARENLKMLERAL-EGKPFFGG 146
PYERA ARFWA + D+K P +A+KGEEQEKA + A E LK+LE L GKPFFGG
Sbjct: 1 PYERAQARFWAAYIDDKLFPAGRKVWAAKGEEQEKAVEEALEALKVLEEELKGGKPFFGG 60
Query: 147 DKIGFLDIAVGWIGIWGRIVEEIAGVSLIDAETMPLLTAWLNNFLEVPVIKACIPSWHEL 206
D IG+LDIA+G W + +EE+ GV L+D E PLL AW FLE +K +P +L
Sbjct: 61 DTIGYLDIALGSFLGWFKAIEEVGGVKLLDEEKFPLLAAWAERFLEREAVKEVLPDRDKL 120
Query: 207 LEHNKGF 213
+E K
Sbjct: 121 VEFLKAL 127
|
Glutathione S-transferase (GST) C-terminal domain family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress. The GST fold contains an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GSH binds to the N-terminal domain while the hydrophobic substrate occupies a pocket in the C-terminal domain. The plant-specific class Tau GST subfamily has undergone extensive gene duplication. The Arabidopsis and Oryza genomes contain 28 and 40 Tau GSTs, respectively. They are primarily responsible for herbicide detoxification together with class Phi GSTs, showing class specificity in substrate preference. Tau enzymes are highly efficient in detoxifying diphenylether and aryloxyphenoxypropionate herbicides. In addition, Tau GSTs play important roles in intracellular signalling, biosynthesis of anthocyanin, responses to soil stresses and responses to auxin and cytokinin hormones. Length = 127 |
| >gnl|CDD|239356 cd03058, GST_N_Tau, GST_N family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >gnl|CDD|223698 COG0625, Gst, Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|233333 TIGR01262, maiA, maleylacetoacetate isomerase | Back alignment and domain information |
|---|
| >gnl|CDD|205595 pfam13417, GST_N_3, Glutathione S-transferase, N-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|238319 cd00570, GST_N_family, Glutathione S-transferase (GST) family, N-terminal domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >gnl|CDD|222110 pfam13409, GST_N_2, Glutathione S-transferase, N-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|217234 pfam02798, GST_N, Glutathione S-transferase, N-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|239340 cd03042, GST_N_Zeta, GST_N family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >gnl|CDD|182405 PRK10357, PRK10357, putative glutathione S-transferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239347 cd03049, GST_N_3, GST_N family, unknown subfamily 3; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >gnl|CDD|236537 PRK09481, sspA, stringent starvation protein A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239354 cd03056, GST_N_4, GST_N family, unknown subfamily 4; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >gnl|CDD|239344 cd03046, GST_N_GTT1_like, GST_N family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S | Back alignment and domain information |
|---|
| >gnl|CDD|239351 cd03053, GST_N_Phi, GST_N family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins | Back alignment and domain information |
|---|
| >gnl|CDD|185068 PRK15113, PRK15113, glutathione S-transferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239353 cd03055, GST_N_Omega, GST_N family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >gnl|CDD|239357 cd03059, GST_N_SspA, GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E | Back alignment and domain information |
|---|
| >gnl|CDD|239352 cd03054, GST_N_Metaxin, GST_N family, Metaxin subfamily; composed of metaxins and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239358 cd03060, GST_N_Omega_like, GST_N family, Omega-like subfamily; composed of uncharacterized proteins with similarity to class Omega GSTs | Back alignment and domain information |
|---|
| >gnl|CDD|239336 cd03038, GST_N_etherase_LigE, GST_N family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor | Back alignment and domain information |
|---|
| >gnl|CDD|198293 cd03184, GST_C_Omega, C-terminal, alpha helical domain of Class Omega Glutathione S-transferases | Back alignment and domain information |
|---|
| >gnl|CDD|239378 cd03080, GST_N_Metaxin_like, GST_N family, Metaxin subfamily, Metaxin-like proteins; a heterogenous group of proteins, predominantly uncharacterized, with similarity to metaxins and GSTs | Back alignment and domain information |
|---|
| >gnl|CDD|198286 cd00299, GST_C_family, C-terminal, alpha helical domain of the Glutathione S-transferase family | Back alignment and domain information |
|---|
| >gnl|CDD|215674 pfam00043, GST_C, Glutathione S-transferase, C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|239348 cd03050, GST_N_Theta, GST_N family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase | Back alignment and domain information |
|---|
| >gnl|CDD|222111 pfam13410, GST_C_2, Glutathione S-transferase, C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|239341 cd03043, GST_N_1, GST_N family, unknown subfamily 1; composed of uncharacterized proteins, predominantly from bacteria, with similarity to GSTs | Back alignment and domain information |
|---|
| >gnl|CDD|239349 cd03051, GST_N_GTT2_like, GST_N family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S | Back alignment and domain information |
|---|
| >gnl|CDD|198289 cd03180, GST_C_2, C-terminal, alpha helical domain of an unknown subfamily 2 of Glutathione S-transferases | Back alignment and domain information |
|---|
| >gnl|CDD|239350 cd03052, GST_N_GDAP1, GST_N family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells | Back alignment and domain information |
|---|
| >gnl|CDD|198324 cd10291, GST_C_YfcG_like, C-terminal, alpha helical domain of Escherichia coli YfcG Glutathione S-transferases and related uncharacterized proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198297 cd03188, GST_C_Beta, C-terminal, alpha helical domain of Class Beta Glutathione S-transferases | Back alignment and domain information |
|---|
| >gnl|CDD|166458 PLN02817, PLN02817, glutathione dehydrogenase (ascorbate) | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 222 | |||
| KOG0406 | 231 | consensus Glutathione S-transferase [Posttranslati | 100.0 | |
| PRK09481 | 211 | sspA stringent starvation protein A; Provisional | 100.0 | |
| PRK15113 | 214 | glutathione S-transferase; Provisional | 100.0 | |
| PLN02473 | 214 | glutathione S-transferase | 100.0 | |
| PRK13972 | 215 | GSH-dependent disulfide bond oxidoreductase; Provi | 100.0 | |
| PRK10542 | 201 | glutathionine S-transferase; Provisional | 100.0 | |
| KOG0868 | 217 | consensus Glutathione S-transferase [Posttranslati | 100.0 | |
| PRK10357 | 202 | putative glutathione S-transferase; Provisional | 100.0 | |
| TIGR01262 | 210 | maiA maleylacetoacetate isomerase. Maleylacetoacet | 100.0 | |
| PLN02395 | 215 | glutathione S-transferase | 100.0 | |
| TIGR00862 | 236 | O-ClC intracellular chloride channel protein. Thes | 100.0 | |
| COG0625 | 211 | Gst Glutathione S-transferase [Posttranslational m | 100.0 | |
| PRK11752 | 264 | putative S-transferase; Provisional | 100.0 | |
| PLN02378 | 213 | glutathione S-transferase DHAR1 | 100.0 | |
| PTZ00057 | 205 | glutathione s-transferase; Provisional | 100.0 | |
| PLN02817 | 265 | glutathione dehydrogenase (ascorbate) | 99.98 | |
| KOG0867 | 226 | consensus Glutathione S-transferase [Posttranslati | 99.97 | |
| PRK10387 | 210 | glutaredoxin 2; Provisional | 99.97 | |
| KOG1695 | 206 | consensus Glutathione S-transferase [Posttranslati | 99.96 | |
| TIGR02182 | 209 | GRXB Glutaredoxin, GrxB family. This model include | 99.96 | |
| KOG4420 | 325 | consensus Uncharacterized conserved protein (Gangl | 99.94 | |
| KOG1422 | 221 | consensus Intracellular Cl- channel CLIC, contains | 99.9 | |
| PLN02907 | 722 | glutamate-tRNA ligase | 99.9 | |
| KOG3029 | 370 | consensus Glutathione S-transferase-related protei | 99.83 | |
| PF13417 | 75 | GST_N_3: Glutathione S-transferase, N-terminal dom | 99.83 | |
| cd03059 | 73 | GST_N_SspA GST_N family, Stringent starvation prot | 99.79 | |
| cd03058 | 74 | GST_N_Tau GST_N family, Class Tau subfamily; GSTs | 99.79 | |
| cd03061 | 91 | GST_N_CLIC GST_N family, Chloride Intracellular Ch | 99.78 | |
| cd03052 | 73 | GST_N_GDAP1 GST_N family, Ganglioside-induced diff | 99.78 | |
| cd03076 | 73 | GST_N_Pi GST_N family, Class Pi subfamily; GSTs ar | 99.77 | |
| cd03041 | 77 | GST_N_2GST_N GST_N family, 2 repeats of the N-term | 99.76 | |
| cd03045 | 74 | GST_N_Delta_Epsilon GST_N family, Class Delta and | 99.76 | |
| cd03060 | 71 | GST_N_Omega_like GST_N family, Omega-like subfamil | 99.76 | |
| cd03185 | 126 | GST_C_Tau GST_C family, Class Tau subfamily; GSTs | 99.76 | |
| cd03053 | 76 | GST_N_Phi GST_N family, Class Phi subfamily; compo | 99.75 | |
| cd03050 | 76 | GST_N_Theta GST_N family, Class Theta subfamily; c | 99.75 | |
| cd03056 | 73 | GST_N_4 GST_N family, unknown subfamily 4; compose | 99.74 | |
| cd03039 | 72 | GST_N_Sigma_like GST_N family, Class Sigma_like; c | 99.73 | |
| cd03037 | 71 | GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) sub | 99.73 | |
| cd03049 | 73 | GST_N_3 GST_N family, unknown subfamily 3; compose | 99.73 | |
| cd03055 | 89 | GST_N_Omega GST_N family, Class Omega subfamily; G | 99.72 | |
| cd03044 | 75 | GST_N_EF1Bgamma GST_N family, Gamma subunit of Elo | 99.72 | |
| cd03048 | 81 | GST_N_Ure2p_like GST_N family, Ure2p-like subfamil | 99.72 | |
| cd03047 | 73 | GST_N_2 GST_N family, unknown subfamily 2; compose | 99.72 | |
| cd03051 | 74 | GST_N_GTT2_like GST_N family, Saccharomyces cerevi | 99.71 | |
| cd03046 | 76 | GST_N_GTT1_like GST_N family, Saccharomyces cerevi | 99.71 | |
| cd03042 | 73 | GST_N_Zeta GST_N family, Class Zeta subfamily; GST | 99.7 | |
| cd03057 | 77 | GST_N_Beta GST_N family, Class Beta subfamily; GST | 99.7 | |
| KOG4244 | 281 | consensus Failed axon connections (fax) protein/gl | 99.7 | |
| cd03077 | 79 | GST_N_Alpha GST_N family, Class Alpha subfamily; G | 99.7 | |
| cd03040 | 77 | GST_N_mPGES2 GST_N family; microsomal Prostaglandi | 99.69 | |
| cd03184 | 124 | GST_C_Omega GST_C family, Class Omega subfamily; G | 99.69 | |
| cd03190 | 142 | GST_C_ECM4_like GST_C family, ECM4-like subfamily; | 99.69 | |
| cd03075 | 82 | GST_N_Mu GST_N family, Class Mu subfamily; GSTs ar | 99.68 | |
| cd03186 | 107 | GST_C_SspA GST_N family, Stringent starvation prot | 99.68 | |
| cd03080 | 75 | GST_N_Metaxin_like GST_N family, Metaxin subfamily | 99.66 | |
| PF02798 | 76 | GST_N: Glutathione S-transferase, N-terminal domai | 99.66 | |
| COG2999 | 215 | GrxB Glutaredoxin 2 [Posttranslational modificatio | 99.66 | |
| PF13409 | 70 | GST_N_2: Glutathione S-transferase, N-terminal dom | 99.66 | |
| cd03196 | 115 | GST_C_5 GST_C family, unknown subfamily 5; compose | 99.65 | |
| cd03038 | 84 | GST_N_etherase_LigE GST_N family, Beta etherase Li | 99.65 | |
| cd03188 | 114 | GST_C_Beta GST_C family, Class Beta subfamily; GST | 99.63 | |
| cd00570 | 71 | GST_N_family Glutathione S-transferase (GST) famil | 99.61 | |
| cd03043 | 73 | GST_N_1 GST_N family, unknown subfamily 1; compose | 99.61 | |
| cd03198 | 134 | GST_C_CLIC GST_C family, Chloride Intracellular Ch | 99.58 | |
| cd03209 | 121 | GST_C_Mu GST_C family, Class Mu subfamily; GSTs ar | 99.58 | |
| cd03203 | 120 | GST_C_Lambda GST_C family, Class Lambda subfamily; | 99.57 | |
| cd03191 | 121 | GST_C_Zeta GST_C family, Class Zeta subfamily; GST | 99.57 | |
| cd03054 | 72 | GST_N_Metaxin GST_N family, Metaxin subfamily; com | 99.57 | |
| cd03201 | 121 | GST_C_DHAR GST_C family, Dehydroascorbate Reductas | 99.56 | |
| cd03178 | 113 | GST_C_Ure2p_like GST_C family, Ure2p-like subfamil | 99.56 | |
| cd03210 | 126 | GST_C_Pi GST_C family, Class Pi subfamily; GSTs ar | 99.55 | |
| cd03182 | 117 | GST_C_GTT2_like GST_C family, Saccharomyces cerevi | 99.55 | |
| COG0435 | 324 | ECM4 Predicted glutathione S-transferase [Posttran | 99.54 | |
| cd03208 | 137 | GST_C_Alpha GST_C family, Class Alpha subfamily; G | 99.54 | |
| cd03189 | 119 | GST_C_GTT1_like GST_C family, Saccharomyces cerevi | 99.53 | |
| cd03187 | 118 | GST_C_Phi GST_C family, Class Phi subfamily; compo | 99.53 | |
| KOG3027 | 257 | consensus Mitochondrial outer membrane protein Met | 99.52 | |
| cd03180 | 110 | GST_C_2 GST_C family, unknown subfamily 2; compose | 99.5 | |
| cd03181 | 123 | GST_C_EFB1gamma GST_C family, Gamma subunit of Elo | 99.5 | |
| cd03177 | 118 | GST_C_Delta_Epsilon GST_C family, Class Delta and | 99.49 | |
| KOG2903 | 319 | consensus Predicted glutathione S-transferase [Pos | 99.48 | |
| cd03183 | 126 | GST_C_Theta GST_C family, Class Theta subfamily; c | 99.45 | |
| cd03200 | 96 | GST_C_JTV1 GST_C family, JTV-1 subfamily; composed | 99.43 | |
| PF00043 | 95 | GST_C: Glutathione S-transferase, C-terminal domai | 99.42 | |
| cd03207 | 103 | GST_C_8 GST_C family, unknown subfamily 8; compose | 99.42 | |
| cd03195 | 114 | GST_C_4 GST_C family, unknown subfamily 4; compose | 99.42 | |
| cd03206 | 100 | GST_C_7 GST_C family, unknown subfamily 7; compose | 99.37 | |
| PF13410 | 69 | GST_C_2: Glutathione S-transferase, C-terminal dom | 99.36 | |
| cd03179 | 105 | GST_C_1 GST_C family, unknown subfamily 1; compose | 99.33 | |
| cd03204 | 111 | GST_C_GDAP1 GST_C family, Ganglioside-induced diff | 99.32 | |
| cd03079 | 74 | GST_N_Metaxin2 GST_N family, Metaxin subfamily, Me | 99.28 | |
| PF14497 | 99 | GST_C_3: Glutathione S-transferase, C-terminal dom | 99.27 | |
| cd03192 | 104 | GST_C_Sigma_like GST_C family, Class Sigma_like; c | 99.27 | |
| TIGR02190 | 79 | GlrX-dom Glutaredoxin-family domain. This C-termin | 99.26 | |
| cd03194 | 114 | GST_C_3 GST_C family, unknown subfamily 3; compose | 99.26 | |
| cd00299 | 100 | GST_C_family Glutathione S-transferase (GST) famil | 99.19 | |
| PRK10638 | 83 | glutaredoxin 3; Provisional | 99.12 | |
| cd03202 | 124 | GST_C_etherase_LigE GST_C family, Beta etherase Li | 99.11 | |
| cd03029 | 72 | GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hyb | 99.1 | |
| cd03193 | 88 | GST_C_Metaxin GST_C family, Metaxin subfamily; com | 99.1 | |
| cd03078 | 73 | GST_N_Metaxin1_like GST_N family, Metaxin subfamil | 99.0 | |
| KOG3028 | 313 | consensus Translocase of outer mitochondrial membr | 98.89 | |
| cd03205 | 98 | GST_C_6 GST_C family, unknown subfamily 6; compose | 98.89 | |
| cd03027 | 73 | GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Eg | 98.88 | |
| PF14834 | 117 | GST_C_4: Glutathione S-transferase, C-terminal dom | 98.82 | |
| PRK10329 | 81 | glutaredoxin-like protein; Provisional | 98.81 | |
| cd03211 | 126 | GST_C_Metaxin2 GST_C family, Metaxin subfamily, Me | 98.78 | |
| cd02066 | 72 | GRX_family Glutaredoxin (GRX) family; composed of | 98.77 | |
| cd03197 | 149 | GST_C_mPGES2 GST_C family; microsomal Prostaglandi | 98.76 | |
| cd02976 | 73 | NrdH NrdH-redoxin (NrdH) family; NrdH is a small m | 98.76 | |
| TIGR02196 | 74 | GlrX_YruB Glutaredoxin-like protein, YruB-family. | 98.75 | |
| cd03212 | 137 | GST_C_Metaxin1_3 GST_C family, Metaxin subfamily, | 98.75 | |
| cd03418 | 75 | GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX b | 98.71 | |
| TIGR02200 | 77 | GlrX_actino Glutaredoxin-like protein. This family | 98.6 | |
| COG0695 | 80 | GrxC Glutaredoxin and related proteins [Posttransl | 98.59 | |
| TIGR02181 | 79 | GRX_bact Glutaredoxin, GrxC family. This family of | 98.54 | |
| TIGR02194 | 72 | GlrX_NrdH Glutaredoxin-like protein NrdH. NrdH-red | 98.52 | |
| PHA03050 | 108 | glutaredoxin; Provisional | 98.49 | |
| PRK11200 | 85 | grxA glutaredoxin 1; Provisional | 98.49 | |
| TIGR02189 | 99 | GlrX-like_plant Glutaredoxin-like family. This fam | 98.48 | |
| PF00462 | 60 | Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Gl | 98.44 | |
| cd03419 | 82 | GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX h | 98.38 | |
| TIGR02183 | 86 | GRXA Glutaredoxin, GrxA family. This model include | 98.37 | |
| TIGR00365 | 97 | monothiol glutaredoxin, Grx4 family. The gene for | 98.3 | |
| cd03028 | 90 | GRX_PICOT_like Glutaredoxin (GRX) family, PKC-inte | 98.21 | |
| TIGR02180 | 84 | GRX_euk Glutaredoxin. This model represents eukary | 98.05 | |
| PF10568 | 72 | Tom37: Outer mitochondrial membrane transport comp | 97.89 | |
| cd03031 | 147 | GRX_GRX_like Glutaredoxin (GRX) family, GRX-like d | 97.64 | |
| PRK10824 | 115 | glutaredoxin-4; Provisional | 97.61 | |
| PRK12759 | 410 | bifunctional gluaredoxin/ribonucleoside-diphosphat | 97.59 | |
| KOG1147 | 712 | consensus Glutamyl-tRNA synthetase [Translation, r | 97.5 | |
| KOG1752 | 104 | consensus Glutaredoxin and related proteins [Postt | 97.34 | |
| PTZ00062 | 204 | glutaredoxin; Provisional | 97.19 | |
| PF04399 | 132 | Glutaredoxin2_C: Glutaredoxin 2, C terminal domain | 97.15 | |
| cd02973 | 67 | TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)- | 97.14 | |
| cd03036 | 111 | ArsC_like Arsenate Reductase (ArsC) family, unknow | 96.96 | |
| cd02977 | 105 | ArsC_family Arsenate Reductase (ArsC) family; comp | 96.9 | |
| COG4545 | 85 | Glutaredoxin-related protein [Posttranslational mo | 96.8 | |
| PRK01655 | 131 | spxA transcriptional regulator Spx; Reviewed | 96.71 | |
| cd03032 | 115 | ArsC_Spx Arsenate Reductase (ArsC) family, Spx sub | 96.58 | |
| TIGR01617 | 117 | arsC_related transcriptional regulator, Spx/MgsR f | 96.51 | |
| cd03199 | 128 | GST_C_GRX2 GST_C family, Glutaredoxin 2 (GRX2) sub | 96.4 | |
| cd03033 | 113 | ArsC_15kD Arsenate Reductase (ArsC) family, 15kD p | 96.29 | |
| cd03035 | 105 | ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb s | 96.27 | |
| PRK13344 | 132 | spxA transcriptional regulator Spx; Reviewed | 96.1 | |
| PRK12559 | 131 | transcriptional regulator Spx; Provisional | 96.07 | |
| PRK10026 | 141 | arsenate reductase; Provisional | 96.06 | |
| PF05768 | 81 | DUF836: Glutaredoxin-like domain (DUF836); InterPr | 96.0 | |
| cd03030 | 92 | GRX_SH3BGR Glutaredoxin (GRX) family, SH3BGR (SH3 | 95.96 | |
| COG0278 | 105 | Glutaredoxin-related protein [Posttranslational mo | 95.3 | |
| TIGR01616 | 126 | nitro_assoc nitrogenase-associated protein. This m | 95.26 | |
| TIGR00412 | 76 | redox_disulf_2 small redox-active disulfide protei | 95.2 | |
| cd03034 | 112 | ArsC_ArsC Arsenate Reductase (ArsC) family, ArsC s | 95.06 | |
| COG1393 | 117 | ArsC Arsenate reductase and related proteins, glut | 95.01 | |
| PF11287 | 112 | DUF3088: Protein of unknown function (DUF3088); In | 94.99 | |
| cd03026 | 89 | AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxid | 94.96 | |
| TIGR00014 | 114 | arsC arsenate reductase (glutaredoxin). composed o | 94.95 | |
| TIGR00411 | 82 | redox_disulf_1 small redox-active disulfide protei | 94.91 | |
| PRK10853 | 118 | putative reductase; Provisional | 94.91 | |
| cd01659 | 69 | TRX_superfamily Thioredoxin (TRX) superfamily; a l | 94.74 | |
| PF11801 | 168 | Tom37_C: Tom37 C-terminal domain; InterPro: IPR019 | 93.62 | |
| PHA02125 | 75 | thioredoxin-like protein | 93.31 | |
| PF13192 | 76 | Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZY | 91.8 | |
| PF03960 | 110 | ArsC: ArsC family; InterPro: IPR006660 Several bac | 88.71 | |
| PF04908 | 99 | SH3BGR: SH3-binding, glutamic acid-rich protein; I | 86.72 |
| >KOG0406 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1e-39 Score=247.01 Aligned_cols=215 Identities=52% Similarity=0.808 Sum_probs=192.3
Q ss_pred ceEEeeccCCchHHHHHHHHHHhCCCceEEeCCCCCCchhhhhhCCCCCcccEEEeCCeecchHHHHHHHHHhhCC-CCC
Q 027498 5 SVKLLGYWASPFALRVKWALKLKGVHYEYVEENLPNKSPLLLRYNPVYKKIPVLVHNGKPLAESLLIIEYIDEAWK-QNP 83 (222)
Q Consensus 5 ~~~L~~~~~s~~~~~vr~~L~~~gi~~~~~~~~~~~~~~~~~~~~p~~~~vP~l~~~~~~i~es~~I~~yL~~~~~-~~~ 83 (222)
.++||++..|||++|++++|..+||+|+.++.|..+++++++..||.+++||+|+++|..|.||..|++||++.++ +++
T Consensus 9 ~vrL~~~w~sPfa~R~~iaL~~KgI~yE~veedl~~Ks~~ll~~np~hkKVPvL~Hn~k~i~ESliiveYiDe~w~~~~~ 88 (231)
T KOG0406|consen 9 TVKLLGMWFSPFAQRVRIALKLKGIPYEYVEEDLTNKSEWLLEKNPVHKKVPVLEHNGKPICESLIIVEYIDETWPSGPP 88 (231)
T ss_pred eEEEEEeecChHHHHHHHHHHhcCCceEEEecCCCCCCHHHHHhccccccCCEEEECCceehhhHHHHHHHHhhccCCCC
Confidence 5999999999999999999999999999999999999999999997779999999999999999999999999999 589
Q ss_pred CCCCCHHHHHHHHHHHHHHhcccchhhhhhhc-CCcHHHHHHHH-HHHHHHHHHHHhc-CCCcccCCCCChhHHHHHhHH
Q 027498 84 LLPDDPYERANARFWAKFFDEKCVPEVMGAFA-SKGEEQEKAAK-ARENLKMLERALE-GKPFFGGDKIGFLDIAVGWIG 160 (222)
Q Consensus 84 l~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~-~~~~l~~le~~L~-~~~~l~G~~~t~aD~~l~~~l 160 (222)
++|+|+.+|+.++.|..+++..+.......+. ..++..+...+ +.+.|..||+.|. +.+|+.|+++++.|+++++.+
T Consensus 89 iLP~DPy~Ra~arfwa~~id~~~~~~~~~~~~~~~~e~~~~~~~e~~e~l~~lE~el~k~k~~fgG~~~G~vDi~~~p~~ 168 (231)
T KOG0406|consen 89 ILPSDPYERAQARFWAEYIDKKVFFVGRFVVAAKGGEEQEAAKEELREALKVLEEELGKGKDFFGGETIGFVDIAIGPSF 168 (231)
T ss_pred CCCCCHHHHHHHHHHHHHHHhHHHHHHHHHHhhcCchHHHHHHHHHHHHHHHHHHHHhcCCCCCCCCCcCHhhhhHHhhH
Confidence 99999999999999999999988777777666 44577777788 9999999999998 789999999999999999776
Q ss_pred HHHHHHHHH-hcccccCCCcccHHHHHHHHHhcchhhhhcCCChHHHHHHhhhhhhhhcc
Q 027498 161 IWGRIVEEI-AGVSLIDAETMPLLTAWLNNFLEVPVIKACIPSWHELLEHNKGFHKILTG 219 (222)
Q Consensus 161 ~~~~~~~~~-~~~~~~~~~~~p~l~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~ 219 (222)
.+.....+. .+......+.+|.|.+|.++|.++|.+++++++.+++.+..+.+++....
T Consensus 169 ~~~~~~~~~~~~~~~~~~~~~P~L~~W~~~~~~~~~V~~~~p~~e~~~e~~~~~~~~~~~ 228 (231)
T KOG0406|consen 169 ERWLAVLEKFGGVKFIIEEETPKLIKWIKRMKEDEAVKAVLPDSEKVVEFMKKYRQGSPN 228 (231)
T ss_pred HHHHHHHHHhcCcccCCCCCCccHHHHHHHHhcChhHHhhcCCHHHHHHHHHHHHHhccc
Confidence 666443333 22345557799999999999999999999999999999999999987543
|
|
| >PRK09481 sspA stringent starvation protein A; Provisional | Back alignment and domain information |
|---|
| >PRK15113 glutathione S-transferase; Provisional | Back alignment and domain information |
|---|
| >PLN02473 glutathione S-transferase | Back alignment and domain information |
|---|
| >PRK13972 GSH-dependent disulfide bond oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK10542 glutathionine S-transferase; Provisional | Back alignment and domain information |
|---|
| >KOG0868 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10357 putative glutathione S-transferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01262 maiA maleylacetoacetate isomerase | Back alignment and domain information |
|---|
| >PLN02395 glutathione S-transferase | Back alignment and domain information |
|---|
| >TIGR00862 O-ClC intracellular chloride channel protein | Back alignment and domain information |
|---|
| >COG0625 Gst Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK11752 putative S-transferase; Provisional | Back alignment and domain information |
|---|
| >PLN02378 glutathione S-transferase DHAR1 | Back alignment and domain information |
|---|
| >PTZ00057 glutathione s-transferase; Provisional | Back alignment and domain information |
|---|
| >PLN02817 glutathione dehydrogenase (ascorbate) | Back alignment and domain information |
|---|
| >KOG0867 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10387 glutaredoxin 2; Provisional | Back alignment and domain information |
|---|
| >KOG1695 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02182 GRXB Glutaredoxin, GrxB family | Back alignment and domain information |
|---|
| >KOG4420 consensus Uncharacterized conserved protein (Ganglioside-induced differentiation associated protein 1, GDAP1) [Function unknown] | Back alignment and domain information |
|---|
| >KOG1422 consensus Intracellular Cl- channel CLIC, contains GST domain [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02907 glutamate-tRNA ligase | Back alignment and domain information |
|---|
| >KOG3029 consensus Glutathione S-transferase-related protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13417 GST_N_3: Glutathione S-transferase, N-terminal domain; PDB: 3ERG_B 3IBH_A 3ERF_A 3UBL_A 3UBK_A 3IR4_A 3M8N_B 2R4V_A 2PER_A 2R5G_A | Back alignment and domain information |
|---|
| >cd03059 GST_N_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E | Back alignment and domain information |
|---|
| >cd03058 GST_N_Tau GST_N family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03061 GST_N_CLIC GST_N family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin and similar proteins | Back alignment and domain information |
|---|
| >cd03052 GST_N_GDAP1 GST_N family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells | Back alignment and domain information |
|---|
| >cd03076 GST_N_Pi GST_N family, Class Pi subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03041 GST_N_2GST_N GST_N family, 2 repeats of the N-terminal domain of soluble GSTs (2 GST_N) subfamily; composed of uncharacterized proteins | Back alignment and domain information |
|---|
| >cd03045 GST_N_Delta_Epsilon GST_N family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03060 GST_N_Omega_like GST_N family, Omega-like subfamily; composed of uncharacterized proteins with similarity to class Omega GSTs | Back alignment and domain information |
|---|
| >cd03185 GST_C_Tau GST_C family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03053 GST_N_Phi GST_N family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins | Back alignment and domain information |
|---|
| >cd03050 GST_N_Theta GST_N family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase | Back alignment and domain information |
|---|
| >cd03056 GST_N_4 GST_N family, unknown subfamily 4; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03039 GST_N_Sigma_like GST_N family, Class Sigma_like; composed of GSTs belonging to class Sigma and similar proteins, including GSTs from class Mu, Pi and Alpha | Back alignment and domain information |
|---|
| >cd03037 GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E | Back alignment and domain information |
|---|
| >cd03049 GST_N_3 GST_N family, unknown subfamily 3; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03055 GST_N_Omega GST_N family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03044 GST_N_EF1Bgamma GST_N family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis | Back alignment and domain information |
|---|
| >cd03048 GST_N_Ure2p_like GST_N family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs | Back alignment and domain information |
|---|
| >cd03047 GST_N_2 GST_N family, unknown subfamily 2; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03051 GST_N_GTT2_like GST_N family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S | Back alignment and domain information |
|---|
| >cd03046 GST_N_GTT1_like GST_N family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S | Back alignment and domain information |
|---|
| >cd03042 GST_N_Zeta GST_N family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03057 GST_N_Beta GST_N family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >KOG4244 consensus Failed axon connections (fax) protein/glutathione S-transferase-like protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd03077 GST_N_Alpha GST_N family, Class Alpha subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03040 GST_N_mPGES2 GST_N family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2 | Back alignment and domain information |
|---|
| >cd03184 GST_C_Omega GST_C family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03190 GST_C_ECM4_like GST_C family, ECM4-like subfamily; composed of predominantly uncharacterized and taxonomically diverse proteins with similarity to the translation product of the Saccharomyces cerevisiae gene ECM4 | Back alignment and domain information |
|---|
| >cd03075 GST_N_Mu GST_N family, Class Mu subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03186 GST_C_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E | Back alignment and domain information |
|---|
| >cd03080 GST_N_Metaxin_like GST_N family, Metaxin subfamily, Metaxin-like proteins; a heterogenous group of proteins, predominantly uncharacterized, with similarity to metaxins and GSTs | Back alignment and domain information |
|---|
| >PF02798 GST_N: Glutathione S-transferase, N-terminal domain; InterPro: IPR004045 In eukaryotes, glutathione S-transferases (GSTs) participate in the detoxification of reactive electrophillic compounds by catalysing their conjugation to glutathione | Back alignment and domain information |
|---|
| >COG2999 GrxB Glutaredoxin 2 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13409 GST_N_2: Glutathione S-transferase, N-terminal domain; PDB: 3C8E_B 3M1G_A 3R3E_A 3O3T_A 1RK4_A 1K0O_B 1K0N_A 3QR6_A 3SWL_A 3TGZ_B | Back alignment and domain information |
|---|
| >cd03196 GST_C_5 GST_C family, unknown subfamily 5; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03038 GST_N_etherase_LigE GST_N family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor | Back alignment and domain information |
|---|
| >cd03188 GST_C_Beta GST_C family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress | Back alignment and domain information |
|---|
| >cd00570 GST_N_family Glutathione S-transferase (GST) family, N-terminal domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03043 GST_N_1 GST_N family, unknown subfamily 1; composed of uncharacterized proteins, predominantly from bacteria, with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03198 GST_C_CLIC GST_C family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin, and similar proteins | Back alignment and domain information |
|---|
| >cd03209 GST_C_Mu GST_C family, Class Mu subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03203 GST_C_Lambda GST_C family, Class Lambda subfamily; composed of plant-specific class Lambda GSTs | Back alignment and domain information |
|---|
| >cd03191 GST_C_Zeta GST_C family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03054 GST_N_Metaxin GST_N family, Metaxin subfamily; composed of metaxins and related proteins | Back alignment and domain information |
|---|
| >cd03201 GST_C_DHAR GST_C family, Dehydroascorbate Reductase (DHAR) subfamily; composed of plant-specific DHARs, monomeric enzymes catalyzing the reduction of DHA into ascorbic acid (AsA) using glutathione as the reductant | Back alignment and domain information |
|---|
| >cd03178 GST_C_Ure2p_like GST_C family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs | Back alignment and domain information |
|---|
| >cd03210 GST_C_Pi GST_C family, Class Pi subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03182 GST_C_GTT2_like GST_C family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S | Back alignment and domain information |
|---|
| >COG0435 ECM4 Predicted glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03208 GST_C_Alpha GST_C family, Class Alpha subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03189 GST_C_GTT1_like GST_C family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S | Back alignment and domain information |
|---|
| >cd03187 GST_C_Phi GST_C family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins | Back alignment and domain information |
|---|
| >KOG3027 consensus Mitochondrial outer membrane protein Metaxin 2, Metaxin 1-binding protein [Cell wall/membrane/envelope biogenesis; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd03180 GST_C_2 GST_C family, unknown subfamily 2; composed of uncharacterized bacterial proteins, with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03181 GST_C_EFB1gamma GST_C family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis | Back alignment and domain information |
|---|
| >cd03177 GST_C_Delta_Epsilon GST_C family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >KOG2903 consensus Predicted glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03183 GST_C_Theta GST_C family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase | Back alignment and domain information |
|---|
| >cd03200 GST_C_JTV1 GST_C family, JTV-1 subfamily; composed of uncharacterized proteins with similarity to the translation product of the human JTV-1 gene | Back alignment and domain information |
|---|
| >PF00043 GST_C: Glutathione S-transferase, C-terminal domain; InterPro: IPR004046 In eukaryotes, glutathione S-transferases (GSTs) participate in the detoxification of reactive electrophillic compounds by catalysing their conjugation to glutathione | Back alignment and domain information |
|---|
| >cd03207 GST_C_8 GST_C family, unknown subfamily 8; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03195 GST_C_4 GST_C family, unknown subfamily 4; composed of uncharacterized proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03206 GST_C_7 GST_C family, unknown subfamily 7; composed of uncharacterized proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >PF13410 GST_C_2: Glutathione S-transferase, C-terminal domain; PDB: 4DEJ_H 3IC8_A 2JL4_A 2V6K_B 3CBU_B 1JLW_B 3F6D_B 3G7I_A 3F63_A 3G7J_B | Back alignment and domain information |
|---|
| >cd03179 GST_C_1 GST_C family, unknown subfamily 1; composed of uncharacterized bacterial proteins, with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03204 GST_C_GDAP1 GST_C family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells | Back alignment and domain information |
|---|
| >cd03079 GST_N_Metaxin2 GST_N family, Metaxin subfamily, Metaxin 2; a metaxin 1 binding protein identified through a yeast two-hybrid system using metaxin 1 as the bait | Back alignment and domain information |
|---|
| >PF14497 GST_C_3: Glutathione S-transferase, C-terminal domain; PDB: 3AY8_A 2UZ8_B 1V2A_C 2HNL_A 2YV9_B 3H1N_A 3FR6_A 1Q4J_B 1PA3_B 1OKT_B | Back alignment and domain information |
|---|
| >cd03192 GST_C_Sigma_like GST_C family, Class Sigma_like; composed of GSTs belonging to class Sigma and similar proteins, including GSTs from class Mu, Pi, and Alpha | Back alignment and domain information |
|---|
| >TIGR02190 GlrX-dom Glutaredoxin-family domain | Back alignment and domain information |
|---|
| >cd03194 GST_C_3 GST_C family, unknown subfamily 3; composed of uncharacterized proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd00299 GST_C_family Glutathione S-transferase (GST) family, C-terminal alpha helical domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >PRK10638 glutaredoxin 3; Provisional | Back alignment and domain information |
|---|
| >cd03202 GST_C_etherase_LigE GST_C family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor | Back alignment and domain information |
|---|
| >cd03029 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria | Back alignment and domain information |
|---|
| >cd03193 GST_C_Metaxin GST_C family, Metaxin subfamily; composed of metaxins and related proteins | Back alignment and domain information |
|---|
| >cd03078 GST_N_Metaxin1_like GST_N family, Metaxin subfamily, Metaxin 1-like proteins; composed of metaxins 1 and 3, and similar proteins including Tom37 from fungi | Back alignment and domain information |
|---|
| >KOG3028 consensus Translocase of outer mitochondrial membrane complex, subunit TOM37/Metaxin 1 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd03205 GST_C_6 GST_C family, unknown subfamily 6; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions | Back alignment and domain information |
|---|
| >PF14834 GST_C_4: Glutathione S-transferase, C-terminal domain; PDB: 3BBY_A | Back alignment and domain information |
|---|
| >PRK10329 glutaredoxin-like protein; Provisional | Back alignment and domain information |
|---|
| >cd03211 GST_C_Metaxin2 GST_C family, Metaxin subfamily, Metaxin 2; a metaxin 1 binding protein identified through a yeast two-hybrid system using metaxin 1 as the bait | Back alignment and domain information |
|---|
| >cd02066 GRX_family Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >cd03197 GST_C_mPGES2 GST_C family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2 | Back alignment and domain information |
|---|
| >cd02976 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile | Back alignment and domain information |
|---|
| >TIGR02196 GlrX_YruB Glutaredoxin-like protein, YruB-family | Back alignment and domain information |
|---|
| >cd03212 GST_C_Metaxin1_3 GST_C family, Metaxin subfamily, Metaxin 1-like proteins; composed of metaxins 1 and 3, and similar proteins | Back alignment and domain information |
|---|
| >cd03418 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >TIGR02200 GlrX_actino Glutaredoxin-like protein | Back alignment and domain information |
|---|
| >COG0695 GrxC Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02181 GRX_bact Glutaredoxin, GrxC family | Back alignment and domain information |
|---|
| >TIGR02194 GlrX_NrdH Glutaredoxin-like protein NrdH | Back alignment and domain information |
|---|
| >PHA03050 glutaredoxin; Provisional | Back alignment and domain information |
|---|
| >PRK11200 grxA glutaredoxin 1; Provisional | Back alignment and domain information |
|---|
| >TIGR02189 GlrX-like_plant Glutaredoxin-like family | Back alignment and domain information |
|---|
| >PF00462 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors | Back alignment and domain information |
|---|
| >cd03419 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >TIGR02183 GRXA Glutaredoxin, GrxA family | Back alignment and domain information |
|---|
| >TIGR00365 monothiol glutaredoxin, Grx4 family | Back alignment and domain information |
|---|
| >cd03028 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins | Back alignment and domain information |
|---|
| >TIGR02180 GRX_euk Glutaredoxin | Back alignment and domain information |
|---|
| >PF10568 Tom37: Outer mitochondrial membrane transport complex protein; InterPro: IPR019564 Tom37 is one of the outer membrane proteins that make up the TOM complex for guiding cytosolic mitochondrial beta-barrel proteins from the cytosol across the outer mitochondrial membrane into the intramembrane space | Back alignment and domain information |
|---|
| >cd03031 GRX_GRX_like Glutaredoxin (GRX) family, GRX-like domain containing protein subfamily; composed of uncharacterized eukaryotic proteins containing a GRX-like domain having only one conserved cysteine, aligning to the C-terminal cysteine of the CXXC motif of GRXs | Back alignment and domain information |
|---|
| >PRK10824 glutaredoxin-4; Provisional | Back alignment and domain information |
|---|
| >PRK12759 bifunctional gluaredoxin/ribonucleoside-diphosphate reductase subunit beta; Provisional | Back alignment and domain information |
|---|
| >KOG1147 consensus Glutamyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG1752 consensus Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00062 glutaredoxin; Provisional | Back alignment and domain information |
|---|
| >PF04399 Glutaredoxin2_C: Glutaredoxin 2, C terminal domain; InterPro: IPR007494 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors | Back alignment and domain information |
|---|
| >cd02973 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-like family; composed of archaeal and bacterial proteins that show similarity to both TRX and GRX, including the C-terminal TRX-fold subdomain of Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO) | Back alignment and domain information |
|---|
| >cd03036 ArsC_like Arsenate Reductase (ArsC) family, unknown subfamily; uncharacterized proteins containing a CXXC motif with similarity to thioredoxin (TRX)-fold arsenic reductases, ArsC | Back alignment and domain information |
|---|
| >cd02977 ArsC_family Arsenate Reductase (ArsC) family; composed of TRX-fold arsenic reductases and similar proteins including the transcriptional regulator, Spx | Back alignment and domain information |
|---|
| >COG4545 Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK01655 spxA transcriptional regulator Spx; Reviewed | Back alignment and domain information |
|---|
| >cd03032 ArsC_Spx Arsenate Reductase (ArsC) family, Spx subfamily; Spx is a unique RNA polymerase (RNAP)-binding protein present in bacilli and some mollicutes | Back alignment and domain information |
|---|
| >TIGR01617 arsC_related transcriptional regulator, Spx/MgsR family | Back alignment and domain information |
|---|
| >cd03199 GST_C_GRX2 GST_C family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E | Back alignment and domain information |
|---|
| >cd03033 ArsC_15kD Arsenate Reductase (ArsC) family, 15kD protein subfamily; composed of proteins of unknown function with similarity to thioredoxin-fold arsenic reductases, ArsC | Back alignment and domain information |
|---|
| >cd03035 ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb subfamily; Yffb is an uncharacterized bacterial protein encoded by the yffb gene, related to the thioredoxin-fold arsenic reductases, ArsC | Back alignment and domain information |
|---|
| >PRK13344 spxA transcriptional regulator Spx; Reviewed | Back alignment and domain information |
|---|
| >PRK12559 transcriptional regulator Spx; Provisional | Back alignment and domain information |
|---|
| >PRK10026 arsenate reductase; Provisional | Back alignment and domain information |
|---|
| >PF05768 DUF836: Glutaredoxin-like domain (DUF836); InterPro: IPR008554 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors | Back alignment and domain information |
|---|
| >cd03030 GRX_SH3BGR Glutaredoxin (GRX) family, SH3BGR (SH3 domain binding glutamic acid-rich protein) subfamily; a recently-identified subfamily composed of SH3BGR and similar proteins possessing significant sequence similarity to GRX, but without a redox active CXXC motif | Back alignment and domain information |
|---|
| >COG0278 Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01616 nitro_assoc nitrogenase-associated protein | Back alignment and domain information |
|---|
| >TIGR00412 redox_disulf_2 small redox-active disulfide protein 2 | Back alignment and domain information |
|---|
| >cd03034 ArsC_ArsC Arsenate Reductase (ArsC) family, ArsC subfamily; arsenic reductases similar to that encoded by arsC on the R733 plasmid of Escherichia coli | Back alignment and domain information |
|---|
| >COG1393 ArsC Arsenate reductase and related proteins, glutaredoxin family [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF11287 DUF3088: Protein of unknown function (DUF3088); InterPro: IPR021439 This family of proteins with unknown function appears to be restricted to Proteobacteria | Back alignment and domain information |
|---|
| >cd03026 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) subfamily, C-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which then reduces hydrogen peroxide and organic hydroperoxides | Back alignment and domain information |
|---|
| >TIGR00014 arsC arsenate reductase (glutaredoxin) | Back alignment and domain information |
|---|
| >TIGR00411 redox_disulf_1 small redox-active disulfide protein 1 | Back alignment and domain information |
|---|
| >PRK10853 putative reductase; Provisional | Back alignment and domain information |
|---|
| >cd01659 TRX_superfamily Thioredoxin (TRX) superfamily; a large, diverse group of proteins containing a TRX-fold | Back alignment and domain information |
|---|
| >PF11801 Tom37_C: Tom37 C-terminal domain; InterPro: IPR019564 Tom37 is one of the outer membrane proteins that make up the TOM complex for guiding cytosolic mitochondrial beta-barrel proteins from the cytosol across the outer mitochondrial membrane into the intramembrane space | Back alignment and domain information |
|---|
| >PHA02125 thioredoxin-like protein | Back alignment and domain information |
|---|
| >PF13192 Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZYN_A 1HYU_A 1ILO_A 1J08_F 2YWM_B 2AYT_B 2HLS_B 1A8L_A 2K8S_B | Back alignment and domain information |
|---|
| >PF03960 ArsC: ArsC family; InterPro: IPR006660 Several bacterial taxon have a chromosomal resistance system, encoded by the ars operon, for the detoxification of arsenate, arsenite, and antimonite [] | Back alignment and domain information |
|---|
| >PF04908 SH3BGR: SH3-binding, glutamic acid-rich protein; InterPro: IPR006993 This family of proteins, which contains SH3BGRL3, is functionally uncharacterised | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 222 | ||||
| 4j2f_A | 223 | Crystal Structure Of A Glutathione Transferase Fami | 2e-57 | ||
| 2vo4_A | 219 | Glutathione Transferase From Glycine Max Length = 2 | 4e-46 | ||
| 1gwc_A | 230 | The Structure Of A Tau Class Glutathione S-Transfer | 4e-40 | ||
| 1oyj_A | 231 | Crystal Structure Solution Of Rice Gst1 (Osgstu1) I | 3e-23 | ||
| 3vln_A | 241 | Human Glutathione Transferase O1-1 C32s Mutant In C | 2e-19 | ||
| 1eem_A | 241 | Glutathione Transferase From Homo Sapiens Length = | 5e-19 | ||
| 3lfl_A | 240 | Crystal Structure Of Human Glutathione Transferase | 5e-18 | ||
| 3qag_A | 239 | Human Glutathione Transferase O2 With Glutathione - | 3e-12 | ||
| 3tot_A | 226 | Crystal Structure Of Glutathione Transferase (Targe | 9e-11 | ||
| 4hoj_A | 210 | Crystal Structure Of Glutathione Transferase Homolo | 1e-10 | ||
| 1e6b_A | 221 | Crystal Structure Of A Zeta Class Glutathione S-Tra | 3e-10 | ||
| 3lyp_A | 215 | Structure Of Stringent Starvation Protein A Homolog | 4e-09 | ||
| 1fw1_A | 216 | Glutathione Transferase ZetaMALEYLACETOACETATE ISOM | 2e-08 | ||
| 3niv_A | 222 | The Crystal Structure Of Glutathione S-Transferase | 3e-08 | ||
| 1yy7_A | 213 | Crystal Structure Of Stringent Starvation Protein A | 3e-08 | ||
| 3lyk_A | 216 | Structure Of Stringent Starvation Protein A Homolog | 2e-07 | ||
| 4glt_A | 225 | Crystal Structure Of Glutathione S-Transferase Mfla | 2e-07 | ||
| 3ubk_A | 242 | Crystal Structure Of Glutathione Transferase (Targe | 2e-07 | ||
| 2cz2_A | 223 | Crystal Structure Of Glutathione Transferase Zeta 1 | 2e-07 | ||
| 3rbt_A | 246 | Crystal Structure Of Glutathione S-Transferase Omeg | 2e-07 | ||
| 3cbu_A | 214 | Crystal Structure Of A Putative Glutathione S-Trans | 4e-06 | ||
| 1jlv_A | 209 | Anopheles Dirus Species B Glutathione S-transferase | 4e-06 | ||
| 3mdk_A | 217 | Structure Of Stringent Starvation Protein A (Sspa) | 6e-06 | ||
| 3r2q_A | 202 | Crystal Structure Analysis Of Yibf From E. Coli Len | 6e-06 | ||
| 3lxz_A | 229 | Structure Of Probable Glutathione S-Transferase(Pp0 | 1e-05 | ||
| 4igj_A | 242 | Crystal Structure Of Maleylacetoacetate Isomerase F | 2e-05 | ||
| 1pn9_A | 209 | Crystal Structure Of An Insect Delta-class Glutathi | 5e-05 | ||
| 2jl4_A | 213 | Holo Structure Of Maleyl Pyruvate Isomerase, A Bact | 6e-05 | ||
| 2v6k_A | 214 | Structure Of Maleyl Pyruvate Isomerase, A Bacterial | 6e-05 | ||
| 3m8n_A | 225 | Crystal Structure Of A Possible Gutathione S-Tranfe | 1e-04 | ||
| 3ein_A | 209 | Delta Class Gst Length = 209 | 2e-04 | ||
| 4g10_A | 265 | Ligg From Sphingobium Sp. Syk-6 Is Related To The G | 2e-04 | ||
| 1v2a_A | 210 | Glutathione S-transferase 1-6 From Anopheles Dirus | 4e-04 | ||
| 3lxt_A | 213 | Crystal Structure Of Glutathione S Transferase From | 4e-04 |
| >pdb|4J2F|A Chain A, Crystal Structure Of A Glutathione Transferase Family Member From Ricinus Communis, Target Efi-501866 Length = 223 | Back alignment and structure |
|
| >pdb|2VO4|A Chain A, Glutathione Transferase From Glycine Max Length = 219 | Back alignment and structure |
| >pdb|1GWC|A Chain A, The Structure Of A Tau Class Glutathione S-Transferase From Wheat, Active In Herbicide Detoxification Length = 230 | Back alignment and structure |
| >pdb|1OYJ|A Chain A, Crystal Structure Solution Of Rice Gst1 (Osgstu1) In Complex With Glutathione. Length = 231 | Back alignment and structure |
| >pdb|3VLN|A Chain A, Human Glutathione Transferase O1-1 C32s Mutant In Complex With Ascorbic Acid Length = 241 | Back alignment and structure |
| >pdb|1EEM|A Chain A, Glutathione Transferase From Homo Sapiens Length = 241 | Back alignment and structure |
| >pdb|3LFL|A Chain A, Crystal Structure Of Human Glutathione Transferase Omega 1, Delta 155 Length = 240 | Back alignment and structure |
| >pdb|3QAG|A Chain A, Human Glutathione Transferase O2 With Glutathione -New Crystal Form Length = 239 | Back alignment and structure |
| >pdb|3TOT|A Chain A, Crystal Structure Of Glutathione Transferase (Target Efi-501058) From Ralstonia Solanacearum Gmi1000 Length = 226 | Back alignment and structure |
| >pdb|4HOJ|A Chain A, Crystal Structure Of Glutathione Transferase Homolog From Neisseria Gonorrhoeae, Target Efi-501841, With Bound Glutathione Length = 210 | Back alignment and structure |
| >pdb|1E6B|A Chain A, Crystal Structure Of A Zeta Class Glutathione S-Transferase From Arabidopsis Thaliana Length = 221 | Back alignment and structure |
| >pdb|3LYP|A Chain A, Structure Of Stringent Starvation Protein A Homolog From Pseudomonas Fluorescens Length = 215 | Back alignment and structure |
| >pdb|1FW1|A Chain A, Glutathione Transferase ZetaMALEYLACETOACETATE ISOMERASE Length = 216 | Back alignment and structure |
| >pdb|3NIV|A Chain A, The Crystal Structure Of Glutathione S-Transferase From Legionella Pneumophila Length = 222 | Back alignment and structure |
| >pdb|1YY7|A Chain A, Crystal Structure Of Stringent Starvation Protein A (Sspa), An Rna Polymerase-Associated Transcription Factor Length = 213 | Back alignment and structure |
| >pdb|3LYK|A Chain A, Structure Of Stringent Starvation Protein A Homolog From Haemophilus Influenzae Length = 216 | Back alignment and structure |
| >pdb|4GLT|A Chain A, Crystal Structure Of Glutathione S-Transferase Mfla_2116 (Target Efi- 507160) From Methylobacillus Flagellatus Kt With Gsh Bound Length = 225 | Back alignment and structure |
| >pdb|3UBK|A Chain A, Crystal Structure Of Glutathione Transferase (Target Efi-501770) From Leptospira Interrogans Length = 242 | Back alignment and structure |
| >pdb|2CZ2|A Chain A, Crystal Structure Of Glutathione Transferase Zeta 1-1 (Maleylacetoacetate Isomerase) From Mus Musculus (Form-1 Crystal) Length = 223 | Back alignment and structure |
| >pdb|3RBT|A Chain A, Crystal Structure Of Glutathione S-Transferase Omega 3 From The Silkworm Bombyx Mori Length = 246 | Back alignment and structure |
| >pdb|3CBU|A Chain A, Crystal Structure Of A Putative Glutathione S-Transferase (Reut_a1011) From Ralstonia Eutropha Jmp134 At 2.05 A Resolution Length = 214 | Back alignment and structure |
| >pdb|1JLV|A Chain A, Anopheles Dirus Species B Glutathione S-transferases 1-3 Length = 209 | Back alignment and structure |
| >pdb|3MDK|A Chain A, Structure Of Stringent Starvation Protein A (Sspa) From Pseudomonas Putida Length = 217 | Back alignment and structure |
| >pdb|3R2Q|A Chain A, Crystal Structure Analysis Of Yibf From E. Coli Length = 202 | Back alignment and structure |
| >pdb|3LXZ|A Chain A, Structure Of Probable Glutathione S-Transferase(Pp0183) From Pseudomonas Putida Length = 229 | Back alignment and structure |
| >pdb|4IGJ|A Chain A, Crystal Structure Of Maleylacetoacetate Isomerase From Anaeromyxobacter Dehalogenans 2cp-1, Target Efi-507175 Length = 242 | Back alignment and structure |
| >pdb|1PN9|A Chain A, Crystal Structure Of An Insect Delta-class Glutathione S- Transferase From A Ddt-resistant Strain Of The Malaria Vector Anopheles Gambiae Length = 209 | Back alignment and structure |
| >pdb|2JL4|A Chain A, Holo Structure Of Maleyl Pyruvate Isomerase, A Bacterial Glutathione-S-Transferase In Zeta Class Length = 213 | Back alignment and structure |
| >pdb|2V6K|A Chain A, Structure Of Maleyl Pyruvate Isomerase, A Bacterial Glutathione-s-transferase In Zeta Class, In Complex With Substrate Analogue Dicarboxyethyl Glutathione Length = 214 | Back alignment and structure |
| >pdb|3M8N|A Chain A, Crystal Structure Of A Possible Gutathione S-Tranferase From Rhodopseudomonas Palustris Length = 225 | Back alignment and structure |
| >pdb|3EIN|A Chain A, Delta Class Gst Length = 209 | Back alignment and structure |
| >pdb|4G10|A Chain A, Ligg From Sphingobium Sp. Syk-6 Is Related To The Glutathione Transferase Omega Class Length = 265 | Back alignment and structure |
| >pdb|1V2A|A Chain A, Glutathione S-transferase 1-6 From Anopheles Dirus Species B Length = 210 | Back alignment and structure |
| >pdb|3LXT|A Chain A, Crystal Structure Of Glutathione S Transferase From Pseudomonas Fluorescens Length = 213 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 222 | |||
| 1gwc_A | 230 | Glutathione S-transferase TSI-1; herbicide detoxif | 6e-94 | |
| 2vo4_A | 219 | 2,4-D inducible glutathione S-transferase; herbici | 2e-93 | |
| 1yy7_A | 213 | SSPA, stringent starvation protein A; GST fold, tr | 8e-86 | |
| 3rbt_A | 246 | Glutathione transferase O1; glutathione S-transfer | 3e-82 | |
| 3lyk_A | 216 | Stringent starvation protein A homolog; structural | 4e-82 | |
| 3vln_A | 241 | GSTO-1, glutathione S-transferase omega-1; GST fol | 6e-82 | |
| 4dej_A | 231 | Glutathione S-transferase related protein; transfe | 1e-81 | |
| 1oyj_A | 231 | Glutathione S-transferase; herbicide detoxificatio | 2e-80 | |
| 3lyp_A | 215 | Stringent starvation protein A; structural genomic | 1e-79 | |
| 3q18_A | 239 | GSTO-2, glutathione S-transferase omega-2; glutath | 2e-78 | |
| 3niv_A | 222 | Glutathione S-transferase; structural genomics, PS | 7e-73 | |
| 3tou_A | 226 | Glutathione S-transferase protein; GSH binding sit | 1e-70 | |
| 4ags_A | 471 | Thiol-dependent reductase 1; transferase, leishman | 5e-70 | |
| 4ags_A | 471 | Thiol-dependent reductase 1; transferase, leishman | 6e-69 | |
| 2cz2_A | 223 | Maleylacetoacetate isomerase; structural genomics, | 2e-69 | |
| 3lxz_A | 229 | Glutathione S-transferase family protein; structur | 1e-67 | |
| 3ubk_A | 242 | Glutathione transferase; GSH binding; 1.95A {Lepto | 8e-66 | |
| 3r2q_A | 202 | Uncharacterized GST-like protein YIBF; transferase | 4e-64 | |
| 3cbu_A | 214 | Probable GST-related protein; thioredoxin fold, GS | 3e-63 | |
| 3m0f_A | 213 | Uncharacterized protein GST_N; PSI-2, NYSGXRC, glu | 4e-60 | |
| 2v6k_A | 214 | Maleylpyruvate isomerase; glutathione-S-transferas | 3e-54 | |
| 1e6b_A | 221 | Glutathione S-transferase; 1.65A {Arabidopsis thal | 1e-48 | |
| 1k0m_A | 241 | CLIC1, NCC27, chloride intracellular channel prote | 1e-43 | |
| 2ahe_A | 267 | Chloride intracellular channel protein 4; glutathi | 1e-42 | |
| 3fy7_A | 250 | Chloride intracellular channel protein 3; GST, glu | 3e-42 | |
| 2r4v_A | 247 | XAP121, chloride intracellular channel protein 2; | 4e-42 | |
| 3qav_A | 243 | RHO-class glutathione S-transferase; cytosol; 2.10 | 3e-34 | |
| 3ic8_A | 310 | Uncharacterized GST-like proteinprotein; glutathio | 4e-32 | |
| 3ibh_A | 233 | GST-II, saccharomyces cerevisiae GTT2; glutathione | 1e-31 | |
| 3n5o_A | 235 | Glutathione transferase; seattle structural genomi | 9e-31 | |
| 2yv7_A | 260 | CG10997-PA, LD46306P, CLIC; dmclic, chloride ION c | 1e-30 | |
| 3bby_A | 215 | Uncharacterized GST-like protein YFCF; NP_416804.1 | 2e-29 | |
| 1gnw_A | 211 | Glutathione S-transferase; herbicide detoxificatio | 4e-28 | |
| 1axd_A | 209 | Glutathione S-transferase I; transferase, herbicid | 1e-25 | |
| 2c3n_A | 247 | Glutathione S-transferase theta 1; glutathione tra | 3e-24 | |
| 1ljr_A | 244 | HGST T2-2, glutathione S-transferase; HET: GSH; 3. | 7e-24 | |
| 1aw9_A | 216 | Glutathione S-transferase III; herbicide detoxific | 1e-23 | |
| 2imi_A | 221 | Epsilon-class glutathione S-transferase; HET: GSH; | 4e-23 | |
| 1v2a_A | 210 | Glutathione transferase GST1-6; glutathione S-tran | 1e-22 | |
| 3ay8_A | 216 | Glutathione S-transferase; GST fold, GST binding, | 2e-22 | |
| 2dsa_A | 203 | Glutathione S-transferase; HET: GSH HPX; 2.10A {Bu | 4e-22 | |
| 3ir4_A | 218 | Glutaredoxin 2; glutathione, IDP00895, structural | 6e-22 | |
| 1r5a_A | 218 | Glutathione transferase; glutathione S-transferase | 2e-21 | |
| 1n2a_A | 201 | Glutathione S-transferase; HET: GTS; 1.90A {Escher | 8e-20 | |
| 1pn9_A | 209 | GST class-delta, glutathione S-transferase 1-6; pr | 2e-19 | |
| 1nhy_A | 219 | EF-1-gamma 1, elongation factor 1-gamma 1; protein | 2e-19 | |
| 3lsz_A | 225 | Glutathione S-transferase; xenobiotic, biodegradat | 5e-19 | |
| 3ein_A | 209 | GST class-theta, glutathione S-transferase 1-1; de | 2e-18 | |
| 1pmt_A | 203 | PMGST, GST B1-1, glutathione transferase; glutathi | 7e-18 | |
| 2pvq_A | 201 | Glutathione S-transferase; xenobiotics detoxificat | 8e-18 | |
| 4g9h_A | 211 | Glutathione S-transferase; GST, enzyme function in | 4e-17 | |
| 3m8n_A | 225 | Possible glutathione S-transferase; PSI-II, struct | 1e-16 | |
| 1f2e_A | 201 | Glutathione S-transferase; GST complexed with glut | 1e-16 | |
| 2ycd_A | 230 | Glutathione S-transferase; SOIL bacteria, herbicid | 2e-16 | |
| 3uar_A | 227 | Glutathione S-transferase; GSH binding site; HET: | 2e-16 | |
| 1z9h_A | 290 | Membrane-associated prostaglandin E synthase-2; me | 7e-16 | |
| 3m3m_A | 210 | Glutathione S-transferase; PSI-II, structural geno | 1e-15 | |
| 1vf1_A | 229 | Glutathione S-transferase 3; detoxification; HET: | 1e-15 | |
| 3f6d_A | 219 | Adgstd4-4, glutathione transferase GST1-4; HET: GT | 2e-15 | |
| 1k3y_A | 221 | GSTA1-1, glutathione S-transferase A1; S-hexyl glu | 3e-15 | |
| 1b48_A | 221 | GST, mgsta4-4, protein (glutathione S-transferase) | 3e-15 | |
| 2uz8_A | 174 | Eukaryotic translation elongation factor 1 epsilon | 4e-15 | |
| 2x64_A | 207 | Glutathione-S-transferase; detoxification enzyme; | 5e-15 | |
| 1yq1_A | 208 | Glutathione S-transferase; nematoda, structural ge | 5e-15 | |
| 3ik7_A | 222 | Glutathione S-transferase A4; human GST A4-4, enzy | 5e-15 | |
| 2cvd_A | 198 | Glutathione-requiring prostaglandin D synthase; gl | 1e-14 | |
| 3iso_A | 218 | Putative glutathione transferase; GST; HET: GSH; 1 | 3e-14 | |
| 4exj_A | 238 | Uncharacterized protein; transferase-like protein, | 5e-14 | |
| 2a2r_A | 210 | Glutathione S-transferase P; detoxification, nitri | 1e-13 | |
| 1b8x_A | 280 | Protein (AML-1B); nuclear matrix targeting signal | 1e-13 | |
| 2fhe_A | 216 | GST, glutathione S-transferase; transferase-substr | 2e-13 | |
| 2fno_A | 248 | AGR_PAT_752P; thioredoxin fold, GST C-terminal dom | 2e-13 | |
| 2on7_A | 206 | Nagst-1, Na glutathione S-transferase 1; hookworm; | 2e-13 | |
| 2ws2_A | 204 | NU-class GST, glutathione S-transferase; parasite, | 2e-13 | |
| 2on5_A | 206 | Nagst-2, Na glutathione S-transferase 2; hookworm; | 2e-13 | |
| 2gsq_A | 202 | Squid GST, glutathione S-transferase; squid digest | 2e-13 | |
| 1dug_A | 234 | Chimera of glutathione S-transferase-synthetic lin | 3e-13 | |
| 1zl9_A | 207 | GST class-sigma, glutathione S-transferase 5; glut | 3e-13 | |
| 1tu7_A | 208 | Glutathione S-transferase 2; HET: GSH; 1.50A {Onch | 3e-13 | |
| 1gsu_A | 219 | GST, CGSTM1-1, class-MU glutathione S-transferase; | 4e-13 | |
| 1bg5_A | 254 | MAB, fusion protein of alpha-Na,K-ATPase with glut | 4e-13 | |
| 3gtu_B | 224 | Glutathione S-transferase; conjugation, detoxifica | 4e-13 | |
| 1okt_A | 211 | Glutathione S-transferase; GST; 1.9A {Plasmodium f | 6e-13 | |
| 2yv9_A | 291 | Chloride intracellular channel EXC-4; chloride ION | 1e-12 | |
| 1tw9_A | 206 | Glutathione S-transferase 2; 1.71A {Heligmosomoide | 2e-12 | |
| 2c4j_A | 218 | Glutathione S-transferase MU 2; glutathione transf | 4e-12 | |
| 1m0u_A | 249 | GST2 gene product; flight muscle protein, sigma, t | 6e-12 | |
| 3h1n_A | 252 | Probable glutathione S-transferase; APC84167, bord | 9e-12 | |
| 2hnl_A | 225 | Glutathione S-transferase 1; prostaglandin synthas | 1e-11 | |
| 2wb9_A | 211 | Glutathione transferase sigma class; thioredoxin f | 2e-10 | |
| 1oe8_A | 211 | Glutathione S-transferase; schistosomiasis, detoxi | 3e-10 | |
| 3c8e_A | 288 | YGHU, glutathione S-transferase homologue; glutath | 1e-06 | |
| 1k0d_A | 260 | URE2 protein; nitrate assimilation, structural gen | 8e-06 | |
| 3gx0_A | 215 | GST-like protein YFCG; transferase, glutathione, g | 2e-04 |
| >1gwc_A Glutathione S-transferase TSI-1; herbicide detoxification, plant, TAU class; HET: GTX; 2.25A {Aegilops tauschii} SCOP: a.45.1.1 c.47.1.5 Length = 230 | Back alignment and structure |
|---|
Score = 273 bits (700), Expect = 6e-94
Identities = 104/229 (45%), Positives = 137/229 (59%), Gaps = 9/229 (3%)
Query: 1 MA-EESVKLLGYWASPFALRVKWALKLKGVHYEYVEENLPNKSPLLLRYNPVYKKIPVLV 59
MA + +KLLG W SPF RVK AL LKG+ YE VEE+L KS LLL+ NPV+KKIPVL+
Sbjct: 1 MAGGDDLKLLGAWPSPFVTRVKLALALKGLSYEDVEEDLYKKSELLLKSNPVHKKIPVLI 60
Query: 60 HNGKPLAESLLIIEYIDEAWKQN--PLLPDDPYERANARFWAKFFDEKCVPEVMGAFASK 117
HNG P+ ES++I++YIDE + LLP DPYERA ARFW + D+K V K
Sbjct: 61 HNGAPVCESMIILQYIDEVFASTGPSLLPADPYERAIARFWVAYVDDKLVAPWRQWLRGK 120
Query: 118 -GEEQEKAAK-ARENLKMLERALE----GKPFFGGDKIGFLDIAVGWIGIWGRIVEEIAG 171
EE+ + K A + +LE AL G FFGGD +G +D+A+G + W ++ E ++G
Sbjct: 121 TEEEKSEGKKQAFAAVGVLEGALRECSKGGGFFGGDGVGLVDVALGGVLSWMKVTEALSG 180
Query: 172 VSLIDAETMPLLTAWLNNFLEVPVIKACIPSWHELLEHNKGFHKILTGS 220
+ DA PLL AW+ F+E+ KA +P LLE K S
Sbjct: 181 DKIFDAAKTPLLAAWVERFIELDAAKAALPDVGRLLEFAKAREAAAAAS 229
|
| >2vo4_A 2,4-D inducible glutathione S-transferase; herbicide, TAU class GST, S-(P-nitrobenzyl- glutathione); HET: GTB 4NM; 1.75A {Glycine max} PDB: 3fhs_A* Length = 219 | Back alignment and structure |
|---|
| >1yy7_A SSPA, stringent starvation protein A; GST fold, transcription; HET: CIT; 2.02A {Yersinia pestis} Length = 213 | Back alignment and structure |
|---|
| >3rbt_A Glutathione transferase O1; glutathione S-transferase omega3; 2.20A {Bombyx mori} Length = 246 | Back alignment and structure |
|---|
| >3lyk_A Stringent starvation protein A homolog; structural genomics, GST-superfamily, SSPA, PSI-2, protein structure initiative; 2.10A {Haemophilus influenzae} Length = 216 | Back alignment and structure |
|---|
| >3vln_A GSTO-1, glutathione S-transferase omega-1; GST fold, reductase; HET: ASC; 1.70A {Homo sapiens} PDB: 1eem_A* 3lfl_A* Length = 241 | Back alignment and structure |
|---|
| >4dej_A Glutathione S-transferase related protein; transferase-like protein, transcription regulation; 2.90A {Idiomarina loihiensis} Length = 231 | Back alignment and structure |
|---|
| >1oyj_A Glutathione S-transferase; herbicide detoxification; HET: GSH; 1.95A {Oryza sativa} SCOP: a.45.1.1 c.47.1.5 Length = 231 | Back alignment and structure |
|---|
| >3lyp_A Stringent starvation protein A; structural genomics, GST-superfamily, SSPA, stringent starva protein A homolog, PSI-2; 1.60A {Pseudomonas fluorescens} PDB: 3mdk_A Length = 215 | Back alignment and structure |
|---|
| >3q18_A GSTO-2, glutathione S-transferase omega-2; glutathione transferase, dehydroascorbate reductase, reductase; 1.70A {Homo sapiens} PDB: 3q19_A* 3qag_A* Length = 239 | Back alignment and structure |
|---|
| >3niv_A Glutathione S-transferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.30A {Legionella pneumophila subsp} Length = 222 | Back alignment and structure |
|---|
| >3tou_A Glutathione S-transferase protein; GSH binding site, GSH; HET: GSH; 1.75A {Ralstonia solanacearum} PDB: 3tot_A* Length = 226 | Back alignment and structure |
|---|
| >4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Length = 471 | Back alignment and structure |
|---|
| >4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Length = 471 | Back alignment and structure |
|---|
| >2cz2_A Maleylacetoacetate isomerase; structural genomics, GST, GSTZ1-1, NPPSFA, national project protein structural and functional analyses; HET: GSH; 1.40A {Mus musculus} PDB: 2cz3_A 1fw1_A* Length = 223 | Back alignment and structure |
|---|
| >3lxz_A Glutathione S-transferase family protein; structural genomics, PP0183, PSI-2, protein structure initiative; 1.76A {Pseudomonas putida} PDB: 3pr8_A* Length = 229 | Back alignment and structure |
|---|
| >3ubk_A Glutathione transferase; GSH binding; 1.95A {Leptospira interrogans serovar lai} PDB: 3ubl_A* Length = 242 | Back alignment and structure |
|---|
| >3r2q_A Uncharacterized GST-like protein YIBF; transferase, glutathione; HET: GSH; 1.05A {Escherichia coli} Length = 202 | Back alignment and structure |
|---|
| >3cbu_A Probable GST-related protein; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics; 2.05A {Ralstonia eutropha} Length = 214 | Back alignment and structure |
|---|
| >3m0f_A Uncharacterized protein GST_N; PSI-2, NYSGXRC, glutathione, structural genomics, protein structure initiative; HET: GSH; 1.60A {Pseudomonas fluorescens} PDB: 3lxt_A* Length = 213 | Back alignment and structure |
|---|
| >2v6k_A Maleylpyruvate isomerase; glutathione-S-transferase, GST, plasmid, bacterial, biodegradation, fumaryl pyruvate; HET: TGG; 1.3A {Ralstonia SP} PDB: 2jl4_A* Length = 214 | Back alignment and structure |
|---|
| >1e6b_A Glutathione S-transferase; 1.65A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 Length = 221 | Back alignment and structure |
|---|
| >1k0m_A CLIC1, NCC27, chloride intracellular channel protein 1; glutathione-S-tranferase superfamily, chloride ION channel, metal transport; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1k0n_A* 1k0o_A 1rk4_A 3uvh_A 3o3t_A 3p90_A 3qr6_A 3p8w_A 3tgz_A 3ma4_A 3swl_A Length = 241 | Back alignment and structure |
|---|
| >2ahe_A Chloride intracellular channel protein 4; glutathione-S-transferase superfamily, CLIC4, NCC27, chloride ION channel, metal transport; 1.80A {Homo sapiens} PDB: 2d2z_A Length = 267 | Back alignment and structure |
|---|
| >3fy7_A Chloride intracellular channel protein 3; GST, glutathione, CLIC, chloride channel, ION transport, ionic channel, nucleus, transport, gated channel; 1.95A {Homo sapiens} PDB: 3kjy_A Length = 250 | Back alignment and structure |
|---|
| >2r4v_A XAP121, chloride intracellular channel protein 2; chloride intracellular channels, CLIC2, pore-forming protein ryanodine receptor, chloride channel; HET: GSH; 1.85A {Homo sapiens} PDB: 2r5g_A 2per_A* Length = 247 | Back alignment and structure |
|---|
| >3qav_A RHO-class glutathione S-transferase; cytosol; 2.10A {Laternula elliptica} PDB: 3qaw_A* Length = 243 | Back alignment and structure |
|---|
| >3ic8_A Uncharacterized GST-like proteinprotein; glutathione, transferase, PSI, MCSG, structural genomics; 2.40A {Pseudomonas syringae PV} Length = 310 | Back alignment and structure |
|---|
| >3ibh_A GST-II, saccharomyces cerevisiae GTT2; glutathione S-transferase, transferase; HET: GSH; 2.10A {Saccharomyces cerevisiae} PDB: 3erf_A* 3erg_A* Length = 233 | Back alignment and structure |
|---|
| >3n5o_A Glutathione transferase; seattle structural genomics center for infectious disease, S GST, pathogenic fungus, coccidioidomycosis; HET: GSH; 1.85A {Coccidioides immitis} PDB: 3lg6_A* Length = 235 | Back alignment and structure |
|---|
| >2yv7_A CG10997-PA, LD46306P, CLIC; dmclic, chloride ION channel, GST fold, metal transport; 1.70A {Drosophila melanogaster} Length = 260 | Back alignment and structure |
|---|
| >3bby_A Uncharacterized GST-like protein YFCF; NP_416804.1, glutathione S-transferase, N-terminal domain, S genomics; 1.85A {Escherichia coli} Length = 215 | Back alignment and structure |
|---|
| >1gnw_A Glutathione S-transferase; herbicide detoxification; HET: GTX; 2.20A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 PDB: 1bx9_A* Length = 211 | Back alignment and structure |
|---|
| >1axd_A Glutathione S-transferase I; transferase, herbicide detoxification, transferase-transfera inhibitor complex; HET: GGL CYW; 2.50A {Zea mays} SCOP: a.45.1.1 c.47.1.5 PDB: 1bye_A* Length = 209 | Back alignment and structure |
|---|
| >2c3n_A Glutathione S-transferase theta 1; glutathione transferase, polymorphism; 1.5A {Homo sapiens} PDB: 2c3q_A* 2c3t_A Length = 247 | Back alignment and structure |
|---|
| >1ljr_A HGST T2-2, glutathione S-transferase; HET: GSH; 3.20A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 2ljr_A 3ljr_A* Length = 244 | Back alignment and structure |
|---|
| >1aw9_A Glutathione S-transferase III; herbicide detoxification; 2.20A {Zea mays} SCOP: a.45.1.1 c.47.1.5 Length = 216 | Back alignment and structure |
|---|
| >2imi_A Epsilon-class glutathione S-transferase; HET: GSH; 1.40A {Anopheles gambiae} PDB: 2il3_A* 2imk_A* Length = 221 | Back alignment and structure |
|---|
| >1v2a_A Glutathione transferase GST1-6; glutathione S-transferase, detoxification, xenobiotics; HET: GTS; 2.15A {Anopheles dirus} SCOP: a.45.1.1 c.47.1.5 Length = 210 | Back alignment and structure |
|---|
| >3ay8_A Glutathione S-transferase; GST fold, GST binding, cytosolic; 2.10A {Bombyx mori} Length = 216 | Back alignment and structure |
|---|
| >2dsa_A Glutathione S-transferase; HET: GSH HPX; 2.10A {Burkholderia xenovorans} PDB: 2gdr_A* Length = 203 | Back alignment and structure |
|---|
| >3ir4_A Glutaredoxin 2; glutathione, IDP00895, structural genomics, for structural genomics of infectious diseases, csgid, oxidoreductase; HET: MSE GSH; 1.20A {Salmonella enterica subsp} PDB: 1g7o_A Length = 218 | Back alignment and structure |
|---|
| >1r5a_A Glutathione transferase; glutathione S-transferase, GST, GSH, mosquito, detoxification, xenobiotics; HET: GTS; 2.50A {Anopheles cracens} SCOP: a.45.1.1 c.47.1.5 Length = 218 | Back alignment and structure |
|---|
| >1n2a_A Glutathione S-transferase; HET: GTS; 1.90A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 PDB: 1a0f_A* Length = 201 | Back alignment and structure |
|---|
| >1pn9_A GST class-delta, glutathione S-transferase 1-6; protein inhibitor complex; HET: GTX; 2.00A {Anopheles gambiae} SCOP: a.45.1.1 c.47.1.5 Length = 209 | Back alignment and structure |
|---|
| >1nhy_A EF-1-gamma 1, elongation factor 1-gamma 1; protein synthesis, GST-like, translation; 3.00A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 Length = 219 | Back alignment and structure |
|---|
| >3lsz_A Glutathione S-transferase; xenobiotic, biodegradative metabolism, PSI2, NYSGXRC, structural genomics, protein structure initiative; HET: GSH; 1.70A {Rhodobacter sphaeroides} Length = 225 | Back alignment and structure |
|---|
| >3ein_A GST class-theta, glutathione S-transferase 1-1; delta-class GST; HET: GSH; 1.13A {Drosophila melanogaster} PDB: 3mak_A* 3f6f_A 3gh6_A* 1jlv_A* Length = 209 | Back alignment and structure |
|---|
| >1pmt_A PMGST, GST B1-1, glutathione transferase; glutathione-conjugating, A putative oxidoreduct; HET: GSH; 2.50A {Proteus mirabilis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pmt_A* Length = 203 | Back alignment and structure |
|---|
| >2pvq_A Glutathione S-transferase; xenobiotics detoxification, H-site; HET: GSH; 1.80A {Ochrobactrum anthropi} PDB: 2nto_A* Length = 201 | Back alignment and structure |
|---|
| >4g9h_A Glutathione S-transferase; GST, enzyme function initiative, structural genomics; HET: GSH; 2.10A {Yersinia pestis} Length = 211 | Back alignment and structure |
|---|
| >3m8n_A Possible glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, nysgxrc; 2.04A {Rhodopseudomonas palustris} Length = 225 | Back alignment and structure |
|---|
| >1f2e_A Glutathione S-transferase; GST complexed with glutathione, thioredoxin superfamily fold transferase; HET: GSH; 2.30A {Sphingomonas paucimobilis} SCOP: a.45.1.1 c.47.1.5 Length = 201 | Back alignment and structure |
|---|
| >2ycd_A Glutathione S-transferase; SOIL bacteria, herbicide detoxification; HET: GTB; 1.40A {Agrobacterium tumefaciens} PDB: 3lq7_A Length = 230 | Back alignment and structure |
|---|
| >3uar_A Glutathione S-transferase; GSH binding site; HET: GSH; 2.60A {Methylococcus capsulatus} PDB: 3uap_A* Length = 227 | Back alignment and structure |
|---|
| >1z9h_A Membrane-associated prostaglandin E synthase-2; membran associated protein, indomethacin, isomerase; HET: IMN; 2.60A {Macaca fascicularis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pbj_A* Length = 290 | Back alignment and structure |
|---|
| >3m3m_A Glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, N SGX research center for structural genomics; HET: GSH; 1.75A {Pseudomonas fluorescens} Length = 210 | Back alignment and structure |
|---|
| >1vf1_A Glutathione S-transferase 3; detoxification; HET: GSH; 1.77A {Gallus gallus} PDB: 1vf2_A* 1vf3_A* 1vf4_A Length = 229 | Back alignment and structure |
|---|
| >3f6d_A Adgstd4-4, glutathione transferase GST1-4; HET: GTX; 1.70A {Anopheles dirus} PDB: 3f63_A* 1jlw_A* 3g7i_A* 3g7j_A* Length = 219 | Back alignment and structure |
|---|
| >1k3y_A GSTA1-1, glutathione S-transferase A1; S-hexyl glutatione, water structu transferase; HET: GTX; 1.30A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsf_A* 1guh_A* 1gsd_A* 1k3o_A 1k3l_A* 1pl1_A* 1pkz_A 1pkw_A* 2r6k_A* 1gse_A* 3u6v_A 1usb_A* 1ydk_A* 3q74_A 3ktl_A* 1pl2_A* 2r3x_A* 1xwg_A 3l0h_A* 1ags_A* ... Length = 221 | Back alignment and structure |
|---|
| >1b48_A GST, mgsta4-4, protein (glutathione S-transferase); subunit cooperativity; HET: HAG GSH; 2.60A {Mus musculus} SCOP: a.45.1.1 c.47.1.5 PDB: 1guk_A Length = 221 | Back alignment and structure |
|---|
| >2uz8_A Eukaryotic translation elongation factor 1 epsilon-1; protein biosynthesis, aminoacyl-tRNA synthetase, GST, nuclear protein, RNA-binding protein; HET: MSE; 2.0A {Homo sapiens} Length = 174 | Back alignment and structure |
|---|
| >2x64_A Glutathione-S-transferase; detoxification enzyme; HET: GSH; 2.30A {Xylella fastidiosa} Length = 207 | Back alignment and structure |
|---|
| >1yq1_A Glutathione S-transferase; nematoda, structural genomics, PSI, protein structure initiative; 3.00A {Caenorhabditis elegans} Length = 208 | Back alignment and structure |
|---|
| >3ik7_A Glutathione S-transferase A4; human GST A4-4, enzyme, cytoplasm, polymorphism; HET: BOB; 1.97A {Homo sapiens} PDB: 1gum_A 1gul_A* Length = 222 | Back alignment and structure |
|---|
| >2cvd_A Glutathione-requiring prostaglandin D synthase; glutathione-S-transferase, isomerase; HET: GSH HQL; 1.45A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1iyi_A* 1v40_A* 1iyh_A* 3vi5_A* 3vi7_A* 2vcq_A* 2vcw_A* 2vcx_A* 2vcz_A* 2vd0_A* 2vd1_A* 3kxo_A* 3ee2_A* 1pd2_1* Length = 198 | Back alignment and structure |
|---|
| >3iso_A Putative glutathione transferase; GST; HET: GSH; 1.90A {Clonorchis sinensis} Length = 218 | Back alignment and structure |
|---|
| >4exj_A Uncharacterized protein; transferase-like protein, transcription regulation, transfer structural genomics; 1.64A {Lodderomyces elongisporus nrrl yb-4239} Length = 238 | Back alignment and structure |
|---|
| >2a2r_A Glutathione S-transferase P; detoxification, nitric oxide carrier, S- nitrosoglutathione; HET: MES GSN; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 11gs_A* 12gs_A* 14gs_A* 16gs_A* 18gs_A* 21gs_A* 13gs_A* 2a2s_A* 3dd3_A* 3dgq_A* 3n9j_A* 3pgt_A* 1pgt_A* 2pgt_A* 4pgt_A* 22gs_A* 17gs_A* 3gus_A* 10gs_A* 1aqv_A* ... Length = 210 | Back alignment and structure |
|---|
| >1b8x_A Protein (AML-1B); nuclear matrix targeting signal protein, signal protein; 2.70A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 Length = 280 | Back alignment and structure |
|---|
| >2fhe_A GST, glutathione S-transferase; transferase-substrate complex; HET: GSH; 2.30A {Fasciola hepatica} SCOP: a.45.1.1 c.47.1.5 PDB: 2wrt_A 1fhe_A* Length = 216 | Back alignment and structure |
|---|
| >2fno_A AGR_PAT_752P; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics, JCSG; 2.00A {Agrobacterium tumefaciens} SCOP: a.45.1.1 c.47.1.5 Length = 248 | Back alignment and structure |
|---|
| >2on7_A Nagst-1, Na glutathione S-transferase 1; hookworm; 2.40A {Necator americanus} Length = 206 | Back alignment and structure |
|---|
| >2ws2_A NU-class GST, glutathione S-transferase; parasite, nematode; 2.01A {Haemonchus contortus} Length = 204 | Back alignment and structure |
|---|
| >2on5_A Nagst-2, Na glutathione S-transferase 2; hookworm; HET: GSH; 1.90A {Necator americanus} Length = 206 | Back alignment and structure |
|---|
| >2gsq_A Squid GST, glutathione S-transferase; squid digestive gland, sigma class; HET: GBI; 2.20A {Ommastrephes sloani} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsq_A* Length = 202 | Back alignment and structure |
|---|
| >1dug_A Chimera of glutathione S-transferase-synthetic linker-C-terminal fibrinogen gamma...; gamma chain integrin fragment; HET: GSH; 1.80A {Schistosoma japonicum} SCOP: a.45.1.1 c.47.1.5 PDB: 1gne_A* 3qmz_T 1y6e_A 1m9a_A* 1gtb_A* 1gta_A* 1m99_A* 1m9b_A* 1ua5_A* 1u87_A* 1u88_A* 3crt_A* 3cru_A* 3d0z_A* Length = 234 | Back alignment and structure |
|---|
| >1zl9_A GST class-sigma, glutathione S-transferase 5; glutathione transferase, C.elegans; HET: GSH; 2.01A {Caenorhabditis elegans} Length = 207 | Back alignment and structure |
|---|
| >1tu7_A Glutathione S-transferase 2; HET: GSH; 1.50A {Onchocerca volvulus} SCOP: a.45.1.1 c.47.1.5 PDB: 1tu8_A* Length = 208 | Back alignment and structure |
|---|
| >1gsu_A GST, CGSTM1-1, class-MU glutathione S-transferase; detoxification enzyme, S-hexyl glutathione; HET: GTX; 1.94A {Gallus gallus} SCOP: a.45.1.1 c.47.1.5 PDB: 1c72_A* Length = 219 | Back alignment and structure |
|---|
| >1bg5_A MAB, fusion protein of alpha-Na,K-ATPase with glutathione S-transferase; ankyrin binding, carrier crystallization, ION transport; 2.60A {Rattus norvegicus} SCOP: a.45.1.1 c.47.1.5 Length = 254 | Back alignment and structure |
|---|
| >3gtu_B Glutathione S-transferase; conjugation, detoxification, cytosolic, heterodimer; 2.80A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 Length = 224 | Back alignment and structure |
|---|
| >1okt_A Glutathione S-transferase; GST; 1.9A {Plasmodium falciparum} SCOP: a.45.1.1 c.47.1.5 PDB: 1pa3_A 1q4j_A* 3fr9_A* 3frc_A* 2aaw_A* 3fr6_A 3fr3_A* Length = 211 | Back alignment and structure |
|---|
| >2yv9_A Chloride intracellular channel EXC-4; chloride ION channel, CLIC, GST fold, metal transport; 1.60A {Caenorhabditis elegans} Length = 291 | Back alignment and structure |
|---|
| >1tw9_A Glutathione S-transferase 2; 1.71A {Heligmosomoides polygyrus} SCOP: a.45.1.1 c.47.1.5 Length = 206 | Back alignment and structure |
|---|
| >2c4j_A Glutathione S-transferase MU 2; glutathione transferase, multigene family; HET: GSO; 1.35A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1xw5_A* 1ykc_A* 2ab6_A* 2gtu_A 3gtu_A 3gur_A* 1hna_A* 1hnb_A* 1hnc_A* 1xw6_A* 1xwk_A* 1yj6_A* 2f3m_A* 2dc5_A 1gtu_A 4gtu_A 6gsu_A* 6gsv_A* 6gsw_A* 2gst_A* ... Length = 218 | Back alignment and structure |
|---|
| >1m0u_A GST2 gene product; flight muscle protein, sigma, transferase; HET: GSH; 1.75A {Drosophila melanogaster} SCOP: a.45.1.1 c.47.1.5 Length = 249 | Back alignment and structure |
|---|
| >3h1n_A Probable glutathione S-transferase; APC84167, bordetella bronchisepti structural genomics, PSI-2, protein structure initiative; 1.83A {Bordetella bronchiseptica RB50} Length = 252 | Back alignment and structure |
|---|
| >2hnl_A Glutathione S-transferase 1; prostaglandin synthase, river BLI onchocerca volvulus, immune modulation; HET: GSH; 2.00A {Onchocerca volvulus} Length = 225 | Back alignment and structure |
|---|
| >2wb9_A Glutathione transferase sigma class; thioredoxin fold; HET: GSH; 1.59A {Fasciola hepatica} PDB: 2wdu_A* Length = 211 | Back alignment and structure |
|---|
| >1oe8_A Glutathione S-transferase; schistosomiasis, detoxifying enzyme, prostaglandin D2 synthase, vaccine candidate; HET: GSH; 1.65A {Schistosoma haematobium} SCOP: a.45.1.1 c.47.1.5 PDB: 1oe7_A* 2c80_A* 2ca8_A* 2f8f_A* 2c8u_A 2caq_A* 2cai_A* 1u3i_A* Length = 211 | Back alignment and structure |
|---|
| >3c8e_A YGHU, glutathione S-transferase homologue; glutathione transferase homologue, E. coli; HET: GSH; 1.50A {Escherichia coli} Length = 288 | Back alignment and structure |
|---|
| >1k0d_A URE2 protein; nitrate assimilation, structural genomics, gene regulation; HET: GSH; 2.20A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 PDB: 1jzr_A* 1k0b_A* 1k0c_A* 1k0a_A* 1g6w_A 1g6y_A 1hqo_A Length = 260 | Back alignment and structure |
|---|
| >3gx0_A GST-like protein YFCG; transferase, glutathione, glutathione disulfide, disulfide bond oxidoreductase; HET: GDS; 2.30A {Escherichia coli} Length = 215 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 222 | |||
| 2vo4_A | 219 | 2,4-D inducible glutathione S-transferase; herbici | 100.0 | |
| 4hoj_A | 210 | REGF protein; GST, glutathione S-transferase, enzy | 100.0 | |
| 3lyk_A | 216 | Stringent starvation protein A homolog; structural | 100.0 | |
| 1gwc_A | 230 | Glutathione S-transferase TSI-1; herbicide detoxif | 100.0 | |
| 4glt_A | 225 | Glutathione S-transferase-like protein; structural | 100.0 | |
| 1oyj_A | 231 | Glutathione S-transferase; herbicide detoxificatio | 100.0 | |
| 4g10_A | 265 | Glutathione S-transferase homolog; thioredoxin fol | 100.0 | |
| 4hi7_A | 228 | GI20122; GST, glutathione S-transferase, enzyme fu | 100.0 | |
| 3vk9_A | 216 | Glutathione S-transferase delta; glutathione bindi | 100.0 | |
| 3lyp_A | 215 | Stringent starvation protein A; structural genomic | 100.0 | |
| 3ubk_A | 242 | Glutathione transferase; GSH binding; 1.95A {Lepto | 100.0 | |
| 1yy7_A | 213 | SSPA, stringent starvation protein A; GST fold, tr | 100.0 | |
| 3lxz_A | 229 | Glutathione S-transferase family protein; structur | 100.0 | |
| 4dej_A | 231 | Glutathione S-transferase related protein; transfe | 100.0 | |
| 3vln_A | 241 | GSTO-1, glutathione S-transferase omega-1; GST fol | 100.0 | |
| 3q18_A | 239 | GSTO-2, glutathione S-transferase omega-2; glutath | 100.0 | |
| 3r2q_A | 202 | Uncharacterized GST-like protein YIBF; transferase | 100.0 | |
| 3m0f_A | 213 | Uncharacterized protein GST_N; PSI-2, NYSGXRC, glu | 100.0 | |
| 4gf0_A | 215 | Glutathione S-transferase; GST, enzyme function in | 100.0 | |
| 3ibh_A | 233 | GST-II, saccharomyces cerevisiae GTT2; glutathione | 100.0 | |
| 3rbt_A | 246 | Glutathione transferase O1; glutathione S-transfer | 100.0 | |
| 3tou_A | 226 | Glutathione S-transferase protein; GSH binding sit | 100.0 | |
| 3n5o_A | 235 | Glutathione transferase; seattle structural genomi | 100.0 | |
| 4iel_A | 229 | Glutathione S-transferase, N-terminal domain PROT; | 100.0 | |
| 3gtu_B | 224 | Glutathione S-transferase; conjugation, detoxifica | 100.0 | |
| 2cz2_A | 223 | Maleylacetoacetate isomerase; structural genomics, | 100.0 | |
| 3ay8_A | 216 | Glutathione S-transferase; GST fold, GST binding, | 100.0 | |
| 4gci_A | 211 | Glutathione S-transferase; GST, enzyme function in | 100.0 | |
| 3cbu_A | 214 | Probable GST-related protein; thioredoxin fold, GS | 100.0 | |
| 3qav_A | 243 | RHO-class glutathione S-transferase; cytosol; 2.10 | 100.0 | |
| 3niv_A | 222 | Glutathione S-transferase; structural genomics, PS | 100.0 | |
| 3ein_A | 209 | GST class-theta, glutathione S-transferase 1-1; de | 100.0 | |
| 1gnw_A | 211 | Glutathione S-transferase; herbicide detoxificatio | 100.0 | |
| 2imi_A | 221 | Epsilon-class glutathione S-transferase; HET: GSH; | 100.0 | |
| 2v6k_A | 214 | Maleylpyruvate isomerase; glutathione-S-transferas | 100.0 | |
| 3iso_A | 218 | Putative glutathione transferase; GST; HET: GSH; 1 | 100.0 | |
| 2gsq_A | 202 | Squid GST, glutathione S-transferase; squid digest | 100.0 | |
| 1axd_A | 209 | Glutathione S-transferase I; transferase, herbicid | 100.0 | |
| 1pn9_A | 209 | GST class-delta, glutathione S-transferase 1-6; pr | 100.0 | |
| 3m3m_A | 210 | Glutathione S-transferase; PSI-II, structural geno | 100.0 | |
| 1r5a_A | 218 | Glutathione transferase; glutathione S-transferase | 100.0 | |
| 2x64_A | 207 | Glutathione-S-transferase; detoxification enzyme; | 100.0 | |
| 4hz2_A | 230 | Glutathione S-transferase domain; glutathione,enzy | 100.0 | |
| 2cvd_A | 198 | Glutathione-requiring prostaglandin D synthase; gl | 100.0 | |
| 3f6d_A | 219 | Adgstd4-4, glutathione transferase GST1-4; HET: GT | 100.0 | |
| 1v2a_A | 210 | Glutathione transferase GST1-6; glutathione S-tran | 100.0 | |
| 3bby_A | 215 | Uncharacterized GST-like protein YFCF; NP_416804.1 | 100.0 | |
| 2fhe_A | 216 | GST, glutathione S-transferase; transferase-substr | 100.0 | |
| 1tu7_A | 208 | Glutathione S-transferase 2; HET: GSH; 1.50A {Onch | 100.0 | |
| 1yq1_A | 208 | Glutathione S-transferase; nematoda, structural ge | 100.0 | |
| 1gsu_A | 219 | GST, CGSTM1-1, class-MU glutathione S-transferase; | 100.0 | |
| 1e6b_A | 221 | Glutathione S-transferase; 1.65A {Arabidopsis thal | 100.0 | |
| 1k0m_A | 241 | CLIC1, NCC27, chloride intracellular channel prote | 100.0 | |
| 3gx0_A | 215 | GST-like protein YFCG; transferase, glutathione, g | 100.0 | |
| 2pvq_A | 201 | Glutathione S-transferase; xenobiotics detoxificat | 100.0 | |
| 2a2r_A | 210 | Glutathione S-transferase P; detoxification, nitri | 100.0 | |
| 3lsz_A | 225 | Glutathione S-transferase; xenobiotic, biodegradat | 100.0 | |
| 3uar_A | 227 | Glutathione S-transferase; GSH binding site; HET: | 100.0 | |
| 1n2a_A | 201 | Glutathione S-transferase; HET: GTS; 1.90A {Escher | 100.0 | |
| 1f2e_A | 201 | Glutathione S-transferase; GST complexed with glut | 100.0 | |
| 3ik7_A | 222 | Glutathione S-transferase A4; human GST A4-4, enzy | 100.0 | |
| 4hz4_A | 217 | Glutathione-S-transferase; enzyme function initiat | 100.0 | |
| 1ljr_A | 244 | HGST T2-2, glutathione S-transferase; HET: GSH; 3. | 100.0 | |
| 4id0_A | 214 | Glutathione S-transferase-like protein YIBF; GST, | 100.0 | |
| 1oe8_A | 211 | Glutathione S-transferase; schistosomiasis, detoxi | 100.0 | |
| 2dsa_A | 203 | Glutathione S-transferase; HET: GSH HPX; 2.10A {Bu | 100.0 | |
| 2wb9_A | 211 | Glutathione transferase sigma class; thioredoxin f | 100.0 | |
| 3m8n_A | 225 | Possible glutathione S-transferase; PSI-II, struct | 100.0 | |
| 1m0u_A | 249 | GST2 gene product; flight muscle protein, sigma, t | 100.0 | |
| 4ecj_A | 244 | Glutathione S-transferase; transferase-like protei | 100.0 | |
| 1pmt_A | 203 | PMGST, GST B1-1, glutathione transferase; glutathi | 100.0 | |
| 1aw9_A | 216 | Glutathione S-transferase III; herbicide detoxific | 100.0 | |
| 1tw9_A | 206 | Glutathione S-transferase 2; 1.71A {Heligmosomoide | 100.0 | |
| 1dug_A | 234 | Chimera of glutathione S-transferase-synthetic lin | 100.0 | |
| 1nhy_A | 219 | EF-1-gamma 1, elongation factor 1-gamma 1; protein | 100.0 | |
| 4exj_A | 238 | Uncharacterized protein; transferase-like protein, | 100.0 | |
| 2c4j_A | 218 | Glutathione S-transferase MU 2; glutathione transf | 100.0 | |
| 4ikh_A | 244 | Glutathione S-transferase; enzyme function initiat | 100.0 | |
| 2hnl_A | 225 | Glutathione S-transferase 1; prostaglandin synthas | 100.0 | |
| 2r4v_A | 247 | XAP121, chloride intracellular channel protein 2; | 100.0 | |
| 2on5_A | 206 | Nagst-2, Na glutathione S-transferase 2; hookworm; | 100.0 | |
| 2on7_A | 206 | Nagst-1, Na glutathione S-transferase 1; hookworm; | 100.0 | |
| 1zl9_A | 207 | GST class-sigma, glutathione S-transferase 5; glut | 100.0 | |
| 1k3y_A | 221 | GSTA1-1, glutathione S-transferase A1; S-hexyl glu | 100.0 | |
| 4ags_A | 471 | Thiol-dependent reductase 1; transferase, leishman | 100.0 | |
| 2ahe_A | 267 | Chloride intracellular channel protein 4; glutathi | 100.0 | |
| 1okt_A | 211 | Glutathione S-transferase; GST; 1.9A {Plasmodium f | 100.0 | |
| 1b8x_A | 280 | Protein (AML-1B); nuclear matrix targeting signal | 100.0 | |
| 2ycd_A | 230 | Glutathione S-transferase; SOIL bacteria, herbicid | 100.0 | |
| 3fy7_A | 250 | Chloride intracellular channel protein 3; GST, glu | 100.0 | |
| 1b48_A | 221 | GST, mgsta4-4, protein (glutathione S-transferase) | 100.0 | |
| 1vf1_A | 229 | Glutathione S-transferase 3; detoxification; HET: | 100.0 | |
| 4ags_A | 471 | Thiol-dependent reductase 1; transferase, leishman | 100.0 | |
| 2c3n_A | 247 | Glutathione S-transferase theta 1; glutathione tra | 100.0 | |
| 2ws2_A | 204 | NU-class GST, glutathione S-transferase; parasite, | 100.0 | |
| 1k0d_A | 260 | URE2 protein; nitrate assimilation, structural gen | 100.0 | |
| 3c8e_A | 288 | YGHU, glutathione S-transferase homologue; glutath | 100.0 | |
| 3h1n_A | 252 | Probable glutathione S-transferase; APC84167, bord | 100.0 | |
| 2yv7_A | 260 | CG10997-PA, LD46306P, CLIC; dmclic, chloride ION c | 100.0 | |
| 1bg5_A | 254 | MAB, fusion protein of alpha-Na,K-ATPase with glut | 100.0 | |
| 3ic8_A | 310 | Uncharacterized GST-like proteinprotein; glutathio | 100.0 | |
| 3ir4_A | 218 | Glutaredoxin 2; glutathione, IDP00895, structural | 100.0 | |
| 2yv9_A | 291 | Chloride intracellular channel EXC-4; chloride ION | 100.0 | |
| 2fno_A | 248 | AGR_PAT_752P; thioredoxin fold, GST C-terminal dom | 99.98 | |
| 3m1g_A | 362 | Putative glutathione S-transferase; ECM4-like subf | 99.97 | |
| 3ppu_A | 352 | Glutathione-S-transferase; GST fold; HET: GSH; 2.3 | 99.97 | |
| 4f03_A | 253 | Glutathione transferase; GST fold; 1.80A {Phaneroc | 99.97 | |
| 4akg_A | 2695 | Glutathione S-transferase class-MU 26 kDa isozyme | 99.96 | |
| 1z9h_A | 290 | Membrane-associated prostaglandin E synthase-2; me | 99.96 | |
| 4fqu_A | 313 | Putative glutathione transferase; glutathionyl-hyd | 99.96 | |
| 4g0i_A | 328 | Protein YQJG; glutathionyl-hydroquinone reductase, | 99.95 | |
| 2uz8_A | 174 | Eukaryotic translation elongation factor 1 epsilon | 99.94 | |
| 2hra_A | 209 | Glutamyl-tRNA synthetase, cytoplasmic; GST-fold, l | 99.91 | |
| 2hsn_A | 160 | Methionyl-tRNA synthetase, cytoplasmic; protein co | 99.78 | |
| 2hqt_A | 124 | GU4 nucleic-binding protein 1; GST-fold, biosynthe | 99.25 | |
| 1fov_A | 82 | Glutaredoxin 3, GRX3; active site disulfide, CIS P | 99.22 | |
| 2lqo_A | 92 | Putative glutaredoxin RV3198.1/MT3292; TRX fold, o | 99.1 | |
| 3msz_A | 89 | Glutaredoxin 1; alpha-beta sandwich, center for st | 99.08 | |
| 2klx_A | 89 | Glutaredoxin; thioredoxin type domain, ssgcid, ele | 99.08 | |
| 2khp_A | 92 | Glutaredoxin; thioredoxin type domain, ssgcid, ele | 99.04 | |
| 3qmx_A | 99 | Glutaredoxin A, glutaredoxin 3; electron transport | 98.96 | |
| 1nm3_A | 241 | Protein HI0572; hybrid, peroxiredoxin, glutaredoxi | 98.92 | |
| 3ic4_A | 92 | Glutaredoxin (GRX-1); structural genomics, PSI, MC | 98.9 | |
| 1aba_A | 87 | Glutaredoxin; electron transport; HET: MES; 1.45A | 98.77 | |
| 1r7h_A | 75 | NRDH-redoxin; thioredoxin, glutaredoxin, redox pro | 98.71 | |
| 1t1v_A | 93 | SH3BGRL3, SH3 domain-binding glutamic acid-rich pr | 98.64 | |
| 3nzn_A | 103 | Glutaredoxin; structural genomics, PSI2, MCSG, pro | 98.59 | |
| 3h8q_A | 114 | Thioredoxin reductase 3; oxidoreductase, structura | 98.52 | |
| 3rhb_A | 113 | ATGRXC5, glutaredoxin-C5, chloroplastic; thioredox | 98.52 | |
| 3zyw_A | 111 | Glutaredoxin-3; metal binding protein; 1.84A {Homo | 98.49 | |
| 1wik_A | 109 | Thioredoxin-like protein 2; picot homology 2 domai | 98.47 | |
| 2cq9_A | 130 | GLRX2 protein, glutaredoxin 2; glutathione-S-trans | 98.44 | |
| 2ct6_A | 111 | SH3 domain-binding glutamic acid-rich-like protein | 98.43 | |
| 2yan_A | 105 | Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {H | 98.42 | |
| 1kte_A | 105 | Thioltransferase; redox-active center, electron tr | 98.41 | |
| 3ipz_A | 109 | Monothiol glutaredoxin-S14, chloroplastic; electro | 98.39 | |
| 1ego_A | 85 | Glutaredoxin; electron transport; NMR {Escherichia | 98.32 | |
| 2ht9_A | 146 | Glutaredoxin-2; thioredoxin fold, iron-sulfur clus | 98.31 | |
| 2wci_A | 135 | Glutaredoxin-4; redox-active center, iron-sulfur c | 98.29 | |
| 3ctg_A | 129 | Glutaredoxin-2; reduced form, electron transport, | 98.28 | |
| 1h75_A | 81 | Glutaredoxin-like protein NRDH; electron transport | 98.26 | |
| 3c1r_A | 118 | Glutaredoxin-1; oxidized form, oxidoreductase, cyt | 98.22 | |
| 2hze_A | 114 | Glutaredoxin-1; thioredoxin fold, arsenic, dimethy | 98.21 | |
| 2wem_A | 118 | Glutaredoxin-related protein 5; chromosome 14 open | 98.18 | |
| 3l4n_A | 127 | Monothiol glutaredoxin-6; C-terminal domain of GRX | 98.18 | |
| 3gx8_A | 121 | Monothiol glutaredoxin-5, mitochondrial; TRX fold, | 98.07 | |
| 1u6t_A | 121 | SH3 domain-binding glutamic acid-rich-like protein | 98.0 | |
| 2fgx_A | 107 | Putative thioredoxin; NET3, NESG, GFT-glutaredoxin | 97.92 | |
| 2kok_A | 120 | Arsenate reductase; brucellosis, zoonotic, oxidore | 97.77 | |
| 1z3e_A | 132 | Regulatory protein SPX; bacterial transcription re | 97.72 | |
| 1ttz_A | 87 | Conserved hypothetical protein; structural genomic | 97.67 | |
| 2k8s_A | 80 | Thioredoxin; dimer, structural genomics, PSI-2, pr | 97.57 | |
| 2wul_A | 118 | Glutaredoxin related protein 5; chromosome 14 open | 97.44 | |
| 1wjk_A | 100 | C330018D20RIK protein; glutaredoxin, thioredoxin f | 97.38 | |
| 2jad_A | 362 | Yellow fluorescent protein glutaredoxin fusion pro | 97.32 | |
| 2e7p_A | 116 | Glutaredoxin; thioredoxin fold, poplar, electron t | 97.27 | |
| 3rdw_A | 121 | Putative arsenate reductase; structural genomics, | 97.14 | |
| 1rw1_A | 114 | Conserved hypothetical protein YFFB; thioredoxin f | 97.11 | |
| 1s3c_A | 141 | Arsenate reductase; ARSC, arsenite, oxidoreductase | 97.08 | |
| 3fz4_A | 120 | Putative arsenate reductase; APC61768, structural | 97.07 | |
| 3l78_A | 120 | Regulatory protein SPX; transcription, transcripti | 97.04 | |
| 2x8g_A | 598 | Thioredoxin glutathione reductase; redox-active ce | 97.0 | |
| 3gkx_A | 120 | Putative ARSC family related protein; ARSC family | 96.97 | |
| 3f0i_A | 119 | Arsenate reductase; structural genomics, IDP01300, | 96.78 | |
| 2axo_A | 270 | Hypothetical protein ATU2684; alpha beta protein., | 94.63 | |
| 1fo5_A | 85 | Thioredoxin; disulfide oxidoreductase, structural | 93.74 | |
| 3kp8_A | 106 | Vkorc1/thioredoxin domain protein; blood coagulati | 88.33 | |
| 1nho_A | 85 | Probable thioredoxin; beta sheet, alpha helix, oxi | 87.29 | |
| 3kp9_A | 291 | Vkorc1/thioredoxin domain protein; warfarin, disul | 87.18 | |
| 2hls_A | 243 | Protein disulfide oxidoreductase; thioredoxin fold | 84.52 | |
| 1hyu_A | 521 | AHPF, alkyl hydroperoxide reductase subunit F; thi | 82.78 |
| >2vo4_A 2,4-D inducible glutathione S-transferase; herbicide, TAU class GST, S-(P-nitrobenzyl- glutathione); HET: GTB 4NM; 1.75A {Glycine max} PDB: 3fhs_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=6.2e-42 Score=264.40 Aligned_cols=215 Identities=46% Similarity=0.811 Sum_probs=187.4
Q ss_pred CCCcceEEeeccCCchHHHHHHHHHHhCCCceEEeCCCCCCchhhhhhCCCCCcccEEEeCCeecchHHHHHHHHHhhCC
Q 027498 1 MAEESVKLLGYWASPFALRVKWALKLKGVHYEYVEENLPNKSPLLLRYNPVYKKIPVLVHNGKPLAESLLIIEYIDEAWK 80 (222)
Q Consensus 1 m~~~~~~L~~~~~s~~~~~vr~~L~~~gi~~~~~~~~~~~~~~~~~~~~p~~~~vP~l~~~~~~i~es~~I~~yL~~~~~ 80 (222)
|+. +++||+++.||+|+++|++|+++||+|+.+.++...+.+++.+.||.+|+||+|++||..++||.+|++||+++++
T Consensus 1 M~~-~~~Ly~~~~sp~~~~v~~~L~~~gi~~e~~~v~~~~~~~~~~~~nP~~g~vP~L~~~g~~l~eS~aI~~yL~~~~~ 79 (219)
T 2vo4_A 1 MQD-EVVLLDFWPSPFGMRVRIALAEKGIKYEYKEEDLRNKSPLLLQMNPVHKKIPVLIHNGKPICESLIAVQYIEEVWN 79 (219)
T ss_dssp CCC-CEEEEECTTCHHHHHHHHHHHHTTCCCEEEECCTTSCCHHHHHHCTTTCCSCEEEETTEEEESHHHHHHHHHHHST
T ss_pred CCC-ceEEEeccCCchHHHHHHHHHHcCCCceEEecCcccCCHHHHHhCCCCCcCCEEEECCEeeehHHHHHHHHHHhCC
Confidence 775 6999999999999999999999999999999998777899999999537999999999999999999999999998
Q ss_pred C-CCCCCCCHHHHHHHHHHHHHHhcccchhhhhhhcCCcHHHHHHHH-HHHHHHHHHHHhcCCCcccCCCCChhHHHHHh
Q 027498 81 Q-NPLLPDDPYERANARFWAKFFDEKCVPEVMGAFASKGEEQEKAAK-ARENLKMLERALEGKPFFGGDKIGFLDIAVGW 158 (222)
Q Consensus 81 ~-~~l~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~l~~le~~L~~~~~l~G~~~t~aD~~l~~ 158 (222)
+ ++|+|.++.+++.+++|+.++++.+.+.+...+...++..+...+ +.+.|+.||+.|++++|++|+++|+||+++++
T Consensus 80 ~~~~L~p~~~~~~a~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~l~~le~~L~~~~~l~G~~~t~ADi~l~~ 159 (219)
T 2vo4_A 80 DRNPLLPSDPYQRAQTRFWADYVDKKIYDLGRKIWTSKGEEKEAAKKEFIEALKLLEEQLGDKTYFGGDNLGFVDIALVP 159 (219)
T ss_dssp TSCCCSCSSHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHTTCSBTTBSSCCHHHHHHHH
T ss_pred CCCCCCCCCHHHHHHHHHHHHHHHhccchhHHHhhccCcHHHHHHHHHHHHHHHHHHHhhcCCCcccCCCCCHHHHHHHH
Confidence 7 579999999999999999999887777666666555555566677 99999999999999999999999999999999
Q ss_pred HHHHHHHHHHHhcccccCCCcccHHHHHHHHHhcchhhhhcCCChHHHHHHhhhhhhhhc
Q 027498 159 IGIWGRIVEEIAGVSLIDAETMPLLTAWLNNFLEVPVIKACIPSWHELLEHNKGFHKILT 218 (222)
Q Consensus 159 ~l~~~~~~~~~~~~~~~~~~~~p~l~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~ 218 (222)
.+.++.......+.++ .++||+|.+|++++.++|++++++++.+...+.+++.++++.
T Consensus 160 ~l~~~~~~~~~~~~~~--~~~~p~l~~w~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~ 217 (219)
T 2vo4_A 160 FYTWFKAYETFGTLNI--ESECPKFIAWAKRCLQKESVAKSLPDQQKVYEFIMDLRKKLG 217 (219)
T ss_dssp HHTTHHHHHHHTTCCH--HHHCHHHHHHHHHHHTSHHHHTTCCCHHHHHHHHHHTHHHHT
T ss_pred HHHHHHHHHHhcCcch--hhcChHHHHHHHHHhcChHHHHhCCCHHHHHHHHHHHHHHhc
Confidence 9887754322223333 247999999999999999999999999999999999888753
|
| >4hoj_A REGF protein; GST, glutathione S-transferase, enzyme function initiative, structural genomics, transferase; HET: GSH; 1.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >3lyk_A Stringent starvation protein A homolog; structural genomics, GST-superfamily, SSPA, PSI-2, protein structure initiative; 2.10A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >1gwc_A Glutathione S-transferase TSI-1; herbicide detoxification, plant, TAU class; HET: GTX; 2.25A {Aegilops tauschii} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >4glt_A Glutathione S-transferase-like protein; structural genomics, function initiative, EFI; HET: GSH; 2.20A {Methylobacillus flagellatus} | Back alignment and structure |
|---|
| >1oyj_A Glutathione S-transferase; herbicide detoxification; HET: GSH; 1.95A {Oryza sativa} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >4g10_A Glutathione S-transferase homolog; thioredoxin fold; HET: MSE GSH; 1.20A {Sphingomonas paucimobilis} | Back alignment and structure |
|---|
| >4hi7_A GI20122; GST, glutathione S-transferase, enzyme function initiative, structural genomics, unknown function; HET: GSH; 1.25A {Drosophila mojavensis} | Back alignment and structure |
|---|
| >3vk9_A Glutathione S-transferase delta; glutathione binding; 2.00A {Bombyx mori} | Back alignment and structure |
|---|
| >3lyp_A Stringent starvation protein A; structural genomics, GST-superfamily, SSPA, stringent starva protein A homolog, PSI-2; 1.60A {Pseudomonas fluorescens} PDB: 3mdk_A | Back alignment and structure |
|---|
| >3ubk_A Glutathione transferase; GSH binding; 1.95A {Leptospira interrogans serovar lai} PDB: 3ubl_A* | Back alignment and structure |
|---|
| >1yy7_A SSPA, stringent starvation protein A; GST fold, transcription; HET: CIT; 2.02A {Yersinia pestis} | Back alignment and structure |
|---|
| >3lxz_A Glutathione S-transferase family protein; structural genomics, PP0183, PSI-2, protein structure initiative; 1.76A {Pseudomonas putida} PDB: 3pr8_A* | Back alignment and structure |
|---|
| >4dej_A Glutathione S-transferase related protein; transferase-like protein, transcription regulation; 2.90A {Idiomarina loihiensis} | Back alignment and structure |
|---|
| >3vln_A GSTO-1, glutathione S-transferase omega-1; GST fold, reductase; HET: ASC; 1.70A {Homo sapiens} PDB: 1eem_A* 3lfl_A* | Back alignment and structure |
|---|
| >3q18_A GSTO-2, glutathione S-transferase omega-2; glutathione transferase, dehydroascorbate reductase, reductase; 1.70A {Homo sapiens} PDB: 3q19_A* 3qag_A* | Back alignment and structure |
|---|
| >3r2q_A Uncharacterized GST-like protein YIBF; transferase, glutathione; HET: GSH; 1.05A {Escherichia coli} | Back alignment and structure |
|---|
| >3m0f_A Uncharacterized protein GST_N; PSI-2, NYSGXRC, glutathione, structural genomics, protein structure initiative; HET: GSH; 1.60A {Pseudomonas fluorescens} PDB: 3lxt_A* | Back alignment and structure |
|---|
| >4gf0_A Glutathione S-transferase; GST, enzyme function initiative, EFI, structural genomics; HET: GSH; 1.75A {Sulfitobacter} | Back alignment and structure |
|---|
| >3ibh_A GST-II, saccharomyces cerevisiae GTT2; glutathione S-transferase, transferase; HET: GSH; 2.10A {Saccharomyces cerevisiae} PDB: 3erf_A* 3erg_A* | Back alignment and structure |
|---|
| >3rbt_A Glutathione transferase O1; glutathione S-transferase omega3; 2.20A {Bombyx mori} | Back alignment and structure |
|---|
| >3tou_A Glutathione S-transferase protein; GSH binding site, GSH; HET: GSH; 1.75A {Ralstonia solanacearum} PDB: 3tot_A* | Back alignment and structure |
|---|
| >3n5o_A Glutathione transferase; seattle structural genomics center for infectious disease, S GST, pathogenic fungus, coccidioidomycosis; HET: GSH; 1.85A {Coccidioides immitis} PDB: 3lg6_A* | Back alignment and structure |
|---|
| >4iel_A Glutathione S-transferase, N-terminal domain PROT; GST, glutathione S-transferase, enzyme function initiative, structural genomics; HET: GSH; 1.60A {Burkholderia ambifaria} | Back alignment and structure |
|---|
| >3gtu_B Glutathione S-transferase; conjugation, detoxification, cytosolic, heterodimer; 2.80A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >2cz2_A Maleylacetoacetate isomerase; structural genomics, GST, GSTZ1-1, NPPSFA, national project protein structural and functional analyses; HET: GSH; 1.40A {Mus musculus} PDB: 2cz3_A 1fw1_A* | Back alignment and structure |
|---|
| >3ay8_A Glutathione S-transferase; GST fold, GST binding, cytosolic; 2.10A {Bombyx mori} | Back alignment and structure |
|---|
| >4gci_A Glutathione S-transferase; GST, enzyme function initiative, structural genomics; HET: GSH; 1.50A {Yersinia pestis} PDB: 4g9h_A* | Back alignment and structure |
|---|
| >3cbu_A Probable GST-related protein; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics; 2.05A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >3qav_A RHO-class glutathione S-transferase; cytosol; 2.10A {Laternula elliptica} PDB: 3qaw_A* | Back alignment and structure |
|---|
| >3niv_A Glutathione S-transferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.30A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3ein_A GST class-theta, glutathione S-transferase 1-1; delta-class GST; HET: GSH; 1.13A {Drosophila melanogaster} PDB: 3mak_A* 3f6f_A 3gh6_A* 1jlv_A* | Back alignment and structure |
|---|
| >1gnw_A Glutathione S-transferase; herbicide detoxification; HET: GTX; 2.20A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 PDB: 1bx9_A* | Back alignment and structure |
|---|
| >2imi_A Epsilon-class glutathione S-transferase; HET: GSH; 1.40A {Anopheles gambiae} PDB: 2il3_A* 2imk_A* | Back alignment and structure |
|---|
| >2v6k_A Maleylpyruvate isomerase; glutathione-S-transferase, GST, plasmid, bacterial, biodegradation, fumaryl pyruvate; HET: TGG; 1.3A {Ralstonia SP} PDB: 2jl4_A* | Back alignment and structure |
|---|
| >3iso_A Putative glutathione transferase; GST; HET: GSH; 1.90A {Clonorchis sinensis} | Back alignment and structure |
|---|
| >2gsq_A Squid GST, glutathione S-transferase; squid digestive gland, sigma class; HET: GBI; 2.20A {Ommastrephes sloani} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsq_A* | Back alignment and structure |
|---|
| >1axd_A Glutathione S-transferase I; transferase, herbicide detoxification, transferase-transfera inhibitor complex; HET: GGL CYW; 2.50A {Zea mays} SCOP: a.45.1.1 c.47.1.5 PDB: 1bye_A* | Back alignment and structure |
|---|
| >1pn9_A GST class-delta, glutathione S-transferase 1-6; protein inhibitor complex; HET: GTX; 2.00A {Anopheles gambiae} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3m3m_A Glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, N SGX research center for structural genomics; HET: GSH; 1.75A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >1r5a_A Glutathione transferase; glutathione S-transferase, GST, GSH, mosquito, detoxification, xenobiotics; HET: GTS; 2.50A {Anopheles cracens} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >2x64_A Glutathione-S-transferase; detoxification enzyme; HET: GSH; 2.30A {Xylella fastidiosa} | Back alignment and structure |
|---|
| >4hz2_A Glutathione S-transferase domain; glutathione,enzyme function initiative; HET: GSH; 1.50A {Xanthobacter autotrophicus} | Back alignment and structure |
|---|
| >2cvd_A Glutathione-requiring prostaglandin D synthase; glutathione-S-transferase, isomerase; HET: GSH HQL; 1.45A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1iyi_A* 1v40_A* 1iyh_A* 3vi5_A* 3vi7_A* 2vcq_A* 2vcw_A* 2vcx_A* 2vcz_A* 2vd0_A* 2vd1_A* 3kxo_A* 3ee2_A* 1pd2_1* | Back alignment and structure |
|---|
| >3f6d_A Adgstd4-4, glutathione transferase GST1-4; HET: GTX; 1.70A {Anopheles dirus} PDB: 3f63_A* 1jlw_A* 3g7i_A* 3g7j_A* | Back alignment and structure |
|---|
| >1v2a_A Glutathione transferase GST1-6; glutathione S-transferase, detoxification, xenobiotics; HET: GTS; 2.15A {Anopheles dirus} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3bby_A Uncharacterized GST-like protein YFCF; NP_416804.1, glutathione S-transferase, N-terminal domain, S genomics; 1.85A {Escherichia coli} | Back alignment and structure |
|---|
| >2fhe_A GST, glutathione S-transferase; transferase-substrate complex; HET: GSH; 2.30A {Fasciola hepatica} SCOP: a.45.1.1 c.47.1.5 PDB: 2wrt_A 1fhe_A* | Back alignment and structure |
|---|
| >1tu7_A Glutathione S-transferase 2; HET: GSH; 1.50A {Onchocerca volvulus} SCOP: a.45.1.1 c.47.1.5 PDB: 1tu8_A* | Back alignment and structure |
|---|
| >1yq1_A Glutathione S-transferase; nematoda, structural genomics, PSI, protein structure initiative; 3.00A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1gsu_A GST, CGSTM1-1, class-MU glutathione S-transferase; detoxification enzyme, S-hexyl glutathione; HET: GTX; 1.94A {Gallus gallus} SCOP: a.45.1.1 c.47.1.5 PDB: 1c72_A* | Back alignment and structure |
|---|
| >1e6b_A Glutathione S-transferase; 1.65A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >1k0m_A CLIC1, NCC27, chloride intracellular channel protein 1; glutathione-S-tranferase superfamily, chloride ION channel, metal transport; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1k0n_A* 1k0o_A 1rk4_A 3uvh_A 3o3t_A 3p90_A 3qr6_A 3p8w_A 3tgz_A 3ma4_A 3swl_A | Back alignment and structure |
|---|
| >3gx0_A GST-like protein YFCG; transferase, glutathione, glutathione disulfide, disulfide bond oxidoreductase; HET: GDS; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >2pvq_A Glutathione S-transferase; xenobiotics detoxification, H-site; HET: GSH; 1.80A {Ochrobactrum anthropi} PDB: 2nto_A* | Back alignment and structure |
|---|
| >2a2r_A Glutathione S-transferase P; detoxification, nitric oxide carrier, S- nitrosoglutathione; HET: MES GSN; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 11gs_A* 12gs_A* 14gs_A* 16gs_A* 18gs_A* 21gs_A* 13gs_A* 2a2s_A* 3dd3_A* 3dgq_A* 3n9j_A* 3pgt_A* 1pgt_A* 2pgt_A* 4pgt_A* 22gs_A* 17gs_A* 3gus_A* 10gs_A* 1aqv_A* ... | Back alignment and structure |
|---|
| >3lsz_A Glutathione S-transferase; xenobiotic, biodegradative metabolism, PSI2, NYSGXRC, structural genomics, protein structure initiative; HET: GSH; 1.70A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >3uar_A Glutathione S-transferase; GSH binding site; HET: GSH; 2.60A {Methylococcus capsulatus} PDB: 3uap_A* | Back alignment and structure |
|---|
| >1n2a_A Glutathione S-transferase; HET: GTS; 1.90A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 PDB: 1a0f_A* | Back alignment and structure |
|---|
| >1f2e_A Glutathione S-transferase; GST complexed with glutathione, thioredoxin superfamily fold transferase; HET: GSH; 2.30A {Sphingomonas paucimobilis} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3ik7_A Glutathione S-transferase A4; human GST A4-4, enzyme, cytoplasm, polymorphism; HET: BOB; 1.97A {Homo sapiens} PDB: 1gum_A 1gul_A* | Back alignment and structure |
|---|
| >4hz4_A Glutathione-S-transferase; enzyme function initiative; 1.62A {Actinobacillus pleuropneumoniae} | Back alignment and structure |
|---|
| >1ljr_A HGST T2-2, glutathione S-transferase; HET: GSH; 3.20A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 2ljr_A 3ljr_A* | Back alignment and structure |
|---|
| >4id0_A Glutathione S-transferase-like protein YIBF; GST, enzyme function initiative, structural genomics; HET: GSF; 1.10A {Pseudomonas fluorescens} PDB: 4ibp_A* | Back alignment and structure |
|---|
| >1oe8_A Glutathione S-transferase; schistosomiasis, detoxifying enzyme, prostaglandin D2 synthase, vaccine candidate; HET: GSH; 1.65A {Schistosoma haematobium} SCOP: a.45.1.1 c.47.1.5 PDB: 1oe7_A* 2c80_A* 2ca8_A* 2f8f_A* 2c8u_A 2caq_A* 2cai_A* 1u3i_A* | Back alignment and structure |
|---|
| >2dsa_A Glutathione S-transferase; HET: GSH HPX; 2.10A {Burkholderia xenovorans} PDB: 2gdr_A* | Back alignment and structure |
|---|
| >2wb9_A Glutathione transferase sigma class; thioredoxin fold; HET: GSH; 1.59A {Fasciola hepatica} PDB: 2wdu_A* | Back alignment and structure |
|---|
| >3m8n_A Possible glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, nysgxrc; 2.04A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >1m0u_A GST2 gene product; flight muscle protein, sigma, transferase; HET: GSH; 1.75A {Drosophila melanogaster} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >4ecj_A Glutathione S-transferase; transferase-like protein, transcription regulation; HET: GSH; 1.76A {Pseudomonas aeruginosa} PDB: 4eci_A* | Back alignment and structure |
|---|
| >1pmt_A PMGST, GST B1-1, glutathione transferase; glutathione-conjugating, A putative oxidoreduct; HET: GSH; 2.50A {Proteus mirabilis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pmt_A* | Back alignment and structure |
|---|
| >1aw9_A Glutathione S-transferase III; herbicide detoxification; 2.20A {Zea mays} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >1tw9_A Glutathione S-transferase 2; 1.71A {Heligmosomoides polygyrus} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >1dug_A Chimera of glutathione S-transferase-synthetic linker-C-terminal fibrinogen gamma...; gamma chain integrin fragment; HET: GSH; 1.80A {Schistosoma japonicum} SCOP: a.45.1.1 c.47.1.5 PDB: 1gne_A* 3qmz_T 1y6e_A 1m9a_A* 1gtb_A* 1gta_A* 1m99_A* 1m9b_A* 1ua5_A* 1u87_A* 1u88_A* 3crt_A* 3cru_A* 3d0z_A* | Back alignment and structure |
|---|
| >1nhy_A EF-1-gamma 1, elongation factor 1-gamma 1; protein synthesis, GST-like, translation; 3.00A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >4exj_A Uncharacterized protein; transferase-like protein, transcription regulation, transfer structural genomics; 1.64A {Lodderomyces elongisporus nrrl yb-4239} | Back alignment and structure |
|---|
| >2c4j_A Glutathione S-transferase MU 2; glutathione transferase, multigene family; HET: GSO; 1.35A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1xw5_A* 1ykc_A* 2ab6_A* 2gtu_A 3gtu_A 3gur_A* 1hna_A* 1hnb_A* 1hnc_A* 1xw6_A* 1xwk_A* 1yj6_A* 2f3m_A* 2dc5_A 1gtu_A 4gtu_A 6gsu_A* 6gsv_A* 6gsw_A* 2gst_A* ... | Back alignment and structure |
|---|
| >4ikh_A Glutathione S-transferase; enzyme function initiative, EFI, structural genomics; HET: GSH; 2.10A {Pseudomonas protegens} | Back alignment and structure |
|---|
| >2hnl_A Glutathione S-transferase 1; prostaglandin synthase, river BLI onchocerca volvulus, immune modulation; HET: GSH; 2.00A {Onchocerca volvulus} | Back alignment and structure |
|---|
| >2r4v_A XAP121, chloride intracellular channel protein 2; chloride intracellular channels, CLIC2, pore-forming protein ryanodine receptor, chloride channel; HET: GSH; 1.85A {Homo sapiens} PDB: 2r5g_A 2per_A* | Back alignment and structure |
|---|
| >2on5_A Nagst-2, Na glutathione S-transferase 2; hookworm; HET: GSH; 1.90A {Necator americanus} | Back alignment and structure |
|---|
| >2on7_A Nagst-1, Na glutathione S-transferase 1; hookworm; 2.40A {Necator americanus} | Back alignment and structure |
|---|
| >1zl9_A GST class-sigma, glutathione S-transferase 5; glutathione transferase, C.elegans; HET: GSH; 2.01A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1k3y_A GSTA1-1, glutathione S-transferase A1; S-hexyl glutatione, water structu transferase; HET: GTX; 1.30A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsf_A* 1guh_A* 1gsd_A* 1k3o_A 1k3l_A* 1pl1_A* 1pkz_A 1pkw_A* 2r6k_A* 1gse_A* 3u6v_A 1usb_A* 1ydk_A* 3q74_A 3ktl_A* 1pl2_A* 2r3x_A* 1xwg_A 3l0h_A* 1ags_A* ... | Back alignment and structure |
|---|
| >4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} | Back alignment and structure |
|---|
| >2ahe_A Chloride intracellular channel protein 4; glutathione-S-transferase superfamily, CLIC4, NCC27, chloride ION channel, metal transport; 1.80A {Homo sapiens} PDB: 2d2z_A | Back alignment and structure |
|---|
| >1okt_A Glutathione S-transferase; GST; 1.9A {Plasmodium falciparum} SCOP: a.45.1.1 c.47.1.5 PDB: 1pa3_A 1q4j_A* 3fr9_A* 3frc_A* 2aaw_A* 3fr6_A 3fr3_A* | Back alignment and structure |
|---|
| >1b8x_A Protein (AML-1B); nuclear matrix targeting signal protein, signal protein; 2.70A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >2ycd_A Glutathione S-transferase; SOIL bacteria, herbicide detoxification; HET: GTB; 1.40A {Agrobacterium tumefaciens} PDB: 3lq7_A | Back alignment and structure |
|---|
| >3fy7_A Chloride intracellular channel protein 3; GST, glutathione, CLIC, chloride channel, ION transport, ionic channel, nucleus, transport, gated channel; 1.95A {Homo sapiens} PDB: 3kjy_A | Back alignment and structure |
|---|
| >1b48_A GST, mgsta4-4, protein (glutathione S-transferase); subunit cooperativity; HET: HAG GSH; 2.60A {Mus musculus} SCOP: a.45.1.1 c.47.1.5 PDB: 1guk_A | Back alignment and structure |
|---|
| >1vf1_A Glutathione S-transferase 3; detoxification; HET: GSH; 1.77A {Gallus gallus} PDB: 1vf2_A* 1vf3_A* 1vf4_A | Back alignment and structure |
|---|
| >4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} | Back alignment and structure |
|---|
| >2c3n_A Glutathione S-transferase theta 1; glutathione transferase, polymorphism; 1.5A {Homo sapiens} PDB: 2c3q_A* 2c3t_A | Back alignment and structure |
|---|
| >2ws2_A NU-class GST, glutathione S-transferase; parasite, nematode; 2.01A {Haemonchus contortus} | Back alignment and structure |
|---|
| >1k0d_A URE2 protein; nitrate assimilation, structural genomics, gene regulation; HET: GSH; 2.20A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 PDB: 1jzr_A* 1k0b_A* 1k0c_A* 1k0a_A* 1g6w_A 1g6y_A 1hqo_A | Back alignment and structure |
|---|
| >3c8e_A YGHU, glutathione S-transferase homologue; glutathione transferase homologue, E. coli; HET: GSH; 1.50A {Escherichia coli} | Back alignment and structure |
|---|
| >3h1n_A Probable glutathione S-transferase; APC84167, bordetella bronchisepti structural genomics, PSI-2, protein structure initiative; 1.83A {Bordetella bronchiseptica RB50} | Back alignment and structure |
|---|
| >2yv7_A CG10997-PA, LD46306P, CLIC; dmclic, chloride ION channel, GST fold, metal transport; 1.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1bg5_A MAB, fusion protein of alpha-Na,K-ATPase with glutathione S-transferase; ankyrin binding, carrier crystallization, ION transport; 2.60A {Rattus norvegicus} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3ic8_A Uncharacterized GST-like proteinprotein; glutathione, transferase, PSI, MCSG, structural genomics; 2.40A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3ir4_A Glutaredoxin 2; glutathione, IDP00895, structural genomics, for structural genomics of infectious diseases, csgid, oxidoreductase; HET: MSE GSH; 1.20A {Salmonella enterica subsp} PDB: 1g7o_A | Back alignment and structure |
|---|
| >2yv9_A Chloride intracellular channel EXC-4; chloride ION channel, CLIC, GST fold, metal transport; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2fno_A AGR_PAT_752P; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics, JCSG; 2.00A {Agrobacterium tumefaciens} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3m1g_A Putative glutathione S-transferase; ECM4-like subfamily, GST_C family, structural genomics, PSI- protein structure initiative; 2.10A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >3ppu_A Glutathione-S-transferase; GST fold; HET: GSH; 2.30A {Phanerochaete chrysosporium} | Back alignment and structure |
|---|
| >4f03_A Glutathione transferase; GST fold; 1.80A {Phanerochaete chrysosporium} PDB: 4g19_A* | Back alignment and structure |
|---|
| >4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A | Back alignment and structure |
|---|
| >1z9h_A Membrane-associated prostaglandin E synthase-2; membran associated protein, indomethacin, isomerase; HET: IMN; 2.60A {Macaca fascicularis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pbj_A* | Back alignment and structure |
|---|
| >4fqu_A Putative glutathione transferase; glutathionyl-hydroquinone reductases, oxidoredu; 3.00A {Sphingobium chlorophenolicum} | Back alignment and structure |
|---|
| >4g0i_A Protein YQJG; glutathionyl-hydroquinone reductase, oxidoreductase; HET: MES; 2.05A {Escherichia coli} PDB: 3r3e_A* 4g0k_A* 4g0l_A* | Back alignment and structure |
|---|
| >2uz8_A Eukaryotic translation elongation factor 1 epsilon-1; protein biosynthesis, aminoacyl-tRNA synthetase, GST, nuclear protein, RNA-binding protein; HET: MSE; 2.0A {Homo sapiens} | Back alignment and structure |
|---|
| >2hra_A Glutamyl-tRNA synthetase, cytoplasmic; GST-fold, ligase; 1.90A {Saccharomyces cerevisiae} PDB: 2hrk_A 2hsm_A | Back alignment and structure |
|---|
| >2hsn_A Methionyl-tRNA synthetase, cytoplasmic; protein complex protein interaction GST-fold, ligase/RNA binding protein complex; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2hqt_A GU4 nucleic-binding protein 1; GST-fold, biosynthetic protein, RNA binding; 1.90A {Saccharomyces cerevisiae} SCOP: a.45.1.2 PDB: 2hrk_B 2hsm_B 2hsn_B | Back alignment and structure |
|---|
| >1fov_A Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53, electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 3grx_A* | Back alignment and structure |
|---|
| >2lqo_A Putative glutaredoxin RV3198.1/MT3292; TRX fold, oxidoreductase; NMR {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A* | Back alignment and structure |
|---|
| >2klx_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Bartonella henselae} | Back alignment and structure |
|---|
| >2khp_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Brucella melitensis} | Back alignment and structure |
|---|
| >3qmx_A Glutaredoxin A, glutaredoxin 3; electron transport; 1.82A {Synechocystis SP} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10 | Back alignment and structure |
|---|
| >3ic4_A Glutaredoxin (GRX-1); structural genomics, PSI, MCSG, protein structure initiative, midwest center for structural genomic oxidoreductase; 1.70A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1aba_A Glutaredoxin; electron transport; HET: MES; 1.45A {Enterobacteria phage T4} SCOP: c.47.1.1 PDB: 1aaz_A 1de1_A 1de2_A | Back alignment and structure |
|---|
| >1r7h_A NRDH-redoxin; thioredoxin, glutaredoxin, redox protein, domain swapping, electron transport; 2.69A {Corynebacterium ammoniagenes} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1t1v_A SH3BGRL3, SH3 domain-binding glutamic acid-rich protein-LIK; glutaredoxin, thioredoxin fold, protein 3D-structure, X-RAY crystallography; 1.60A {Mus musculus} SCOP: c.47.1.14 PDB: 1j0f_A 1sj6_A | Back alignment and structure |
|---|
| >3nzn_A Glutaredoxin; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics, rossmann fold; 1.10A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3h8q_A Thioredoxin reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC, developmental protein, differentiation; 2.21A {Homo sapiens} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3rhb_A ATGRXC5, glutaredoxin-C5, chloroplastic; thioredoxin fold, thiol-disulfide oxidoreductase, glutaredox oxidoreductase; HET: GSH; 1.20A {Arabidopsis thaliana} PDB: 3rhc_A* 3fz9_A* 3fza_A* | Back alignment and structure |
|---|
| >3zyw_A Glutaredoxin-3; metal binding protein; 1.84A {Homo sapiens} | Back alignment and structure |
|---|
| >1wik_A Thioredoxin-like protein 2; picot homology 2 domain, picot protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2cq9_A GLRX2 protein, glutaredoxin 2; glutathione-S-transferase, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ct6_A SH3 domain-binding glutamic acid-rich-like protein 2; SH3BGRL2,FASH3, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yan_A Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1kte_A Thioltransferase; redox-active center, electron transport, acetylation; 2.20A {Sus scrofa} SCOP: c.47.1.1 PDB: 1jhb_A 1b4q_A* | Back alignment and structure |
|---|
| >3ipz_A Monothiol glutaredoxin-S14, chloroplastic; electron transport, PL redox-active center, transit peptide, transport, oxidoreduc; 2.40A {Arabidopsis thaliana} PDB: 2lku_A | Back alignment and structure |
|---|
| >1ego_A Glutaredoxin; electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 1egr_A 1grx_A* 1qfn_A | Back alignment and structure |
|---|
| >2ht9_A Glutaredoxin-2; thioredoxin fold, iron-sulfur cluster, 2Fe2S, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: GSH; 1.90A {Homo sapiens} PDB: 2fls_A* | Back alignment and structure |
|---|
| >2wci_A Glutaredoxin-4; redox-active center, iron-sulfur cluster scaffolder, Fe2S2, homodimer, transport, glutathione, thioredoxin fold; HET: GSH; 1.90A {Escherichia coli} PDB: 1yka_A | Back alignment and structure |
|---|
| >3ctg_A Glutaredoxin-2; reduced form, electron transport, mitochondrion, redox-activ transit peptide, transport, oxidoreductase; 1.50A {Saccharomyces cerevisiae} PDB: 3ctf_A 3d4m_A 3d5j_A* | Back alignment and structure |
|---|
| >1h75_A Glutaredoxin-like protein NRDH; electron transport, thioredoxin, redox protein; 1.7A {Escherichia coli} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3c1r_A Glutaredoxin-1; oxidized form, oxidoreductase, cytoplasm, electron transport, redox-active center, transport; HET: MES; 2.00A {Saccharomyces cerevisiae} PDB: 3c1s_A* 2jac_A* | Back alignment and structure |
|---|
| >2hze_A Glutaredoxin-1; thioredoxin fold, arsenic, dimethylarsenite., electron trans oxidoreductase; 1.80A {Ectromelia virus} PDB: 2hzf_A 2hze_B | Back alignment and structure |
|---|
| >3l4n_A Monothiol glutaredoxin-6; C-terminal domain of GRX6, oxidoreductase; HET: GSH; 1.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3gx8_A Monothiol glutaredoxin-5, mitochondrial; TRX fold, electron transport, mitochondrion, redox-active center, transit peptide, transport; 1.67A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1u6t_A SH3 domain-binding glutamic acid-rich-like protein; SH3-binding, glutaredoxin, thioredoxin fold, crystallography, protein binding; HET: CIT; 1.90A {Homo sapiens} PDB: 1wry_A | Back alignment and structure |
|---|
| >2fgx_A Putative thioredoxin; NET3, NESG, GFT-glutaredoxin-like, structural genomics, PSI, protein structure initiative; NMR {Nitrosomonas europaea} | Back alignment and structure |
|---|
| >2kok_A Arsenate reductase; brucellosis, zoonotic, oxidoreductase, S genomics, seattle structural genomics center for infectious ssgcid; NMR {Brucella abortus} | Back alignment and structure |
|---|
| >1z3e_A Regulatory protein SPX; bacterial transcription regulation, disulfide stress; 1.50A {Bacillus subtilis} SCOP: c.47.1.12 PDB: 3gfk_A 3ihq_A | Back alignment and structure |
|---|
| >1ttz_A Conserved hypothetical protein; structural genomics, unknown function, PSI, protein structure initiative; 2.11A {Xanthomonas campestris} SCOP: c.47.1.1 PDB: 1xpv_A | Back alignment and structure |
|---|
| >2k8s_A Thioredoxin; dimer, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Nitrosomonas europaea} | Back alignment and structure |
|---|
| >2wul_A Glutaredoxin related protein 5; chromosome 14 open reading frame 87, oxidoreductase, thiored family, GLRX5, FLB4739; HET: GSH; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1wjk_A C330018D20RIK protein; glutaredoxin, thioredoxin fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2jad_A Yellow fluorescent protein glutaredoxin fusion protein; electron transport, redox- active center, yeast, GRX1P, transport; HET: PIA; 2.7A {Aequorea victoria} | Back alignment and structure |
|---|
| >2e7p_A Glutaredoxin; thioredoxin fold, poplar, electron transport; HET: GSH; 2.10A {Populus tremula x populus tremuloides} PDB: 1z7p_A 1z7r_A | Back alignment and structure |
|---|
| >3rdw_A Putative arsenate reductase; structural genomics, center for structural genomics of infec diseases, csgid, oxidoreductase; 2.20A {Yersinia pestis} | Back alignment and structure |
|---|
| >1rw1_A Conserved hypothetical protein YFFB; thioredoxin fold, structure 2 function project, S2F, structu genomics, unknown function; HET: MSE IPA; 1.02A {Pseudomonas aeruginosa} SCOP: c.47.1.12 | Back alignment and structure |
|---|
| >1s3c_A Arsenate reductase; ARSC, arsenite, oxidoreductase; 1.25A {Escherichia coli} PDB: 1sd9_A 1i9d_A 1j9b_A 1sd8_A 1jzw_A* 1sk1_A* 1sjz_A* 1sk0_A* 1sk2_A 1s3d_A | Back alignment and structure |
|---|
| >3fz4_A Putative arsenate reductase; APC61768, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.38A {Streptococcus mutans UA159} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3l78_A Regulatory protein SPX; transcription, transcriptional factor, disulfide bond, redox-active center, transcription regulati; 1.90A {Streptococcus mutans} SCOP: c.47.1.12 | Back alignment and structure |
|---|
| >2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* | Back alignment and structure |
|---|
| >3gkx_A Putative ARSC family related protein; ARSC family protein, structural genomi 2, protein structure initiative; 2.20A {Bacteroides fragilis} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3f0i_A Arsenate reductase; structural genomics, IDP01300, vibrio CH center for structural genomics of infectious diseases, CSGI oxidoreductase; HET: MSE; 1.88A {Vibrio cholerae} | Back alignment and structure |
|---|
| >2axo_A Hypothetical protein ATU2684; alpha beta protein., structural genomics, PSI, protein struc initiative; 1.80A {Agrobacterium tumefaciens str} SCOP: c.47.1.19 | Back alignment and structure |
|---|
| >1fo5_A Thioredoxin; disulfide oxidoreductase, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; NMR {Methanocaldococcus jannaschii} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3kp8_A Vkorc1/thioredoxin domain protein; blood coagulation, disulfide formation, redox partner, oxidoreductase; 1.66A {Synechococcus SP} | Back alignment and structure |
|---|
| >1nho_A Probable thioredoxin; beta sheet, alpha helix, oxidoreductase; NMR {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3kp9_A Vkorc1/thioredoxin domain protein; warfarin, disulfide formation, blood coagulation, oxidoreduc blood coagulation,oxidoreductase; HET: U10; 3.60A {Synechococcus SP} | Back alignment and structure |
|---|
| >2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 222 | ||||
| d1oyja1 | 145 | a.45.1.1 (A:86-230) Class tau GST {Rice (Oryza sat | 1e-32 | |
| d1gwca1 | 138 | a.45.1.1 (A:87-224) Class tau GST {Aegilops tausch | 3e-27 | |
| d1oyja2 | 84 | c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativ | 3e-26 | |
| d1gwca2 | 83 | c.47.1.5 (A:4-86) Class tau GST {Aegilops tauschii | 6e-20 | |
| d1eema2 | 98 | c.47.1.5 (A:5-102) Class omega GST {Human (Homo sa | 2e-19 | |
| d1eema1 | 139 | a.45.1.1 (A:103-241) Class omega GST {Human (Homo | 9e-19 | |
| d1e6ba2 | 80 | c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress | 8e-16 | |
| d1fw1a2 | 83 | c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapi | 1e-15 | |
| d1e6ba1 | 133 | a.45.1.1 (A:88-220) Class zeta GST {Mouse-ear cres | 2e-15 | |
| d1axda2 | 80 | c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), | 3e-15 | |
| d1r5aa2 | 85 | c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anoph | 3e-15 | |
| d1jlva2 | 84 | c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anoph | 6e-15 | |
| d1z9ha2 | 113 | c.47.1.5 (A:100-212) Microsomal prostaglandin E sy | 1e-14 | |
| d1fw1a1 | 125 | a.45.1.1 (A:88-212) Class zeta GST {Human (Homo sa | 3e-14 | |
| d1ljra2 | 79 | c.47.1.5 (A:1-79) Class theta GST {Human (Homo sap | 5e-14 | |
| d1aw9a2 | 81 | c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), | 8e-13 | |
| d1gnwa2 | 84 | c.47.1.5 (A:2-85) Class phi GST {Mouse-ear cress ( | 5e-12 | |
| d1k0ma2 | 86 | c.47.1.5 (A:6-91) Chloride intracellular channel 1 | 1e-11 | |
| d1pmta2 | 80 | c.47.1.5 (A:1-80) Class beta GST {Proteus mirabili | 2e-11 | |
| d1n2aa2 | 80 | c.47.1.5 (A:1-80) Class beta GST {Escherichia coli | 4e-11 | |
| d1k0da2 | 92 | c.47.1.5 (A:109-200) Yeast prion protein ure2p, ni | 5e-11 | |
| d1pmta1 | 121 | a.45.1.1 (A:81-201) Class beta GST {Proteus mirabi | 1e-10 | |
| d1g7oa2 | 75 | c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli | 1e-10 | |
| d1f2ea2 | 80 | c.47.1.5 (A:1-80) Class beta GST {Sphingomonas pau | 1e-10 | |
| d1v2aa2 | 83 | c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anoph | 5e-10 | |
| d1n2aa1 | 121 | a.45.1.1 (A:81-201) Class beta GST {Escherichia co | 5e-09 | |
| d2a2ra2 | 77 | c.47.1.5 (A:1-77) Class pi GST {Human (Homo sapien | 3e-08 | |
| d1f2ea1 | 121 | a.45.1.1 (A:81-201) Class beta GST {Sphingomonas p | 7e-08 | |
| d1v2aa1 | 125 | a.45.1.1 (A:84-208) Class delta GST {Mosquito (Ano | 3e-07 | |
| d2cvda1 | 124 | a.45.1.1 (A:76-199) Class sigma GST {Human (Homo s | 4e-07 | |
| d1jlva1 | 123 | a.45.1.1 (A:85-207) Class delta GST {Mosquito (Ano | 4e-07 | |
| d2cvda2 | 74 | c.47.1.5 (A:2-75) Class sigma GST {Human (Homo sap | 5e-07 | |
| d1b48a2 | 78 | c.47.1.5 (A:2-79) Class alpha GST {Mouse (Mus musc | 6e-07 | |
| d1tw9a2 | 77 | c.47.1.5 (A:1-77) Class sigma GST {Heligmosomoides | 1e-06 | |
| d2gsta1 | 133 | a.45.1.1 (A:85-217) Class mu GST {Rat (Rattus norv | 2e-06 | |
| d1nhya1 | 144 | a.45.1.1 (A:76-219) GST-like domain of elongation | 2e-06 | |
| d1k3ya2 | 79 | c.47.1.5 (A:2-80) Class alpha GST {Human (Homo sap | 4e-06 | |
| d1k0ma1 | 149 | a.45.1.1 (A:92-240) Chloride intracellular channel | 4e-06 | |
| d2a2ra1 | 132 | a.45.1.1 (A:78-209) Class pi GST {Human (Homo sapi | 6e-06 | |
| d1gula2 | 77 | c.47.1.5 (A:4-80) Class alpha GST {Human (Homo sap | 6e-06 | |
| d1tu7a2 | 77 | c.47.1.5 (A:1-77) Class pi GST {Onchocerca volvulu | 6e-06 | |
| d2gsqa1 | 127 | a.45.1.1 (A:76-202) Class sigma GST {Squid (Ommast | 7e-06 | |
| d1gsua1 | 133 | a.45.1.1 (A:85-217) Class mu GST {Chicken (Gallus | 1e-05 | |
| d1m0ua2 | 76 | c.47.1.5 (A:47-122) Class sigma GST {Fruit fly (Dr | 1e-05 | |
| d1tw9a1 | 129 | a.45.1.1 (A:78-206) Class sigma GST {Heligmosomoid | 2e-05 | |
| d2c4ja1 | 133 | a.45.1.1 (A:86-218) Class mu GST {Human (Homo sapi | 2e-05 | |
| d2c4ja2 | 84 | c.47.1.5 (A:2-85) Class mu GST {Human (Homo sapien | 2e-05 | |
| d1z9ha1 | 161 | a.45.1.1 (A:213-373) Microsomal prostaglandin E sy | 2e-05 | |
| d1b48a1 | 143 | a.45.1.1 (A:80-222) Class alpha GST {Mouse (Mus mu | 3e-05 | |
| d1r5aa1 | 129 | a.45.1.1 (A:87-215) Class delta GST {Mosquito (Ano | 3e-05 | |
| d1k3ya1 | 142 | a.45.1.1 (A:81-222) Class alpha GST {Human (Homo s | 4e-05 | |
| d1gula1 | 140 | a.45.1.1 (A:81-220) Class alpha GST {Human (Homo s | 5e-05 | |
| d1m0ua1 | 127 | a.45.1.1 (A:123-249) Class sigma GST {Fruit fly (D | 6e-05 | |
| d1okta2 | 85 | c.47.1.5 (A:1-85) Pf GST {Malarial parasite (Plasm | 8e-05 | |
| d1k0da1 | 151 | a.45.1.1 (A:201-351) Yeast prion protein ure2p, ni | 9e-05 | |
| d1fhea2 | 80 | c.47.1.5 (A:1-80) Class alpha GST {Fasciola hepati | 1e-04 | |
| d2gsqa2 | 75 | c.47.1.5 (A:1-75) Class sigma GST {Squid (Ommastre | 1e-04 | |
| d1jlwa1 | 127 | a.45.1.1 (A:91-217) Class delta GST {Mosquito (Ano | 2e-04 | |
| d1duga1 | 140 | a.45.1.1 (A:81-220) Class alpha GST {Schistosoma j | 2e-04 | |
| d1tu7a1 | 131 | a.45.1.1 (A:78-208) Class pi GST {Onchocerca volvu | 4e-04 | |
| d2fhea1 | 136 | a.45.1.1 (A:81-216) Class alpha GST {Fasciola hepa | 4e-04 | |
| d1ljra1 | 165 | a.45.1.1 (A:80-244) Class theta GST {Human (Homo s | 5e-04 | |
| d1nhya2 | 75 | c.47.1.5 (A:1-75) GST-like domain of elongation fa | 5e-04 | |
| d1okta1 | 126 | a.45.1.1 (A:86-211) Pf GST {Malarial parasite (Pla | 0.002 | |
| d1axda1 | 129 | a.45.1.1 (A:81-210) Class phi GST {Maize (Zea mays | 0.003 |
| >d1oyja1 a.45.1.1 (A:86-230) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} Length = 145 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: GST C-terminal domain-like superfamily: GST C-terminal domain-like family: Glutathione S-transferase (GST), C-terminal domain domain: Class tau GST species: Rice (Oryza sativa) [TaxId: 4530]
Score = 113 bits (284), Expect = 1e-32
Identities = 41/141 (29%), Positives = 59/141 (41%), Gaps = 6/141 (4%)
Query: 81 QNPLLPDDPYERANARFWAKFFDEKCVPEVMGAFASKGEEQEKAAK-ARENLKMLERALE 139
N D Y RA ARFWA + D K + KGE Q A + E L+ LE L
Sbjct: 5 ANSGDADAAYARATARFWADYVDRKLYDCGSRLWRLKGEPQAAAGREMAEILRTLEAELG 64
Query: 140 GKPFFGG---DKIGFLDIAVGWIGIWGRIVEEIAGVSLIDAETMPLLTAWLNNFLEVPVI 196
+ FFGG ++GF+D+A+ W E G S+ + P L AW + +
Sbjct: 65 DREFFGGGGGGRLGFVDVALVPFTAWFYSYERCGGFSVEE--VAPRLAAWARRCGRIDSV 122
Query: 197 KACIPSWHELLEHNKGFHKIL 217
+PS ++ + K
Sbjct: 123 VKHLPSPEKVYDFVGVLKKKY 143
|
| >d1gwca1 a.45.1.1 (A:87-224) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} Length = 138 | Back information, alignment and structure |
|---|
| >d1oyja2 c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} Length = 84 | Back information, alignment and structure |
|---|
| >d1gwca2 c.47.1.5 (A:4-86) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} Length = 83 | Back information, alignment and structure |
|---|
| >d1eema2 c.47.1.5 (A:5-102) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1eema1 a.45.1.1 (A:103-241) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} Length = 139 | Back information, alignment and structure |
|---|
| >d1e6ba2 c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 | Back information, alignment and structure |
|---|
| >d1fw1a2 c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} Length = 83 | Back information, alignment and structure |
|---|
| >d1e6ba1 a.45.1.1 (A:88-220) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 133 | Back information, alignment and structure |
|---|
| >d1axda2 c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} Length = 80 | Back information, alignment and structure |
|---|
| >d1r5aa2 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} Length = 85 | Back information, alignment and structure |
|---|
| >d1jlva2 c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} Length = 84 | Back information, alignment and structure |
|---|
| >d1z9ha2 c.47.1.5 (A:100-212) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} Length = 113 | Back information, alignment and structure |
|---|
| >d1fw1a1 a.45.1.1 (A:88-212) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d1ljra2 c.47.1.5 (A:1-79) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1aw9a2 c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} Length = 81 | Back information, alignment and structure |
|---|
| >d1gnwa2 c.47.1.5 (A:2-85) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 84 | Back information, alignment and structure |
|---|
| >d1k0ma2 c.47.1.5 (A:6-91) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} Length = 86 | Back information, alignment and structure |
|---|
| >d1pmta2 c.47.1.5 (A:1-80) Class beta GST {Proteus mirabilis [TaxId: 584]} Length = 80 | Back information, alignment and structure |
|---|
| >d1n2aa2 c.47.1.5 (A:1-80) Class beta GST {Escherichia coli [TaxId: 562]} Length = 80 | Back information, alignment and structure |
|---|
| >d1k0da2 c.47.1.5 (A:109-200) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 92 | Back information, alignment and structure |
|---|
| >d1pmta1 a.45.1.1 (A:81-201) Class beta GST {Proteus mirabilis [TaxId: 584]} Length = 121 | Back information, alignment and structure |
|---|
| >d1g7oa2 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} Length = 75 | Back information, alignment and structure |
|---|
| >d1f2ea2 c.47.1.5 (A:1-80) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} Length = 80 | Back information, alignment and structure |
|---|
| >d1v2aa2 c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} Length = 83 | Back information, alignment and structure |
|---|
| >d1n2aa1 a.45.1.1 (A:81-201) Class beta GST {Escherichia coli [TaxId: 562]} Length = 121 | Back information, alignment and structure |
|---|
| >d2a2ra2 c.47.1.5 (A:1-77) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} Length = 77 | Back information, alignment and structure |
|---|
| >d1f2ea1 a.45.1.1 (A:81-201) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} Length = 121 | Back information, alignment and structure |
|---|
| >d1v2aa1 a.45.1.1 (A:84-208) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} Length = 125 | Back information, alignment and structure |
|---|
| >d2cvda1 a.45.1.1 (A:76-199) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} Length = 124 | Back information, alignment and structure |
|---|
| >d1jlva1 a.45.1.1 (A:85-207) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} Length = 123 | Back information, alignment and structure |
|---|
| >d2cvda2 c.47.1.5 (A:2-75) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
| >d1b48a2 c.47.1.5 (A:2-79) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} Length = 78 | Back information, alignment and structure |
|---|
| >d1tw9a2 c.47.1.5 (A:1-77) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} Length = 77 | Back information, alignment and structure |
|---|
| >d2gsta1 a.45.1.1 (A:85-217) Class mu GST {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 133 | Back information, alignment and structure |
|---|
| >d1nhya1 a.45.1.1 (A:76-219) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 144 | Back information, alignment and structure |
|---|
| >d1k3ya2 c.47.1.5 (A:2-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1k0ma1 a.45.1.1 (A:92-240) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} Length = 149 | Back information, alignment and structure |
|---|
| >d2a2ra1 a.45.1.1 (A:78-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} Length = 132 | Back information, alignment and structure |
|---|
| >d1gula2 c.47.1.5 (A:4-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Length = 77 | Back information, alignment and structure |
|---|
| >d1tu7a2 c.47.1.5 (A:1-77) Class pi GST {Onchocerca volvulus [TaxId: 6282]} Length = 77 | Back information, alignment and structure |
|---|
| >d2gsqa1 a.45.1.1 (A:76-202) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} Length = 127 | Back information, alignment and structure |
|---|
| >d1gsua1 a.45.1.1 (A:85-217) Class mu GST {Chicken (Gallus gallus) [TaxId: 9031]} Length = 133 | Back information, alignment and structure |
|---|
| >d1m0ua2 c.47.1.5 (A:47-122) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 76 | Back information, alignment and structure |
|---|
| >d1tw9a1 a.45.1.1 (A:78-206) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} Length = 129 | Back information, alignment and structure |
|---|
| >d2c4ja1 a.45.1.1 (A:86-218) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Length = 133 | Back information, alignment and structure |
|---|
| >d2c4ja2 c.47.1.5 (A:2-85) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
| >d1z9ha1 a.45.1.1 (A:213-373) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} Length = 161 | Back information, alignment and structure |
|---|
| >d1b48a1 a.45.1.1 (A:80-222) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} Length = 143 | Back information, alignment and structure |
|---|
| >d1r5aa1 a.45.1.1 (A:87-215) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} Length = 129 | Back information, alignment and structure |
|---|
| >d1k3ya1 a.45.1.1 (A:81-222) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Length = 142 | Back information, alignment and structure |
|---|
| >d1gula1 a.45.1.1 (A:81-220) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Length = 140 | Back information, alignment and structure |
|---|
| >d1m0ua1 a.45.1.1 (A:123-249) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 127 | Back information, alignment and structure |
|---|
| >d1okta2 c.47.1.5 (A:1-85) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 85 | Back information, alignment and structure |
|---|
| >d1k0da1 a.45.1.1 (A:201-351) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 151 | Back information, alignment and structure |
|---|
| >d1fhea2 c.47.1.5 (A:1-80) Class alpha GST {Fasciola hepatica [TaxId: 6192]} Length = 80 | Back information, alignment and structure |
|---|
| >d2gsqa2 c.47.1.5 (A:1-75) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} Length = 75 | Back information, alignment and structure |
|---|
| >d1jlwa1 a.45.1.1 (A:91-217) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-4 [TaxId: 123217]} Length = 127 | Back information, alignment and structure |
|---|
| >d1duga1 a.45.1.1 (A:81-220) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} Length = 140 | Back information, alignment and structure |
|---|
| >d1tu7a1 a.45.1.1 (A:78-208) Class pi GST {Onchocerca volvulus [TaxId: 6282]} Length = 131 | Back information, alignment and structure |
|---|
| >d2fhea1 a.45.1.1 (A:81-216) Class alpha GST {Fasciola hepatica [TaxId: 6192]} Length = 136 | Back information, alignment and structure |
|---|
| >d1ljra1 a.45.1.1 (A:80-244) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} Length = 165 | Back information, alignment and structure |
|---|
| >d1nhya2 c.47.1.5 (A:1-75) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 75 | Back information, alignment and structure |
|---|
| >d1okta1 a.45.1.1 (A:86-211) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 126 | Back information, alignment and structure |
|---|
| >d1axda1 a.45.1.1 (A:81-210) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} Length = 129 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 222 | |||
| d1oyja2 | 84 | Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} | 99.9 | |
| d1eema2 | 98 | Class omega GST {Human (Homo sapiens) [TaxId: 9606 | 99.9 | |
| d1aw9a2 | 81 | Class phi GST {Maize (Zea mays), type III [TaxId: | 99.89 | |
| d1e6ba2 | 80 | Class zeta GST {Mouse-ear cress (Arabidopsis thali | 99.89 | |
| d1v2aa2 | 83 | Class delta GST {Mosquito (Anopheles dirus b), iso | 99.89 | |
| d1gwca1 | 138 | Class tau GST {Aegilops tauschii, also known as Tr | 99.89 | |
| d1jlva2 | 84 | Class delta GST {Mosquito (Anopheles dirus b), iso | 99.88 | |
| d1fw1a2 | 83 | Class zeta GST {Human (Homo sapiens) [TaxId: 9606] | 99.88 | |
| d1axda2 | 80 | Class phi GST {Maize (Zea mays), type I [TaxId: 45 | 99.88 | |
| d1r5aa2 | 85 | Class delta GST {Mosquito (Anopheles dirus b), iso | 99.88 | |
| d1gnwa2 | 84 | Class phi GST {Mouse-ear cress (Arabidopsis thalia | 99.87 | |
| d1ljra2 | 79 | Class theta GST {Human (Homo sapiens) [TaxId: 9606 | 99.86 | |
| d1gwca2 | 83 | Class tau GST {Aegilops tauschii, also known as Tr | 99.86 | |
| d1k0da2 | 92 | Yeast prion protein ure2p, nitrogen regulation fra | 99.85 | |
| d1oyja1 | 145 | Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} | 99.85 | |
| d1k0ma2 | 86 | Chloride intracellular channel 1 (clic1) {Human (H | 99.85 | |
| d1eema1 | 139 | Class omega GST {Human (Homo sapiens) [TaxId: 9606 | 99.84 | |
| d1g7oa2 | 75 | Glutaredoxin 2 {Escherichia coli [TaxId: 562]} | 99.83 | |
| d2gsqa2 | 75 | Class sigma GST {Squid (Ommastrephes sloani pacifi | 99.83 | |
| d2cvda2 | 74 | Class sigma GST {Human (Homo sapiens) [TaxId: 9606 | 99.83 | |
| d2a2ra2 | 77 | Class pi GST {Human (Homo sapiens) [TaxId: 9606]} | 99.82 | |
| d1pmta2 | 80 | Class beta GST {Proteus mirabilis [TaxId: 584]} | 99.81 | |
| d1gula2 | 77 | Class alpha GST {Human (Homo sapiens), (a1-1) [Tax | 99.81 | |
| d1f2ea2 | 80 | Class beta GST {Sphingomonas paucimobilis [TaxId: | 99.81 | |
| d1tu7a2 | 77 | Class pi GST {Onchocerca volvulus [TaxId: 6282]} | 99.81 | |
| d3gtub1 | 140 | Class mu GST {Human (Homo sapiens) [TaxId: 9606]} | 99.8 | |
| d1b48a2 | 78 | Class alpha GST {Mouse (Mus musculus), (a1-4) [Tax | 99.8 | |
| d1n2aa2 | 80 | Class beta GST {Escherichia coli [TaxId: 562]} | 99.8 | |
| d2c4ja2 | 84 | Class mu GST {Human (Homo sapiens) [TaxId: 9606]} | 99.8 | |
| d1okta2 | 85 | Pf GST {Malarial parasite (Plasmodium falciparum) | 99.8 | |
| d1k3ya2 | 79 | Class alpha GST {Human (Homo sapiens), (a1-1) [Tax | 99.79 | |
| d1axda1 | 129 | Class phi GST {Maize (Zea mays), type I [TaxId: 45 | 99.79 | |
| d2gsta1 | 133 | Class mu GST {Rat (Rattus norvegicus) [TaxId: 1011 | 99.79 | |
| d1n2aa1 | 121 | Class beta GST {Escherichia coli [TaxId: 562]} | 99.79 | |
| d1gsua1 | 133 | Class mu GST {Chicken (Gallus gallus) [TaxId: 9031 | 99.78 | |
| d2c4ja1 | 133 | Class mu GST {Human (Homo sapiens) [TaxId: 9606]} | 99.78 | |
| d1ljra1 | 165 | Class theta GST {Human (Homo sapiens) [TaxId: 9606 | 99.78 | |
| d1m0ua2 | 76 | Class sigma GST {Fruit fly (Drosophila melanogaste | 99.78 | |
| d1fw1a1 | 125 | Class zeta GST {Human (Homo sapiens) [TaxId: 9606] | 99.78 | |
| d1f2ea1 | 121 | Class beta GST {Sphingomonas paucimobilis [TaxId: | 99.78 | |
| d1tw9a2 | 77 | Class sigma GST {Heligmosomoides polygyrus [TaxId: | 99.78 | |
| d1duga1 | 140 | Class alpha GST {Schistosoma japonicum [TaxId: 618 | 99.77 | |
| d1pmta1 | 121 | Class beta GST {Proteus mirabilis [TaxId: 584]} | 99.77 | |
| d2cvda1 | 124 | Class sigma GST {Human (Homo sapiens) [TaxId: 9606 | 99.77 | |
| d1jlwa1 | 127 | Class delta GST {Mosquito (Anopheles dirus b), iso | 99.76 | |
| d1nhya1 | 144 | GST-like domain of elongation factor 1-gamma {Bake | 99.76 | |
| d2fhea1 | 136 | Class alpha GST {Fasciola hepatica [TaxId: 6192]} | 99.76 | |
| d1k3ya1 | 142 | Class alpha GST {Human (Homo sapiens), (a1-1) [Tax | 99.76 | |
| d2a2ra1 | 132 | Class pi GST {Human (Homo sapiens) [TaxId: 9606]} | 99.75 | |
| d1aw9a1 | 135 | Class phi GST {Maize (Zea mays), type III [TaxId: | 99.75 | |
| d1r5aa1 | 129 | Class delta GST {Mosquito (Anopheles dirus b), iso | 99.75 | |
| d1v2aa1 | 125 | Class delta GST {Mosquito (Anopheles dirus b), iso | 99.75 | |
| d1m0ua1 | 127 | Class sigma GST {Fruit fly (Drosophila melanogaste | 99.75 | |
| d1e6ba1 | 133 | Class zeta GST {Mouse-ear cress (Arabidopsis thali | 99.74 | |
| d1jlva1 | 123 | Class delta GST {Mosquito (Anopheles dirus b), iso | 99.74 | |
| d1b48a1 | 143 | Class alpha GST {Mouse (Mus musculus), (a1-4) [Tax | 99.74 | |
| d2gsqa1 | 127 | Class sigma GST {Squid (Ommastrephes sloani pacifi | 99.74 | |
| d1gnwa1 | 126 | Class phi GST {Mouse-ear cress (Arabidopsis thalia | 99.73 | |
| d1duga2 | 80 | Class alpha GST {Schistosoma japonicum [TaxId: 618 | 99.73 | |
| d1gula1 | 140 | Class alpha GST {Human (Homo sapiens), (a1-1) [Tax | 99.73 | |
| d2fnoa2 | 87 | Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobac | 99.73 | |
| d1fhea2 | 80 | Class alpha GST {Fasciola hepatica [TaxId: 6192]} | 99.72 | |
| d1k0da1 | 151 | Yeast prion protein ure2p, nitrogen regulation fra | 99.72 | |
| d1z9ha2 | 113 | Microsomal prostaglandin E synthase-2 {Crab-eating | 99.72 | |
| d1tw9a1 | 129 | Class sigma GST {Heligmosomoides polygyrus [TaxId: | 99.68 | |
| d1tu7a1 | 131 | Class pi GST {Onchocerca volvulus [TaxId: 6282]} | 99.67 | |
| d1okta1 | 126 | Pf GST {Malarial parasite (Plasmodium falciparum) | 99.66 | |
| d1nhya2 | 75 | GST-like domain of elongation factor 1-gamma {Bake | 99.64 | |
| d1oe8a2 | 81 | Class alpha GST {Blood fluke (Schistosoma haematob | 99.63 | |
| d1oe8a1 | 123 | Class alpha GST {Blood fluke (Schistosoma haematob | 99.61 | |
| d1k0ma1 | 149 | Chloride intracellular channel 1 (clic1) {Human (H | 99.56 | |
| d2hrkb1 | 118 | GU4 nucleic-binding protein 1, Arc1p {Baker's yeas | 99.42 | |
| d1nm3a1 | 74 | C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus | 99.09 | |
| d1z9ha1 | 161 | Microsomal prostaglandin E synthase-2 {Crab-eating | 98.88 | |
| d1r7ha_ | 74 | Glutaredoxin-like NRDH-redoxin {Corynebacterium am | 98.78 | |
| d1fova_ | 82 | Glutaredoxin (Grx, thioltransferase) {Escherichia | 98.78 | |
| d1h75a_ | 76 | Glutaredoxin-like NRDH-redoxin {Escherichia coli [ | 98.71 | |
| d1wika_ | 109 | Thioredoxin-like protein 2 {Mouse (Mus musculus) [ | 98.0 | |
| d1abaa_ | 87 | Glutaredoxin (Grx, thioltransferase) {Bacteriophag | 98.0 | |
| d1egoa_ | 85 | Glutaredoxin (Grx, thioltransferase) {Escherichia | 97.97 | |
| d1t1va_ | 93 | SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} | 97.92 | |
| d1ktea_ | 105 | Glutaredoxin (Grx, thioltransferase) {Pig (Sus scr | 97.82 | |
| d1wjka_ | 100 | Thioredoxin-like structure containing protein C330 | 97.72 | |
| d2fnoa1 | 149 | Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobac | 97.53 | |
| d1ttza_ | 75 | Hypothetical protein XCC2852 {Xanthomonas campestr | 97.4 | |
| d1g7oa1 | 140 | Glutaredoxin 2 {Escherichia coli [TaxId: 562]} | 96.45 | |
| d1z3ea1 | 114 | Regulatory protein Spx {Bacillus subtilis [TaxId: | 95.5 | |
| d1rw1a_ | 114 | Hypothetical protein PA3664 (YffB) {Pseudomonas ae | 95.1 | |
| d1hyua4 | 96 | Alkyl hydroperoxide reductase subunit F (AhpF), N- | 93.69 | |
| d1j9ba_ | 138 | Arsenate reductase ArsC {Escherichia coli [TaxId: | 93.28 | |
| d1iloa_ | 77 | MTH985, a thioredoxin {Archaeon Methanobacterium t | 92.1 | |
| d1fo5a_ | 85 | MJ0307, thioredoxin/glutaredoxin-like protein {Arc | 88.64 | |
| d1nhoa_ | 85 | MTH807, thioredoxin/glutaredoxin-like protein {Arc | 87.34 |
| >d1oyja2 c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Thioredoxin fold superfamily: Thioredoxin-like family: Glutathione S-transferase (GST), N-terminal domain domain: Class tau GST species: Rice (Oryza sativa) [TaxId: 4530]
Probab=99.90 E-value=5.5e-24 Score=137.09 Aligned_cols=80 Identities=51% Similarity=0.938 Sum_probs=75.4
Q ss_pred CcceEEeeccCCchHHHHHHHHHHhCCCceEEeCCCCCCchhhhhhCCCCCcccEEEeCCeecchHHHHHHHHHhhCCCC
Q 027498 3 EESVKLLGYWASPFALRVKWALKLKGVHYEYVEENLPNKSPLLLRYNPVYKKIPVLVHNGKPLAESLLIIEYIDEAWKQN 82 (222)
Q Consensus 3 ~~~~~L~~~~~s~~~~~vr~~L~~~gi~~~~~~~~~~~~~~~~~~~~p~~~~vP~l~~~~~~i~es~~I~~yL~~~~~~~ 82 (222)
+.+++||++..||||+|||++|.++||+|+.+.++...+.+++.+.||.+|+||+|++||..+.||.+|++||++.||++
T Consensus 3 ~~~l~Ly~~~~Sp~~~rvr~~L~~kgi~~e~~~v~~~~~~~~~~~~nP~~g~vP~L~~~g~~l~eS~~I~~YL~e~~P~~ 82 (84)
T d1oyja2 3 EKELVLLDFWVSPFGQRCRIAMAEKGLEFEYREEDLGNKSDLLLRSNPVHRKIPVLLHAGRPVSESLVILQYLDDAFPGT 82 (84)
T ss_dssp SCCEEEEECTTCHHHHHHHHHHHHHTCCCEEEECCTTSCCHHHHHHSTTTCCSCEEEETTEEEESHHHHHHHHHHHCTTS
T ss_pred CCceEEEcCCCChHHHHHHHHHHHcCCCcEEEEEccCcCCHHHHhhCCCcCcccEEEECCceEEcHHHHHHHHHHHCCCC
Confidence 35799999999999999999999999999999999998899999999964899999999999999999999999999865
|
| >d1eema2 c.47.1.5 (A:5-102) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1aw9a2 c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1e6ba2 c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1v2aa2 c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1gwca1 a.45.1.1 (A:87-224) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} | Back information, alignment and structure |
|---|
| >d1jlva2 c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1fw1a2 c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1axda2 c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1r5aa2 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1gnwa2 c.47.1.5 (A:2-85) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1ljra2 c.47.1.5 (A:1-79) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gwca2 c.47.1.5 (A:4-86) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} | Back information, alignment and structure |
|---|
| >d1k0da2 c.47.1.5 (A:109-200) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1oyja1 a.45.1.1 (A:86-230) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1k0ma2 c.47.1.5 (A:6-91) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1eema1 a.45.1.1 (A:103-241) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g7oa2 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2gsqa2 c.47.1.5 (A:1-75) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} | Back information, alignment and structure |
|---|
| >d2cvda2 c.47.1.5 (A:2-75) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2a2ra2 c.47.1.5 (A:1-77) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pmta2 c.47.1.5 (A:1-80) Class beta GST {Proteus mirabilis [TaxId: 584]} | Back information, alignment and structure |
|---|
| >d1gula2 c.47.1.5 (A:4-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f2ea2 c.47.1.5 (A:1-80) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} | Back information, alignment and structure |
|---|
| >d1tu7a2 c.47.1.5 (A:1-77) Class pi GST {Onchocerca volvulus [TaxId: 6282]} | Back information, alignment and structure |
|---|
| >d3gtub1 a.45.1.1 (B:85-224) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b48a2 c.47.1.5 (A:2-79) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1n2aa2 c.47.1.5 (A:1-80) Class beta GST {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2c4ja2 c.47.1.5 (A:2-85) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1okta2 c.47.1.5 (A:1-85) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1k3ya2 c.47.1.5 (A:2-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1axda1 a.45.1.1 (A:81-210) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d2gsta1 a.45.1.1 (A:85-217) Class mu GST {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1n2aa1 a.45.1.1 (A:81-201) Class beta GST {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gsua1 a.45.1.1 (A:85-217) Class mu GST {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2c4ja1 a.45.1.1 (A:86-218) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ljra1 a.45.1.1 (A:80-244) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m0ua2 c.47.1.5 (A:47-122) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1fw1a1 a.45.1.1 (A:88-212) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f2ea1 a.45.1.1 (A:81-201) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} | Back information, alignment and structure |
|---|
| >d1tw9a2 c.47.1.5 (A:1-77) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} | Back information, alignment and structure |
|---|
| >d1duga1 a.45.1.1 (A:81-220) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} | Back information, alignment and structure |
|---|
| >d1pmta1 a.45.1.1 (A:81-201) Class beta GST {Proteus mirabilis [TaxId: 584]} | Back information, alignment and structure |
|---|
| >d2cvda1 a.45.1.1 (A:76-199) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jlwa1 a.45.1.1 (A:91-217) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-4 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1nhya1 a.45.1.1 (A:76-219) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2fhea1 a.45.1.1 (A:81-216) Class alpha GST {Fasciola hepatica [TaxId: 6192]} | Back information, alignment and structure |
|---|
| >d1k3ya1 a.45.1.1 (A:81-222) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2a2ra1 a.45.1.1 (A:78-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1aw9a1 a.45.1.1 (A:83-217) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1r5aa1 a.45.1.1 (A:87-215) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1v2aa1 a.45.1.1 (A:84-208) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1m0ua1 a.45.1.1 (A:123-249) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1e6ba1 a.45.1.1 (A:88-220) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1jlva1 a.45.1.1 (A:85-207) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1b48a1 a.45.1.1 (A:80-222) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2gsqa1 a.45.1.1 (A:76-202) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} | Back information, alignment and structure |
|---|
| >d1gnwa1 a.45.1.1 (A:86-211) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1duga2 c.47.1.5 (A:1-80) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} | Back information, alignment and structure |
|---|
| >d1gula1 a.45.1.1 (A:81-220) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fnoa2 c.47.1.5 (A:1-87) Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1fhea2 c.47.1.5 (A:1-80) Class alpha GST {Fasciola hepatica [TaxId: 6192]} | Back information, alignment and structure |
|---|
| >d1k0da1 a.45.1.1 (A:201-351) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1z9ha2 c.47.1.5 (A:100-212) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} | Back information, alignment and structure |
|---|
| >d1tw9a1 a.45.1.1 (A:78-206) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} | Back information, alignment and structure |
|---|
| >d1tu7a1 a.45.1.1 (A:78-208) Class pi GST {Onchocerca volvulus [TaxId: 6282]} | Back information, alignment and structure |
|---|
| >d1okta1 a.45.1.1 (A:86-211) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1nhya2 c.47.1.5 (A:1-75) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1oe8a2 c.47.1.5 (A:4-84) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} | Back information, alignment and structure |
|---|
| >d1oe8a1 a.45.1.1 (A:85-207) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} | Back information, alignment and structure |
|---|
| >d1k0ma1 a.45.1.1 (A:92-240) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hrkb1 a.45.1.2 (B:4-121) GU4 nucleic-binding protein 1, Arc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nm3a1 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1z9ha1 a.45.1.1 (A:213-373) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} | Back information, alignment and structure |
|---|
| >d1r7ha_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Corynebacterium ammoniagenes [TaxId: 1697]} | Back information, alignment and structure |
|---|
| >d1fova_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli, Grx3 [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1h75a_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wika_ c.47.1.1 (A:) Thioredoxin-like protein 2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1abaa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1egoa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1t1va_ c.47.1.14 (A:) SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ktea_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1wjka_ c.47.1.1 (A:) Thioredoxin-like structure containing protein C330018D20Rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2fnoa1 a.45.1.1 (A:88-236) Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1ttza_ c.47.1.1 (A:) Hypothetical protein XCC2852 {Xanthomonas campestris [TaxId: 339]} | Back information, alignment and structure |
|---|
| >d1g7oa1 a.45.1.1 (A:76-215) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1z3ea1 c.47.1.12 (A:1-114) Regulatory protein Spx {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1rw1a_ c.47.1.12 (A:) Hypothetical protein PA3664 (YffB) {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1hyua4 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1j9ba_ c.47.1.12 (A:) Arsenate reductase ArsC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1iloa_ c.47.1.1 (A:) MTH985, a thioredoxin {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1fo5a_ c.47.1.1 (A:) MJ0307, thioredoxin/glutaredoxin-like protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1nhoa_ c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-like protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|