Citrus Sinensis ID: 027498


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220--
MAEESVKLLGYWASPFALRVKWALKLKGVHYEYVEENLPNKSPLLLRYNPVYKKIPVLVHNGKPLAESLLIIEYIDEAWKQNPLLPDDPYERANARFWAKFFDEKCVPEVMGAFASKGEEQEKAAKARENLKMLERALEGKPFFGGDKIGFLDIAVGWIGIWGRIVEEIAGVSLIDAETMPLLTAWLNNFLEVPVIKACIPSWHELLEHNKGFHKILTGSST
cccccEEEEcccccHHHHHHHHHHHHccccccEEEcccccccHHHHHHccccccccEEEEccEEEcHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHcccc
cccccEEEEEccccHHHHHHHHHHHHHccccEEEEcccccccHHHHHHccccccccEEEEccEEEEcHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHcHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccEccEccccHHHHHHHccHHHHHHHHHHHccccccccccHHHHHHHHHHHHcHHHHHHcccHHHHHHHHHHHHHHHccccc
MAEESVKLLGYWASPFALRVKWALKLKGVHYEyveenlpnksplllrynpvykkipvlvhngkplaESLLIIEYIDEAwkqnpllpddpyerANARFWAKffdekcvpEVMGAFASKGEEQEKAAKARENLKMLERALegkpffggdkigflDIAVGWIGIWGRIVEEIAgvslidaeTMPLLTAWLNNFlevpvikaciPSWHELLEHNKGFHKILTGSST
MAEESVKLLGYWASPFALRVKWALKLKGVHYEYveenlpnkspllLRYNPVYKKIPVLVHNGKPLAESLLIIEYIDEAWKQNPLLPDDPYERANARFWAKFFDEKCVPEVMGAFASKGEEQEKAAKARENLKMLERALegkpffggDKIGFLDIAVGWIGIWGRIVEEIAGVSLIDAETMPLLTAWLNNFLEVPVIKACIPSWHELlehnkgfhkiltgsst
MAEESVKLLGYWASPFALRVKWALKLKGVHYEYVEENLPNKSPLLLRYNPVYKKIPVLVHNGKPLAESLLIIEYIDEAWKQNPLLPDDPYERANARFWAKFFDEKCVPEVMGAFASKGEEQEKAAKARENLKMLERALEGKPFFGGDKIGFLDIAVGWIGIWGRIVEEIAGVSLIDAETMPLLTAWLNNFLEVPVIKACIPSWHELLEHNKGFHKILTGSST
*****VKLLGYWASPFALRVKWALKLKGVHYEYVEENLPNKSPLLLRYNPVYKKIPVLVHNGKPLAESLLIIEYIDEAWKQNPLLPDDPYERANARFWAKFFDEKCVPEVMGAF**********************ALEGKPFFGGDKIGFLDIAVGWIGIWGRIVEEIAGVSLIDAETMPLLTAWLNNFLEVPVIKACIPSWHELLEHNKGFHKIL*****
**EESVKLLGYWASPFALRVKWALKLKGVHYEYVEENLPNKSPLLLRYNPVYKKIPVLVHNGKPLAESLLIIEYIDEAWKQNPLLPDDPYERANARFWAKFFDEKCVPEVMGAFASKGEEQEKAAKARENLKMLERALEGKPFFGGDKIGFLDIAVGWIGIWGRIVEEIAGVSLIDAETMPLLTAWLNNFLEVPVIKACIPSWHELLEHNKGFHKILTG***
MAEESVKLLGYWASPFALRVKWALKLKGVHYEYVEENLPNKSPLLLRYNPVYKKIPVLVHNGKPLAESLLIIEYIDEAWKQNPLLPDDPYERANARFWAKFFDEKCVPEVMGAFASK********KARENLKMLERALEGKPFFGGDKIGFLDIAVGWIGIWGRIVEEIAGVSLIDAETMPLLTAWLNNFLEVPVIKACIPSWHELLEHNKGFHKILTGSST
***ESVKLLGYWASPFALRVKWALKLKGVHYEYVEENLPNKSPLLLRYNPVYKKIPVLVHNGKPLAESLLIIEYIDEAWKQNPLLPDDPYERANARFWAKFFDEKCVPEVMGAFASKGEEQEKAAKARENLKMLERALEGKPFFGGDKIGFLDIAVGWIGIWGRIVEEIAGVSLIDAETMPLLTAWLNNFLEVPVIKACIPSWHELLEHNKGFHKILTG***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAEESVKLLGYWASPFALRVKWALKLKGVHYEYVEENLPNKSPLLLRYNPVYKKIPVLVHNGKPLAESLLIIEYIDEAWKQNPLLPDDPYERANARFWAKFFDEKCVPEVMGAFASxxxxxxxxxxxxxxxxxxxxxLEGKPFFGGDKIGFLDIAVGWIGIWGRIVEEIAGVSLIDAETMPLLTAWLNNFLEVPVIKACIPSWHELLEHNKGFHKILTGSST
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query222 2.2.26 [Sep-21-2011]
Q9FQA3222 Glutathione transferase G N/A no 0.990 0.990 0.545 1e-65
Q9ZW24227 Glutathione S-transferase yes no 0.941 0.920 0.5 1e-55
P32110225 Probable glutathione S-tr no no 0.986 0.973 0.497 5e-55
Q03662223 Probable glutathione S-tr N/A no 0.918 0.914 0.524 7e-54
Q9SR36224 Glutathione S-transferase no no 0.923 0.915 0.514 6e-52
Q9ZW27224 Glutathione S-transferase no no 0.900 0.892 0.495 1e-51
Q9ZW30224 Glutathione S-transferase no no 0.891 0.883 0.495 2e-51
Q03663223 Probable glutathione S-tr N/A no 0.990 0.986 0.463 4e-51
Q03664223 Probable glutathione S-tr N/A no 0.981 0.977 0.472 7e-51
Q9ZW29225 Glutathione S-transferase no no 0.936 0.924 0.504 1e-49
>sp|Q9FQA3|GST23_MAIZE Glutathione transferase GST 23 OS=Zea mays PE=2 SV=1 Back     alignment and function desciption
 Score =  249 bits (636), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 121/222 (54%), Positives = 158/222 (71%), Gaps = 2/222 (0%)

Query: 1   MAEESVKLLGYWASPFALRVKWALKLKGVHYEYVEENLPNKSPLLLRYNPVYKKIPVLVH 60
           MAE+ VK+LG WASP  +RV+WAL+LKGV YEYV+E+L NKS  LLR+NPV KK+PVLVH
Sbjct: 1   MAEKGVKVLGMWASPMVIRVEWALRLKGVEYEYVDEDLANKSADLLRHNPVTKKVPVLVH 60

Query: 61  NGKPLAESLLIIEYIDEAWKQN-PLLPDDPYERANARFWAKFFDEKCVPEVMGAFASKGE 119
           +GKP+AES +I+EYIDE WK   P++P DPYERA ARFWA+F ++KC   +   F + GE
Sbjct: 61  DGKPVAESTIIVEYIDEVWKGGYPIMPGDPYERAQARFWARFAEDKCNAALYPIFTATGE 120

Query: 120 EQEKAA-KARENLKMLERALEGKPFFGGDKIGFLDIAVGWIGIWGRIVEEIAGVSLIDAE 178
            Q KA  +A++ LK LE ALEGK FFGGD +G+LDI VGW   W  ++EE+ G S++  E
Sbjct: 121 AQRKAVHEAQQCLKTLETALEGKKFFGGDAVGYLDIVVGWFAHWLPVIEEVTGASVVTHE 180

Query: 179 TMPLLTAWLNNFLEVPVIKACIPSWHELLEHNKGFHKILTGS 220
            +PL+ AW   FL + V+KA +P    LL  NK   + L  +
Sbjct: 181 ELPLMKAWFGRFLALDVVKAALPDRDRLLAANKARREQLLSA 222




Involved in multiple disease resistance (MDR).
Zea mays (taxid: 4577)
EC: 2EC: .EC: 5EC: .EC: 1EC: .EC: 1EC: 8
>sp|Q9ZW24|GSTU7_ARATH Glutathione S-transferase U7 OS=Arabidopsis thaliana GN=GSTU7 PE=2 SV=1 Back     alignment and function description
>sp|P32110|GSTX6_SOYBN Probable glutathione S-transferase OS=Glycine max GN=HSP26-A PE=2 SV=1 Back     alignment and function description
>sp|Q03662|GSTX1_TOBAC Probable glutathione S-transferase OS=Nicotiana tabacum PE=2 SV=1 Back     alignment and function description
>sp|Q9SR36|GSTU8_ARATH Glutathione S-transferase U8 OS=Arabidopsis thaliana GN=GSTU8 PE=2 SV=1 Back     alignment and function description
>sp|Q9ZW27|GSTU4_ARATH Glutathione S-transferase U4 OS=Arabidopsis thaliana GN=GSTU4 PE=2 SV=1 Back     alignment and function description
>sp|Q9ZW30|GSTU1_ARATH Glutathione S-transferase U1 OS=Arabidopsis thaliana GN=GSTU1 PE=2 SV=1 Back     alignment and function description
>sp|Q03663|GSTX2_TOBAC Probable glutathione S-transferase OS=Nicotiana tabacum PE=2 SV=1 Back     alignment and function description
>sp|Q03664|GSTX3_TOBAC Probable glutathione S-transferase OS=Nicotiana tabacum PE=2 SV=1 Back     alignment and function description
>sp|Q9ZW29|GSTU2_ARATH Glutathione S-transferase U2 OS=Arabidopsis thaliana GN=GSTU2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query222
350538459225 uncharacterized protein LOC543815 [Solan 0.995 0.982 0.663 3e-80
388498238223 unknown [Medicago truncatula] 1.0 0.995 0.659 5e-80
356510141221 PREDICTED: LOW QUALITY PROTEIN: glutathi 0.977 0.981 0.651 9e-80
359492474219 PREDICTED: LOW QUALITY PROTEIN: glutathi 0.959 0.972 0.668 2e-78
225456069225 PREDICTED: probable glutathione S-transf 0.954 0.942 0.569 7e-65
225456073225 PREDICTED: probable glutathione S-transf 0.959 0.946 0.562 1e-64
242044996222 hypothetical protein SORBIDRAFT_02g02708 0.990 0.990 0.549 5e-64
162459493222 glutathione transferase GST 23 [Zea mays 0.990 0.990 0.545 6e-64
414885837230 TPA: hypothetical protein ZEAMMB73_51802 0.981 0.947 0.55 7e-64
399106951221 glutathione transferase 23 [Triticum aes 0.986 0.990 0.529 3e-63
>gi|350538459|ref|NP_001234088.1| uncharacterized protein LOC543815 [Solanum lycopersicum] gi|10567808|gb|AAG16758.1| putative glutathione S-transferase T3 [Solanum lycopersicum] Back     alignment and taxonomy information
 Score =  303 bits (777), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 148/223 (66%), Positives = 174/223 (78%), Gaps = 2/223 (0%)

Query: 1   MAEESVKLLGYWASPFALRVKWALKLKGVHYEYVEENLPNKSPLLLRYNPVYKKIPVLVH 60
           MA E VKLLGYWASPFAL+V WALKLKG+ YEY EE+L NKSPLLL+YNPV+KKIPVLVH
Sbjct: 1   MASEKVKLLGYWASPFALKVHWALKLKGIEYEYQEEDLSNKSPLLLQYNPVHKKIPVLVH 60

Query: 61  NGKPLAESLLIIEYIDEAWKQNPLLPDDPYERANARFWAKFFDEKCVPEVMGAFASKGEE 120
           NGKP+AESL+I+EYI+E WK NPLLP+DPYERA ARFWAKF D+KCVP + G FA  G E
Sbjct: 61  NGKPIAESLVILEYIEETWKHNPLLPEDPYERAKARFWAKFVDDKCVPGIFGTFAKVGVE 120

Query: 121 QEKAAK-ARENLKMLERALEGKPFFGGDKIGFLDIAVGWIGIWGRIVEEIAGVSLIDAET 179
           Q+K AK ARENLK+LE  L  K FFG  KIGF+D+   WI  W +IVEE+  + LIDAE 
Sbjct: 121 QQKIAKEARENLKILEDELGKKHFFGDAKIGFMDVTSAWIICWAQIVEEVVDIRLIDAEE 180

Query: 180 MPLLTAWLNNFLE-VPVIKACIPSWHELLEHNKGFHKILTGSS 221
           MP L +W  N LE  P++K C P   +LLEHNKGFH++L  S+
Sbjct: 181 MPSLVSWFQNVLEAAPILKECTPPKDKLLEHNKGFHEMLVASA 223




Source: Solanum lycopersicum

Species: Solanum lycopersicum

Genus: Solanum

Family: Solanaceae

Order: Solanales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|388498238|gb|AFK37185.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|356510141|ref|XP_003523798.1| PREDICTED: LOW QUALITY PROTEIN: glutathione transferase GST 23-like [Glycine max] Back     alignment and taxonomy information
>gi|359492474|ref|XP_003634419.1| PREDICTED: LOW QUALITY PROTEIN: glutathione transferase GST 23-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225456069|ref|XP_002280532.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera] Back     alignment and taxonomy information
>gi|225456073|ref|XP_002280676.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera] Back     alignment and taxonomy information
>gi|242044996|ref|XP_002460369.1| hypothetical protein SORBIDRAFT_02g027080 [Sorghum bicolor] gi|241923746|gb|EER96890.1| hypothetical protein SORBIDRAFT_02g027080 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|162459493|ref|NP_001104994.1| glutathione transferase GST 23 [Zea mays] gi|75334191|sp|Q9FQA3.1|GST23_MAIZE RecName: Full=Glutathione transferase GST 23; AltName: Full=Glutathione transferase GST 36 gi|11385523|gb|AAG34844.1|AF244701_1 glutathione S-transferase GST 36 [Zea mays] gi|194702784|gb|ACF85476.1| unknown [Zea mays] gi|195628152|gb|ACG35906.1| glutathione S-transferase [Zea mays] gi|414885838|tpg|DAA61852.1| TPA: glutathione S-transferase GST 23 [Zea mays] Back     alignment and taxonomy information
>gi|414885837|tpg|DAA61851.1| TPA: hypothetical protein ZEAMMB73_518022, partial [Zea mays] Back     alignment and taxonomy information
>gi|399106951|gb|AFP20277.1| glutathione transferase 23 [Triticum aestivum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query222
TAIR|locus:2043112227 GSTU7 "AT2G29420" [Arabidopsis 0.927 0.907 0.507 4.9e-53
TAIR|locus:2083544224 GSTU8 "AT3G09270" [Arabidopsis 0.923 0.915 0.514 3.5e-52
TAIR|locus:2043017224 GSTU4 "AT2G29460" [Arabidopsis 0.941 0.933 0.511 1.9e-51
TAIR|locus:2042987224 GSTU1 "AT2G29490" [Arabidopsis 0.909 0.901 0.523 3.1e-51
TAIR|locus:2042997225 GSTU2 "AT2G29480" [Arabidopsis 0.936 0.924 0.504 7.4e-50
TAIR|locus:2043032224 GSTU5 "AT2G29450" [Arabidopsis 0.936 0.928 0.509 8.5e-49
TAIR|locus:2043007225 GSTU3 "AT2G29470" [Arabidopsis 0.927 0.915 0.488 4.7e-48
TAIR|locus:2012773227 ERD9 "AT1G10370" [Arabidopsis 0.950 0.929 0.461 6.9e-47
TAIR|locus:2043057223 GSTU6 "AT2G29440" [Arabidopsis 0.954 0.950 0.479 1.6e-45
TAIR|locus:2012758227 GSTU18 "AT1G10360" [Arabidopsi 0.932 0.911 0.451 5.6e-45
TAIR|locus:2043112 GSTU7 "AT2G29420" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 549 (198.3 bits), Expect = 4.9e-53, P = 4.9e-53
 Identities = 105/207 (50%), Positives = 138/207 (66%)

Query:     4 ESVKLLGYWASPFALRVKWALKLKGVHYEYVEENLPNKSPLLLRYNPVYKKIPVLVHNGK 63
             E VKLLG WASPF+ R++ AL LKGV YE++E+++ NKS LLL+ NPV+K IPVLVHNGK
Sbjct:     8 EEVKLLGMWASPFSRRIEIALTLKGVSYEFLEQDITNKSSLLLQLNPVHKMIPVLVHNGK 67

Query:    64 PLAESLLIIEYIDEAWKQNPLLPDDPYERANARFWAKFFDEKCVPEVMGAFASKGEEQEK 123
             P++ESL+I+EYIDE W+ NP+LP DPYER  ARFW+KF DE+     M      G+E++ 
Sbjct:    68 PISESLVILEYIDETWRDNPILPQDPYERTMARFWSKFVDEQIYVTAMKVVGKTGKERDA 127

Query:   124 AAKARENLKM-LERALEGKPFFGGDKIGFLDIAVGWIGIWGRIVEEIAGVSLIDAETMPL 182
               +A  +L M LE+ L GK F GG  +GF+DI    +  W    EEI GV ++  E  P 
Sbjct:   128 VVEATRDLLMFLEKELVGKDFLGGKSLGFVDIVATLVAFWLMRTEEIVGVKVVPVEKFPE 187

Query:   183 LTAWLNNFLEVPVIKACIPSWHELLEH 209
             +  W+ N L   VIK CIP   E L++
Sbjct:   188 IHRWVKNLLGNDVIKKCIPPEDEHLKY 214




GO:0004364 "glutathione transferase activity" evidence=ISS;TAS
GO:0005737 "cytoplasm" evidence=ISM;NAS
GO:0009407 "toxin catabolic process" evidence=RCA;TAS
GO:0009751 "response to salicylic acid stimulus" evidence=IEP
GO:0005829 "cytosol" evidence=IDA
GO:0010583 "response to cyclopentenone" evidence=RCA
TAIR|locus:2083544 GSTU8 "AT3G09270" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043017 GSTU4 "AT2G29460" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2042987 GSTU1 "AT2G29490" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2042997 GSTU2 "AT2G29480" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043032 GSTU5 "AT2G29450" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043007 GSTU3 "AT2G29470" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2012773 ERD9 "AT1G10370" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043057 GSTU6 "AT2G29440" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2012758 GSTU18 "AT1G10360" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q03662GSTX1_TOBAC2, ., 5, ., 1, ., 1, 80.52400.91890.9147N/Ano
Q9ZW24GSTU7_ARATH2, ., 5, ., 1, ., 1, 80.50.94140.9207yesno
Q9FQA3GST23_MAIZE2, ., 5, ., 1, ., 1, 80.54500.99090.9909N/Ano
P78417GSTO1_HUMAN1, ., 2, 0, ., 4, ., 20.31620.89180.8215yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer2.5.1.180.914

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00017766001
SubName- Full=Chromosome chr17 scaffold_16, whole genome shotgun sequence; (225 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00032791001
RecName- Full=Glutathione peroxidase; (246 aa)
       0.899
GOR
SubName- Full=Chromosome chr7 scaffold_31, whole genome shotgun sequence; (559 aa)
       0.899
GSVIVG00023686001
RecName- Full=Glutathione peroxidase; (170 aa)
       0.899
GSVIVG00022884001
SubName- Full=Chromosome chr14 scaffold_27, whole genome shotgun sequence; (510 aa)
       0.899
GSVIVG00020491001
SubName- Full=Chromosome chr5 scaffold_2, whole genome shotgun sequence; (496 aa)
       0.899
GSVIVG00016630001
SubName- Full=Chromosome chr11 scaffold_13, whole genome shotgun sequence; (536 aa)
       0.899
GSVIVG00001920001
RecName- Full=Glutathione peroxidase; (167 aa)
       0.899
GSVIVG00000410001
RecName- Full=Glutathione peroxidase; (170 aa)
       0.899
GSVIVG00000409001
RecName- Full=Glutathione peroxidase; (168 aa)
       0.899
DHAR
SubName- Full=Putative uncharacterized protein (Chromosome chr13 scaffold_48, whole genome shot [...] (212 aa)
       0.409

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query222
cd03185127 cd03185, GST_C_Tau, C-terminal, alpha helical doma 4e-53
cd0305874 cd03058, GST_N_Tau, GST_N family, Class Tau subfam 5e-44
COG0625211 COG0625, Gst, Glutathione S-transferase [Posttrans 9e-29
TIGR01262210 TIGR01262, maiA, maleylacetoacetate isomerase 5e-22
pfam1341775 pfam13417, GST_N_3, Glutathione S-transferase, N-t 9e-22
cd0057071 cd00570, GST_N_family, Glutathione S-transferase ( 2e-18
pfam1340968 pfam13409, GST_N_2, Glutathione S-transferase, N-t 3e-16
pfam0279874 pfam02798, GST_N, Glutathione S-transferase, N-ter 4e-16
cd0304273 cd03042, GST_N_Zeta, GST_N family, Class Zeta subf 5e-14
PRK10357202 PRK10357, PRK10357, putative glutathione S-transfe 2e-09
cd0304973 cd03049, GST_N_3, GST_N family, unknown subfamily 1e-08
PRK09481211 PRK09481, sspA, stringent starvation protein A; Pr 2e-08
cd0305673 cd03056, GST_N_4, GST_N family, unknown subfamily 1e-07
cd0304676 cd03046, GST_N_GTT1_like, GST_N family, Saccharomy 2e-07
cd0305376 cd03053, GST_N_Phi, GST_N family, Class Phi subfam 3e-07
PRK15113214 PRK15113, PRK15113, glutathione S-transferase; Pro 5e-07
cd0305589 cd03055, GST_N_Omega, GST_N family, Class Omega su 6e-07
cd0305973 cd03059, GST_N_SspA, GST_N family, Stringent starv 8e-07
cd0305472 cd03054, GST_N_Metaxin, GST_N family, Metaxin subf 5e-06
cd0306071 cd03060, GST_N_Omega_like, GST_N family, Omega-lik 2e-05
cd0303884 cd03038, GST_N_etherase_LigE, GST_N family, Beta e 3e-05
cd03184124 cd03184, GST_C_Omega, C-terminal, alpha helical do 4e-05
cd0308075 cd03080, GST_N_Metaxin_like, GST_N family, Metaxin 1e-04
cd00299100 cd00299, GST_C_family, C-terminal, alpha helical d 2e-04
pfam0004392 pfam00043, GST_C, Glutathione S-transferase, C-ter 4e-04
cd0305076 cd03050, GST_N_Theta, GST_N family, Class Theta su 7e-04
pfam1341069 pfam13410, GST_C_2, Glutathione S-transferase, C-t 7e-04
cd0304373 cd03043, GST_N_1, GST_N family, unknown subfamily 0.002
cd0305174 cd03051, GST_N_GTT2_like, GST_N family, Saccharomy 0.003
cd03180110 cd03180, GST_C_2, C-terminal, alpha helical domain 0.004
cd0305273 cd03052, GST_N_GDAP1, GST_N family, Ganglioside-in 0.004
cd10291110 cd10291, GST_C_YfcG_like, C-terminal, alpha helica 0.004
cd03188113 cd03188, GST_C_Beta, C-terminal, alpha helical dom 0.004
PLN02817265 PLN02817, PLN02817, glutathione dehydrogenase (asc 0.004
>gnl|CDD|198294 cd03185, GST_C_Tau, C-terminal, alpha helical domain of Class Tau Glutathione S-transferases Back     alignment and domain information
 Score =  166 bits (423), Expect = 4e-53
 Identities = 65/127 (51%), Positives = 81/127 (63%), Gaps = 2/127 (1%)

Query: 89  PYERANARFWAKFFDEKCVPEVMGAFASKGEEQEKAAK-ARENLKMLERAL-EGKPFFGG 146
           PYERA ARFWA + D+K  P     +A+KGEEQEKA + A E LK+LE  L  GKPFFGG
Sbjct: 1   PYERAQARFWAAYIDDKLFPAGRKVWAAKGEEQEKAVEEALEALKVLEEELKGGKPFFGG 60

Query: 147 DKIGFLDIAVGWIGIWGRIVEEIAGVSLIDAETMPLLTAWLNNFLEVPVIKACIPSWHEL 206
           D IG+LDIA+G    W + +EE+ GV L+D E  PLL AW   FLE   +K  +P   +L
Sbjct: 61  DTIGYLDIALGSFLGWFKAIEEVGGVKLLDEEKFPLLAAWAERFLEREAVKEVLPDRDKL 120

Query: 207 LEHNKGF 213
           +E  K  
Sbjct: 121 VEFLKAL 127


Glutathione S-transferase (GST) C-terminal domain family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress. The GST fold contains an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GSH binds to the N-terminal domain while the hydrophobic substrate occupies a pocket in the C-terminal domain. The plant-specific class Tau GST subfamily has undergone extensive gene duplication. The Arabidopsis and Oryza genomes contain 28 and 40 Tau GSTs, respectively. They are primarily responsible for herbicide detoxification together with class Phi GSTs, showing class specificity in substrate preference. Tau enzymes are highly efficient in detoxifying diphenylether and aryloxyphenoxypropionate herbicides. In addition, Tau GSTs play important roles in intracellular signalling, biosynthesis of anthocyanin, responses to soil stresses and responses to auxin and cytokinin hormones. Length = 127

>gnl|CDD|239356 cd03058, GST_N_Tau, GST_N family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>gnl|CDD|223698 COG0625, Gst, Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|233333 TIGR01262, maiA, maleylacetoacetate isomerase Back     alignment and domain information
>gnl|CDD|205595 pfam13417, GST_N_3, Glutathione S-transferase, N-terminal domain Back     alignment and domain information
>gnl|CDD|238319 cd00570, GST_N_family, Glutathione S-transferase (GST) family, N-terminal domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>gnl|CDD|222110 pfam13409, GST_N_2, Glutathione S-transferase, N-terminal domain Back     alignment and domain information
>gnl|CDD|217234 pfam02798, GST_N, Glutathione S-transferase, N-terminal domain Back     alignment and domain information
>gnl|CDD|239340 cd03042, GST_N_Zeta, GST_N family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>gnl|CDD|182405 PRK10357, PRK10357, putative glutathione S-transferase; Provisional Back     alignment and domain information
>gnl|CDD|239347 cd03049, GST_N_3, GST_N family, unknown subfamily 3; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>gnl|CDD|236537 PRK09481, sspA, stringent starvation protein A; Provisional Back     alignment and domain information
>gnl|CDD|239354 cd03056, GST_N_4, GST_N family, unknown subfamily 4; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>gnl|CDD|239344 cd03046, GST_N_GTT1_like, GST_N family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>gnl|CDD|239351 cd03053, GST_N_Phi, GST_N family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins Back     alignment and domain information
>gnl|CDD|185068 PRK15113, PRK15113, glutathione S-transferase; Provisional Back     alignment and domain information
>gnl|CDD|239353 cd03055, GST_N_Omega, GST_N family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>gnl|CDD|239357 cd03059, GST_N_SspA, GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E Back     alignment and domain information
>gnl|CDD|239352 cd03054, GST_N_Metaxin, GST_N family, Metaxin subfamily; composed of metaxins and related proteins Back     alignment and domain information
>gnl|CDD|239358 cd03060, GST_N_Omega_like, GST_N family, Omega-like subfamily; composed of uncharacterized proteins with similarity to class Omega GSTs Back     alignment and domain information
>gnl|CDD|239336 cd03038, GST_N_etherase_LigE, GST_N family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor Back     alignment and domain information
>gnl|CDD|198293 cd03184, GST_C_Omega, C-terminal, alpha helical domain of Class Omega Glutathione S-transferases Back     alignment and domain information
>gnl|CDD|239378 cd03080, GST_N_Metaxin_like, GST_N family, Metaxin subfamily, Metaxin-like proteins; a heterogenous group of proteins, predominantly uncharacterized, with similarity to metaxins and GSTs Back     alignment and domain information
>gnl|CDD|198286 cd00299, GST_C_family, C-terminal, alpha helical domain of the Glutathione S-transferase family Back     alignment and domain information
>gnl|CDD|215674 pfam00043, GST_C, Glutathione S-transferase, C-terminal domain Back     alignment and domain information
>gnl|CDD|239348 cd03050, GST_N_Theta, GST_N family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase Back     alignment and domain information
>gnl|CDD|222111 pfam13410, GST_C_2, Glutathione S-transferase, C-terminal domain Back     alignment and domain information
>gnl|CDD|239341 cd03043, GST_N_1, GST_N family, unknown subfamily 1; composed of uncharacterized proteins, predominantly from bacteria, with similarity to GSTs Back     alignment and domain information
>gnl|CDD|239349 cd03051, GST_N_GTT2_like, GST_N family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>gnl|CDD|198289 cd03180, GST_C_2, C-terminal, alpha helical domain of an unknown subfamily 2 of Glutathione S-transferases Back     alignment and domain information
>gnl|CDD|239350 cd03052, GST_N_GDAP1, GST_N family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells Back     alignment and domain information
>gnl|CDD|198324 cd10291, GST_C_YfcG_like, C-terminal, alpha helical domain of Escherichia coli YfcG Glutathione S-transferases and related uncharacterized proteins Back     alignment and domain information
>gnl|CDD|198297 cd03188, GST_C_Beta, C-terminal, alpha helical domain of Class Beta Glutathione S-transferases Back     alignment and domain information
>gnl|CDD|166458 PLN02817, PLN02817, glutathione dehydrogenase (ascorbate) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 222
KOG0406231 consensus Glutathione S-transferase [Posttranslati 100.0
PRK09481211 sspA stringent starvation protein A; Provisional 100.0
PRK15113214 glutathione S-transferase; Provisional 100.0
PLN02473214 glutathione S-transferase 100.0
PRK13972215 GSH-dependent disulfide bond oxidoreductase; Provi 100.0
PRK10542201 glutathionine S-transferase; Provisional 100.0
KOG0868217 consensus Glutathione S-transferase [Posttranslati 100.0
PRK10357202 putative glutathione S-transferase; Provisional 100.0
TIGR01262210 maiA maleylacetoacetate isomerase. Maleylacetoacet 100.0
PLN02395215 glutathione S-transferase 100.0
TIGR00862236 O-ClC intracellular chloride channel protein. Thes 100.0
COG0625211 Gst Glutathione S-transferase [Posttranslational m 100.0
PRK11752264 putative S-transferase; Provisional 100.0
PLN02378213 glutathione S-transferase DHAR1 100.0
PTZ00057205 glutathione s-transferase; Provisional 100.0
PLN02817265 glutathione dehydrogenase (ascorbate) 99.98
KOG0867226 consensus Glutathione S-transferase [Posttranslati 99.97
PRK10387210 glutaredoxin 2; Provisional 99.97
KOG1695206 consensus Glutathione S-transferase [Posttranslati 99.96
TIGR02182209 GRXB Glutaredoxin, GrxB family. This model include 99.96
KOG4420325 consensus Uncharacterized conserved protein (Gangl 99.94
KOG1422221 consensus Intracellular Cl- channel CLIC, contains 99.9
PLN02907 722 glutamate-tRNA ligase 99.9
KOG3029370 consensus Glutathione S-transferase-related protei 99.83
PF1341775 GST_N_3: Glutathione S-transferase, N-terminal dom 99.83
cd0305973 GST_N_SspA GST_N family, Stringent starvation prot 99.79
cd0305874 GST_N_Tau GST_N family, Class Tau subfamily; GSTs 99.79
cd0306191 GST_N_CLIC GST_N family, Chloride Intracellular Ch 99.78
cd0305273 GST_N_GDAP1 GST_N family, Ganglioside-induced diff 99.78
cd0307673 GST_N_Pi GST_N family, Class Pi subfamily; GSTs ar 99.77
cd0304177 GST_N_2GST_N GST_N family, 2 repeats of the N-term 99.76
cd0304574 GST_N_Delta_Epsilon GST_N family, Class Delta and 99.76
cd0306071 GST_N_Omega_like GST_N family, Omega-like subfamil 99.76
cd03185126 GST_C_Tau GST_C family, Class Tau subfamily; GSTs 99.76
cd0305376 GST_N_Phi GST_N family, Class Phi subfamily; compo 99.75
cd0305076 GST_N_Theta GST_N family, Class Theta subfamily; c 99.75
cd0305673 GST_N_4 GST_N family, unknown subfamily 4; compose 99.74
cd0303972 GST_N_Sigma_like GST_N family, Class Sigma_like; c 99.73
cd0303771 GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) sub 99.73
cd0304973 GST_N_3 GST_N family, unknown subfamily 3; compose 99.73
cd0305589 GST_N_Omega GST_N family, Class Omega subfamily; G 99.72
cd0304475 GST_N_EF1Bgamma GST_N family, Gamma subunit of Elo 99.72
cd0304881 GST_N_Ure2p_like GST_N family, Ure2p-like subfamil 99.72
cd0304773 GST_N_2 GST_N family, unknown subfamily 2; compose 99.72
cd0305174 GST_N_GTT2_like GST_N family, Saccharomyces cerevi 99.71
cd0304676 GST_N_GTT1_like GST_N family, Saccharomyces cerevi 99.71
cd0304273 GST_N_Zeta GST_N family, Class Zeta subfamily; GST 99.7
cd0305777 GST_N_Beta GST_N family, Class Beta subfamily; GST 99.7
KOG4244281 consensus Failed axon connections (fax) protein/gl 99.7
cd0307779 GST_N_Alpha GST_N family, Class Alpha subfamily; G 99.7
cd0304077 GST_N_mPGES2 GST_N family; microsomal Prostaglandi 99.69
cd03184124 GST_C_Omega GST_C family, Class Omega subfamily; G 99.69
cd03190142 GST_C_ECM4_like GST_C family, ECM4-like subfamily; 99.69
cd0307582 GST_N_Mu GST_N family, Class Mu subfamily; GSTs ar 99.68
cd03186107 GST_C_SspA GST_N family, Stringent starvation prot 99.68
cd0308075 GST_N_Metaxin_like GST_N family, Metaxin subfamily 99.66
PF0279876 GST_N: Glutathione S-transferase, N-terminal domai 99.66
COG2999215 GrxB Glutaredoxin 2 [Posttranslational modificatio 99.66
PF1340970 GST_N_2: Glutathione S-transferase, N-terminal dom 99.66
cd03196115 GST_C_5 GST_C family, unknown subfamily 5; compose 99.65
cd0303884 GST_N_etherase_LigE GST_N family, Beta etherase Li 99.65
cd03188114 GST_C_Beta GST_C family, Class Beta subfamily; GST 99.63
cd0057071 GST_N_family Glutathione S-transferase (GST) famil 99.61
cd0304373 GST_N_1 GST_N family, unknown subfamily 1; compose 99.61
cd03198134 GST_C_CLIC GST_C family, Chloride Intracellular Ch 99.58
cd03209121 GST_C_Mu GST_C family, Class Mu subfamily; GSTs ar 99.58
cd03203120 GST_C_Lambda GST_C family, Class Lambda subfamily; 99.57
cd03191121 GST_C_Zeta GST_C family, Class Zeta subfamily; GST 99.57
cd0305472 GST_N_Metaxin GST_N family, Metaxin subfamily; com 99.57
cd03201121 GST_C_DHAR GST_C family, Dehydroascorbate Reductas 99.56
cd03178113 GST_C_Ure2p_like GST_C family, Ure2p-like subfamil 99.56
cd03210126 GST_C_Pi GST_C family, Class Pi subfamily; GSTs ar 99.55
cd03182117 GST_C_GTT2_like GST_C family, Saccharomyces cerevi 99.55
COG0435324 ECM4 Predicted glutathione S-transferase [Posttran 99.54
cd03208137 GST_C_Alpha GST_C family, Class Alpha subfamily; G 99.54
cd03189119 GST_C_GTT1_like GST_C family, Saccharomyces cerevi 99.53
cd03187118 GST_C_Phi GST_C family, Class Phi subfamily; compo 99.53
KOG3027257 consensus Mitochondrial outer membrane protein Met 99.52
cd03180110 GST_C_2 GST_C family, unknown subfamily 2; compose 99.5
cd03181123 GST_C_EFB1gamma GST_C family, Gamma subunit of Elo 99.5
cd03177118 GST_C_Delta_Epsilon GST_C family, Class Delta and 99.49
KOG2903319 consensus Predicted glutathione S-transferase [Pos 99.48
cd03183126 GST_C_Theta GST_C family, Class Theta subfamily; c 99.45
cd0320096 GST_C_JTV1 GST_C family, JTV-1 subfamily; composed 99.43
PF0004395 GST_C: Glutathione S-transferase, C-terminal domai 99.42
cd03207103 GST_C_8 GST_C family, unknown subfamily 8; compose 99.42
cd03195114 GST_C_4 GST_C family, unknown subfamily 4; compose 99.42
cd03206100 GST_C_7 GST_C family, unknown subfamily 7; compose 99.37
PF1341069 GST_C_2: Glutathione S-transferase, C-terminal dom 99.36
cd03179105 GST_C_1 GST_C family, unknown subfamily 1; compose 99.33
cd03204111 GST_C_GDAP1 GST_C family, Ganglioside-induced diff 99.32
cd0307974 GST_N_Metaxin2 GST_N family, Metaxin subfamily, Me 99.28
PF1449799 GST_C_3: Glutathione S-transferase, C-terminal dom 99.27
cd03192104 GST_C_Sigma_like GST_C family, Class Sigma_like; c 99.27
TIGR0219079 GlrX-dom Glutaredoxin-family domain. This C-termin 99.26
cd03194114 GST_C_3 GST_C family, unknown subfamily 3; compose 99.26
cd00299100 GST_C_family Glutathione S-transferase (GST) famil 99.19
PRK1063883 glutaredoxin 3; Provisional 99.12
cd03202124 GST_C_etherase_LigE GST_C family, Beta etherase Li 99.11
cd0302972 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hyb 99.1
cd0319388 GST_C_Metaxin GST_C family, Metaxin subfamily; com 99.1
cd0307873 GST_N_Metaxin1_like GST_N family, Metaxin subfamil 99.0
KOG3028313 consensus Translocase of outer mitochondrial membr 98.89
cd0320598 GST_C_6 GST_C family, unknown subfamily 6; compose 98.89
cd0302773 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Eg 98.88
PF14834117 GST_C_4: Glutathione S-transferase, C-terminal dom 98.82
PRK1032981 glutaredoxin-like protein; Provisional 98.81
cd03211126 GST_C_Metaxin2 GST_C family, Metaxin subfamily, Me 98.78
cd0206672 GRX_family Glutaredoxin (GRX) family; composed of 98.77
cd03197149 GST_C_mPGES2 GST_C family; microsomal Prostaglandi 98.76
cd0297673 NrdH NrdH-redoxin (NrdH) family; NrdH is a small m 98.76
TIGR0219674 GlrX_YruB Glutaredoxin-like protein, YruB-family. 98.75
cd03212137 GST_C_Metaxin1_3 GST_C family, Metaxin subfamily, 98.75
cd0341875 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX b 98.71
TIGR0220077 GlrX_actino Glutaredoxin-like protein. This family 98.6
COG069580 GrxC Glutaredoxin and related proteins [Posttransl 98.59
TIGR0218179 GRX_bact Glutaredoxin, GrxC family. This family of 98.54
TIGR0219472 GlrX_NrdH Glutaredoxin-like protein NrdH. NrdH-red 98.52
PHA03050108 glutaredoxin; Provisional 98.49
PRK1120085 grxA glutaredoxin 1; Provisional 98.49
TIGR0218999 GlrX-like_plant Glutaredoxin-like family. This fam 98.48
PF0046260 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Gl 98.44
cd0341982 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX h 98.38
TIGR0218386 GRXA Glutaredoxin, GrxA family. This model include 98.37
TIGR0036597 monothiol glutaredoxin, Grx4 family. The gene for 98.3
cd0302890 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-inte 98.21
TIGR0218084 GRX_euk Glutaredoxin. This model represents eukary 98.05
PF1056872 Tom37: Outer mitochondrial membrane transport comp 97.89
cd03031147 GRX_GRX_like Glutaredoxin (GRX) family, GRX-like d 97.64
PRK10824115 glutaredoxin-4; Provisional 97.61
PRK12759 410 bifunctional gluaredoxin/ribonucleoside-diphosphat 97.59
KOG1147 712 consensus Glutamyl-tRNA synthetase [Translation, r 97.5
KOG1752104 consensus Glutaredoxin and related proteins [Postt 97.34
PTZ00062204 glutaredoxin; Provisional 97.19
PF04399132 Glutaredoxin2_C: Glutaredoxin 2, C terminal domain 97.15
cd0297367 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)- 97.14
cd03036111 ArsC_like Arsenate Reductase (ArsC) family, unknow 96.96
cd02977105 ArsC_family Arsenate Reductase (ArsC) family; comp 96.9
COG454585 Glutaredoxin-related protein [Posttranslational mo 96.8
PRK01655131 spxA transcriptional regulator Spx; Reviewed 96.71
cd03032115 ArsC_Spx Arsenate Reductase (ArsC) family, Spx sub 96.58
TIGR01617117 arsC_related transcriptional regulator, Spx/MgsR f 96.51
cd03199128 GST_C_GRX2 GST_C family, Glutaredoxin 2 (GRX2) sub 96.4
cd03033113 ArsC_15kD Arsenate Reductase (ArsC) family, 15kD p 96.29
cd03035105 ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb s 96.27
PRK13344132 spxA transcriptional regulator Spx; Reviewed 96.1
PRK12559131 transcriptional regulator Spx; Provisional 96.07
PRK10026141 arsenate reductase; Provisional 96.06
PF0576881 DUF836: Glutaredoxin-like domain (DUF836); InterPr 96.0
cd0303092 GRX_SH3BGR Glutaredoxin (GRX) family, SH3BGR (SH3 95.96
COG0278105 Glutaredoxin-related protein [Posttranslational mo 95.3
TIGR01616126 nitro_assoc nitrogenase-associated protein. This m 95.26
TIGR0041276 redox_disulf_2 small redox-active disulfide protei 95.2
cd03034112 ArsC_ArsC Arsenate Reductase (ArsC) family, ArsC s 95.06
COG1393117 ArsC Arsenate reductase and related proteins, glut 95.01
PF11287112 DUF3088: Protein of unknown function (DUF3088); In 94.99
cd0302689 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxid 94.96
TIGR00014114 arsC arsenate reductase (glutaredoxin). composed o 94.95
TIGR0041182 redox_disulf_1 small redox-active disulfide protei 94.91
PRK10853118 putative reductase; Provisional 94.91
cd0165969 TRX_superfamily Thioredoxin (TRX) superfamily; a l 94.74
PF11801168 Tom37_C: Tom37 C-terminal domain; InterPro: IPR019 93.62
PHA0212575 thioredoxin-like protein 93.31
PF1319276 Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZY 91.8
PF03960110 ArsC: ArsC family; InterPro: IPR006660 Several bac 88.71
PF0490899 SH3BGR: SH3-binding, glutamic acid-rich protein; I 86.72
>KOG0406 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=100.00  E-value=1e-39  Score=247.01  Aligned_cols=215  Identities=52%  Similarity=0.808  Sum_probs=192.3

Q ss_pred             ceEEeeccCCchHHHHHHHHHHhCCCceEEeCCCCCCchhhhhhCCCCCcccEEEeCCeecchHHHHHHHHHhhCC-CCC
Q 027498            5 SVKLLGYWASPFALRVKWALKLKGVHYEYVEENLPNKSPLLLRYNPVYKKIPVLVHNGKPLAESLLIIEYIDEAWK-QNP   83 (222)
Q Consensus         5 ~~~L~~~~~s~~~~~vr~~L~~~gi~~~~~~~~~~~~~~~~~~~~p~~~~vP~l~~~~~~i~es~~I~~yL~~~~~-~~~   83 (222)
                      .++||++..|||++|++++|..+||+|+.++.|..+++++++..||.+++||+|+++|..|.||..|++||++.++ +++
T Consensus         9 ~vrL~~~w~sPfa~R~~iaL~~KgI~yE~veedl~~Ks~~ll~~np~hkKVPvL~Hn~k~i~ESliiveYiDe~w~~~~~   88 (231)
T KOG0406|consen    9 TVKLLGMWFSPFAQRVRIALKLKGIPYEYVEEDLTNKSEWLLEKNPVHKKVPVLEHNGKPICESLIIVEYIDETWPSGPP   88 (231)
T ss_pred             eEEEEEeecChHHHHHHHHHHhcCCceEEEecCCCCCCHHHHHhccccccCCEEEECCceehhhHHHHHHHHhhccCCCC
Confidence            5999999999999999999999999999999999999999999997779999999999999999999999999999 589


Q ss_pred             CCCCCHHHHHHHHHHHHHHhcccchhhhhhhc-CCcHHHHHHHH-HHHHHHHHHHHhc-CCCcccCCCCChhHHHHHhHH
Q 027498           84 LLPDDPYERANARFWAKFFDEKCVPEVMGAFA-SKGEEQEKAAK-ARENLKMLERALE-GKPFFGGDKIGFLDIAVGWIG  160 (222)
Q Consensus        84 l~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~-~~~~l~~le~~L~-~~~~l~G~~~t~aD~~l~~~l  160 (222)
                      ++|+|+.+|+.++.|..+++..+.......+. ..++..+...+ +.+.|..||+.|. +.+|+.|+++++.|+++++.+
T Consensus        89 iLP~DPy~Ra~arfwa~~id~~~~~~~~~~~~~~~~e~~~~~~~e~~e~l~~lE~el~k~k~~fgG~~~G~vDi~~~p~~  168 (231)
T KOG0406|consen   89 ILPSDPYERAQARFWAEYIDKKVFFVGRFVVAAKGGEEQEAAKEELREALKVLEEELGKGKDFFGGETIGFVDIAIGPSF  168 (231)
T ss_pred             CCCCCHHHHHHHHHHHHHHHhHHHHHHHHHHhhcCchHHHHHHHHHHHHHHHHHHHHhcCCCCCCCCCcCHhhhhHHhhH
Confidence            99999999999999999999988777777666 44577777788 9999999999998 789999999999999999776


Q ss_pred             HHHHHHHHH-hcccccCCCcccHHHHHHHHHhcchhhhhcCCChHHHHHHhhhhhhhhcc
Q 027498          161 IWGRIVEEI-AGVSLIDAETMPLLTAWLNNFLEVPVIKACIPSWHELLEHNKGFHKILTG  219 (222)
Q Consensus       161 ~~~~~~~~~-~~~~~~~~~~~p~l~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~  219 (222)
                      .+.....+. .+......+.+|.|.+|.++|.++|.+++++++.+++.+..+.+++....
T Consensus       169 ~~~~~~~~~~~~~~~~~~~~~P~L~~W~~~~~~~~~V~~~~p~~e~~~e~~~~~~~~~~~  228 (231)
T KOG0406|consen  169 ERWLAVLEKFGGVKFIIEEETPKLIKWIKRMKEDEAVKAVLPDSEKVVEFMKKYRQGSPN  228 (231)
T ss_pred             HHHHHHHHHhcCcccCCCCCCccHHHHHHHHhcChhHHhhcCCHHHHHHHHHHHHHhccc
Confidence            666443333 22345557799999999999999999999999999999999999987543



>PRK09481 sspA stringent starvation protein A; Provisional Back     alignment and domain information
>PRK15113 glutathione S-transferase; Provisional Back     alignment and domain information
>PLN02473 glutathione S-transferase Back     alignment and domain information
>PRK13972 GSH-dependent disulfide bond oxidoreductase; Provisional Back     alignment and domain information
>PRK10542 glutathionine S-transferase; Provisional Back     alignment and domain information
>KOG0868 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10357 putative glutathione S-transferase; Provisional Back     alignment and domain information
>TIGR01262 maiA maleylacetoacetate isomerase Back     alignment and domain information
>PLN02395 glutathione S-transferase Back     alignment and domain information
>TIGR00862 O-ClC intracellular chloride channel protein Back     alignment and domain information
>COG0625 Gst Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11752 putative S-transferase; Provisional Back     alignment and domain information
>PLN02378 glutathione S-transferase DHAR1 Back     alignment and domain information
>PTZ00057 glutathione s-transferase; Provisional Back     alignment and domain information
>PLN02817 glutathione dehydrogenase (ascorbate) Back     alignment and domain information
>KOG0867 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10387 glutaredoxin 2; Provisional Back     alignment and domain information
>KOG1695 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02182 GRXB Glutaredoxin, GrxB family Back     alignment and domain information
>KOG4420 consensus Uncharacterized conserved protein (Ganglioside-induced differentiation associated protein 1, GDAP1) [Function unknown] Back     alignment and domain information
>KOG1422 consensus Intracellular Cl- channel CLIC, contains GST domain [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN02907 glutamate-tRNA ligase Back     alignment and domain information
>KOG3029 consensus Glutathione S-transferase-related protein [General function prediction only] Back     alignment and domain information
>PF13417 GST_N_3: Glutathione S-transferase, N-terminal domain; PDB: 3ERG_B 3IBH_A 3ERF_A 3UBL_A 3UBK_A 3IR4_A 3M8N_B 2R4V_A 2PER_A 2R5G_A Back     alignment and domain information
>cd03059 GST_N_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E Back     alignment and domain information
>cd03058 GST_N_Tau GST_N family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03061 GST_N_CLIC GST_N family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin and similar proteins Back     alignment and domain information
>cd03052 GST_N_GDAP1 GST_N family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells Back     alignment and domain information
>cd03076 GST_N_Pi GST_N family, Class Pi subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03041 GST_N_2GST_N GST_N family, 2 repeats of the N-terminal domain of soluble GSTs (2 GST_N) subfamily; composed of uncharacterized proteins Back     alignment and domain information
>cd03045 GST_N_Delta_Epsilon GST_N family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03060 GST_N_Omega_like GST_N family, Omega-like subfamily; composed of uncharacterized proteins with similarity to class Omega GSTs Back     alignment and domain information
>cd03185 GST_C_Tau GST_C family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03053 GST_N_Phi GST_N family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins Back     alignment and domain information
>cd03050 GST_N_Theta GST_N family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase Back     alignment and domain information
>cd03056 GST_N_4 GST_N family, unknown subfamily 4; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>cd03039 GST_N_Sigma_like GST_N family, Class Sigma_like; composed of GSTs belonging to class Sigma and similar proteins, including GSTs from class Mu, Pi and Alpha Back     alignment and domain information
>cd03037 GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E Back     alignment and domain information
>cd03049 GST_N_3 GST_N family, unknown subfamily 3; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>cd03055 GST_N_Omega GST_N family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03044 GST_N_EF1Bgamma GST_N family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis Back     alignment and domain information
>cd03048 GST_N_Ure2p_like GST_N family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs Back     alignment and domain information
>cd03047 GST_N_2 GST_N family, unknown subfamily 2; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>cd03051 GST_N_GTT2_like GST_N family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>cd03046 GST_N_GTT1_like GST_N family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>cd03042 GST_N_Zeta GST_N family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03057 GST_N_Beta GST_N family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>KOG4244 consensus Failed axon connections (fax) protein/glutathione S-transferase-like protein [Signal transduction mechanisms] Back     alignment and domain information
>cd03077 GST_N_Alpha GST_N family, Class Alpha subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03040 GST_N_mPGES2 GST_N family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2 Back     alignment and domain information
>cd03184 GST_C_Omega GST_C family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03190 GST_C_ECM4_like GST_C family, ECM4-like subfamily; composed of predominantly uncharacterized and taxonomically diverse proteins with similarity to the translation product of the Saccharomyces cerevisiae gene ECM4 Back     alignment and domain information
>cd03075 GST_N_Mu GST_N family, Class Mu subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03186 GST_C_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E Back     alignment and domain information
>cd03080 GST_N_Metaxin_like GST_N family, Metaxin subfamily, Metaxin-like proteins; a heterogenous group of proteins, predominantly uncharacterized, with similarity to metaxins and GSTs Back     alignment and domain information
>PF02798 GST_N: Glutathione S-transferase, N-terminal domain; InterPro: IPR004045 In eukaryotes, glutathione S-transferases (GSTs) participate in the detoxification of reactive electrophillic compounds by catalysing their conjugation to glutathione Back     alignment and domain information
>COG2999 GrxB Glutaredoxin 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13409 GST_N_2: Glutathione S-transferase, N-terminal domain; PDB: 3C8E_B 3M1G_A 3R3E_A 3O3T_A 1RK4_A 1K0O_B 1K0N_A 3QR6_A 3SWL_A 3TGZ_B Back     alignment and domain information
>cd03196 GST_C_5 GST_C family, unknown subfamily 5; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>cd03038 GST_N_etherase_LigE GST_N family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor Back     alignment and domain information
>cd03188 GST_C_Beta GST_C family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>cd00570 GST_N_family Glutathione S-transferase (GST) family, N-terminal domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03043 GST_N_1 GST_N family, unknown subfamily 1; composed of uncharacterized proteins, predominantly from bacteria, with similarity to GSTs Back     alignment and domain information
>cd03198 GST_C_CLIC GST_C family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin, and similar proteins Back     alignment and domain information
>cd03209 GST_C_Mu GST_C family, Class Mu subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>cd03203 GST_C_Lambda GST_C family, Class Lambda subfamily; composed of plant-specific class Lambda GSTs Back     alignment and domain information
>cd03191 GST_C_Zeta GST_C family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>cd03054 GST_N_Metaxin GST_N family, Metaxin subfamily; composed of metaxins and related proteins Back     alignment and domain information
>cd03201 GST_C_DHAR GST_C family, Dehydroascorbate Reductase (DHAR) subfamily; composed of plant-specific DHARs, monomeric enzymes catalyzing the reduction of DHA into ascorbic acid (AsA) using glutathione as the reductant Back     alignment and domain information
>cd03178 GST_C_Ure2p_like GST_C family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs Back     alignment and domain information
>cd03210 GST_C_Pi GST_C family, Class Pi subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>cd03182 GST_C_GTT2_like GST_C family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>COG0435 ECM4 Predicted glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03208 GST_C_Alpha GST_C family, Class Alpha subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>cd03189 GST_C_GTT1_like GST_C family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>cd03187 GST_C_Phi GST_C family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins Back     alignment and domain information
>KOG3027 consensus Mitochondrial outer membrane protein Metaxin 2, Metaxin 1-binding protein [Cell wall/membrane/envelope biogenesis; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd03180 GST_C_2 GST_C family, unknown subfamily 2; composed of uncharacterized bacterial proteins, with similarity to GSTs Back     alignment and domain information
>cd03181 GST_C_EFB1gamma GST_C family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis Back     alignment and domain information
>cd03177 GST_C_Delta_Epsilon GST_C family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>KOG2903 consensus Predicted glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03183 GST_C_Theta GST_C family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase Back     alignment and domain information
>cd03200 GST_C_JTV1 GST_C family, JTV-1 subfamily; composed of uncharacterized proteins with similarity to the translation product of the human JTV-1 gene Back     alignment and domain information
>PF00043 GST_C: Glutathione S-transferase, C-terminal domain; InterPro: IPR004046 In eukaryotes, glutathione S-transferases (GSTs) participate in the detoxification of reactive electrophillic compounds by catalysing their conjugation to glutathione Back     alignment and domain information
>cd03207 GST_C_8 GST_C family, unknown subfamily 8; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>cd03195 GST_C_4 GST_C family, unknown subfamily 4; composed of uncharacterized proteins with similarity to GSTs Back     alignment and domain information
>cd03206 GST_C_7 GST_C family, unknown subfamily 7; composed of uncharacterized proteins with similarity to GSTs Back     alignment and domain information
>PF13410 GST_C_2: Glutathione S-transferase, C-terminal domain; PDB: 4DEJ_H 3IC8_A 2JL4_A 2V6K_B 3CBU_B 1JLW_B 3F6D_B 3G7I_A 3F63_A 3G7J_B Back     alignment and domain information
>cd03179 GST_C_1 GST_C family, unknown subfamily 1; composed of uncharacterized bacterial proteins, with similarity to GSTs Back     alignment and domain information
>cd03204 GST_C_GDAP1 GST_C family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells Back     alignment and domain information
>cd03079 GST_N_Metaxin2 GST_N family, Metaxin subfamily, Metaxin 2; a metaxin 1 binding protein identified through a yeast two-hybrid system using metaxin 1 as the bait Back     alignment and domain information
>PF14497 GST_C_3: Glutathione S-transferase, C-terminal domain; PDB: 3AY8_A 2UZ8_B 1V2A_C 2HNL_A 2YV9_B 3H1N_A 3FR6_A 1Q4J_B 1PA3_B 1OKT_B Back     alignment and domain information
>cd03192 GST_C_Sigma_like GST_C family, Class Sigma_like; composed of GSTs belonging to class Sigma and similar proteins, including GSTs from class Mu, Pi, and Alpha Back     alignment and domain information
>TIGR02190 GlrX-dom Glutaredoxin-family domain Back     alignment and domain information
>cd03194 GST_C_3 GST_C family, unknown subfamily 3; composed of uncharacterized proteins with similarity to GSTs Back     alignment and domain information
>cd00299 GST_C_family Glutathione S-transferase (GST) family, C-terminal alpha helical domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>PRK10638 glutaredoxin 3; Provisional Back     alignment and domain information
>cd03202 GST_C_etherase_LigE GST_C family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor Back     alignment and domain information
>cd03029 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria Back     alignment and domain information
>cd03193 GST_C_Metaxin GST_C family, Metaxin subfamily; composed of metaxins and related proteins Back     alignment and domain information
>cd03078 GST_N_Metaxin1_like GST_N family, Metaxin subfamily, Metaxin 1-like proteins; composed of metaxins 1 and 3, and similar proteins including Tom37 from fungi Back     alignment and domain information
>KOG3028 consensus Translocase of outer mitochondrial membrane complex, subunit TOM37/Metaxin 1 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd03205 GST_C_6 GST_C family, unknown subfamily 6; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions Back     alignment and domain information
>PF14834 GST_C_4: Glutathione S-transferase, C-terminal domain; PDB: 3BBY_A Back     alignment and domain information
>PRK10329 glutaredoxin-like protein; Provisional Back     alignment and domain information
>cd03211 GST_C_Metaxin2 GST_C family, Metaxin subfamily, Metaxin 2; a metaxin 1 binding protein identified through a yeast two-hybrid system using metaxin 1 as the bait Back     alignment and domain information
>cd02066 GRX_family Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>cd03197 GST_C_mPGES2 GST_C family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2 Back     alignment and domain information
>cd02976 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile Back     alignment and domain information
>TIGR02196 GlrX_YruB Glutaredoxin-like protein, YruB-family Back     alignment and domain information
>cd03212 GST_C_Metaxin1_3 GST_C family, Metaxin subfamily, Metaxin 1-like proteins; composed of metaxins 1 and 3, and similar proteins Back     alignment and domain information
>cd03418 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>TIGR02200 GlrX_actino Glutaredoxin-like protein Back     alignment and domain information
>COG0695 GrxC Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02181 GRX_bact Glutaredoxin, GrxC family Back     alignment and domain information
>TIGR02194 GlrX_NrdH Glutaredoxin-like protein NrdH Back     alignment and domain information
>PHA03050 glutaredoxin; Provisional Back     alignment and domain information
>PRK11200 grxA glutaredoxin 1; Provisional Back     alignment and domain information
>TIGR02189 GlrX-like_plant Glutaredoxin-like family Back     alignment and domain information
>PF00462 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>cd03419 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>TIGR02183 GRXA Glutaredoxin, GrxA family Back     alignment and domain information
>TIGR00365 monothiol glutaredoxin, Grx4 family Back     alignment and domain information
>cd03028 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins Back     alignment and domain information
>TIGR02180 GRX_euk Glutaredoxin Back     alignment and domain information
>PF10568 Tom37: Outer mitochondrial membrane transport complex protein; InterPro: IPR019564 Tom37 is one of the outer membrane proteins that make up the TOM complex for guiding cytosolic mitochondrial beta-barrel proteins from the cytosol across the outer mitochondrial membrane into the intramembrane space Back     alignment and domain information
>cd03031 GRX_GRX_like Glutaredoxin (GRX) family, GRX-like domain containing protein subfamily; composed of uncharacterized eukaryotic proteins containing a GRX-like domain having only one conserved cysteine, aligning to the C-terminal cysteine of the CXXC motif of GRXs Back     alignment and domain information
>PRK10824 glutaredoxin-4; Provisional Back     alignment and domain information
>PRK12759 bifunctional gluaredoxin/ribonucleoside-diphosphate reductase subunit beta; Provisional Back     alignment and domain information
>KOG1147 consensus Glutamyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1752 consensus Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00062 glutaredoxin; Provisional Back     alignment and domain information
>PF04399 Glutaredoxin2_C: Glutaredoxin 2, C terminal domain; InterPro: IPR007494 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>cd02973 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-like family; composed of archaeal and bacterial proteins that show similarity to both TRX and GRX, including the C-terminal TRX-fold subdomain of Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO) Back     alignment and domain information
>cd03036 ArsC_like Arsenate Reductase (ArsC) family, unknown subfamily; uncharacterized proteins containing a CXXC motif with similarity to thioredoxin (TRX)-fold arsenic reductases, ArsC Back     alignment and domain information
>cd02977 ArsC_family Arsenate Reductase (ArsC) family; composed of TRX-fold arsenic reductases and similar proteins including the transcriptional regulator, Spx Back     alignment and domain information
>COG4545 Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK01655 spxA transcriptional regulator Spx; Reviewed Back     alignment and domain information
>cd03032 ArsC_Spx Arsenate Reductase (ArsC) family, Spx subfamily; Spx is a unique RNA polymerase (RNAP)-binding protein present in bacilli and some mollicutes Back     alignment and domain information
>TIGR01617 arsC_related transcriptional regulator, Spx/MgsR family Back     alignment and domain information
>cd03199 GST_C_GRX2 GST_C family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E Back     alignment and domain information
>cd03033 ArsC_15kD Arsenate Reductase (ArsC) family, 15kD protein subfamily; composed of proteins of unknown function with similarity to thioredoxin-fold arsenic reductases, ArsC Back     alignment and domain information
>cd03035 ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb subfamily; Yffb is an uncharacterized bacterial protein encoded by the yffb gene, related to the thioredoxin-fold arsenic reductases, ArsC Back     alignment and domain information
>PRK13344 spxA transcriptional regulator Spx; Reviewed Back     alignment and domain information
>PRK12559 transcriptional regulator Spx; Provisional Back     alignment and domain information
>PRK10026 arsenate reductase; Provisional Back     alignment and domain information
>PF05768 DUF836: Glutaredoxin-like domain (DUF836); InterPro: IPR008554 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>cd03030 GRX_SH3BGR Glutaredoxin (GRX) family, SH3BGR (SH3 domain binding glutamic acid-rich protein) subfamily; a recently-identified subfamily composed of SH3BGR and similar proteins possessing significant sequence similarity to GRX, but without a redox active CXXC motif Back     alignment and domain information
>COG0278 Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01616 nitro_assoc nitrogenase-associated protein Back     alignment and domain information
>TIGR00412 redox_disulf_2 small redox-active disulfide protein 2 Back     alignment and domain information
>cd03034 ArsC_ArsC Arsenate Reductase (ArsC) family, ArsC subfamily; arsenic reductases similar to that encoded by arsC on the R733 plasmid of Escherichia coli Back     alignment and domain information
>COG1393 ArsC Arsenate reductase and related proteins, glutaredoxin family [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF11287 DUF3088: Protein of unknown function (DUF3088); InterPro: IPR021439 This family of proteins with unknown function appears to be restricted to Proteobacteria Back     alignment and domain information
>cd03026 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) subfamily, C-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which then reduces hydrogen peroxide and organic hydroperoxides Back     alignment and domain information
>TIGR00014 arsC arsenate reductase (glutaredoxin) Back     alignment and domain information
>TIGR00411 redox_disulf_1 small redox-active disulfide protein 1 Back     alignment and domain information
>PRK10853 putative reductase; Provisional Back     alignment and domain information
>cd01659 TRX_superfamily Thioredoxin (TRX) superfamily; a large, diverse group of proteins containing a TRX-fold Back     alignment and domain information
>PF11801 Tom37_C: Tom37 C-terminal domain; InterPro: IPR019564 Tom37 is one of the outer membrane proteins that make up the TOM complex for guiding cytosolic mitochondrial beta-barrel proteins from the cytosol across the outer mitochondrial membrane into the intramembrane space Back     alignment and domain information
>PHA02125 thioredoxin-like protein Back     alignment and domain information
>PF13192 Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZYN_A 1HYU_A 1ILO_A 1J08_F 2YWM_B 2AYT_B 2HLS_B 1A8L_A 2K8S_B Back     alignment and domain information
>PF03960 ArsC: ArsC family; InterPro: IPR006660 Several bacterial taxon have a chromosomal resistance system, encoded by the ars operon, for the detoxification of arsenate, arsenite, and antimonite [] Back     alignment and domain information
>PF04908 SH3BGR: SH3-binding, glutamic acid-rich protein; InterPro: IPR006993 This family of proteins, which contains SH3BGRL3, is functionally uncharacterised Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query222
4j2f_A223 Crystal Structure Of A Glutathione Transferase Fami 2e-57
2vo4_A219 Glutathione Transferase From Glycine Max Length = 2 4e-46
1gwc_A230 The Structure Of A Tau Class Glutathione S-Transfer 4e-40
1oyj_A231 Crystal Structure Solution Of Rice Gst1 (Osgstu1) I 3e-23
3vln_A241 Human Glutathione Transferase O1-1 C32s Mutant In C 2e-19
1eem_A241 Glutathione Transferase From Homo Sapiens Length = 5e-19
3lfl_A240 Crystal Structure Of Human Glutathione Transferase 5e-18
3qag_A239 Human Glutathione Transferase O2 With Glutathione - 3e-12
3tot_A226 Crystal Structure Of Glutathione Transferase (Targe 9e-11
4hoj_A210 Crystal Structure Of Glutathione Transferase Homolo 1e-10
1e6b_A221 Crystal Structure Of A Zeta Class Glutathione S-Tra 3e-10
3lyp_A215 Structure Of Stringent Starvation Protein A Homolog 4e-09
1fw1_A216 Glutathione Transferase ZetaMALEYLACETOACETATE ISOM 2e-08
3niv_A222 The Crystal Structure Of Glutathione S-Transferase 3e-08
1yy7_A213 Crystal Structure Of Stringent Starvation Protein A 3e-08
3lyk_A216 Structure Of Stringent Starvation Protein A Homolog 2e-07
4glt_A225 Crystal Structure Of Glutathione S-Transferase Mfla 2e-07
3ubk_A242 Crystal Structure Of Glutathione Transferase (Targe 2e-07
2cz2_A223 Crystal Structure Of Glutathione Transferase Zeta 1 2e-07
3rbt_A246 Crystal Structure Of Glutathione S-Transferase Omeg 2e-07
3cbu_A214 Crystal Structure Of A Putative Glutathione S-Trans 4e-06
1jlv_A209 Anopheles Dirus Species B Glutathione S-transferase 4e-06
3mdk_A217 Structure Of Stringent Starvation Protein A (Sspa) 6e-06
3r2q_A202 Crystal Structure Analysis Of Yibf From E. Coli Len 6e-06
3lxz_A229 Structure Of Probable Glutathione S-Transferase(Pp0 1e-05
4igj_A242 Crystal Structure Of Maleylacetoacetate Isomerase F 2e-05
1pn9_A209 Crystal Structure Of An Insect Delta-class Glutathi 5e-05
2jl4_A213 Holo Structure Of Maleyl Pyruvate Isomerase, A Bact 6e-05
2v6k_A214 Structure Of Maleyl Pyruvate Isomerase, A Bacterial 6e-05
3m8n_A225 Crystal Structure Of A Possible Gutathione S-Tranfe 1e-04
3ein_A209 Delta Class Gst Length = 209 2e-04
4g10_A265 Ligg From Sphingobium Sp. Syk-6 Is Related To The G 2e-04
1v2a_A210 Glutathione S-transferase 1-6 From Anopheles Dirus 4e-04
3lxt_A213 Crystal Structure Of Glutathione S Transferase From 4e-04
>pdb|4J2F|A Chain A, Crystal Structure Of A Glutathione Transferase Family Member From Ricinus Communis, Target Efi-501866 Length = 223 Back     alignment and structure

Iteration: 1

Score = 218 bits (554), Expect = 2e-57, Method: Compositional matrix adjust. Identities = 115/222 (51%), Positives = 150/222 (67%), Gaps = 5/222 (2%) Query: 4 ESVKLLGYWASPFALRVKWALKLKGVHYEYVEENLPNKSPLLLRYNPVYKKIPVLVHNGK 63 E +KL G W SPF+ RV WALKLKG+ YEYVEE+L NKSPLLL+YNPV+KKIPVLVH GK Sbjct: 3 EVLKLHGAWPSPFSCRVIWALKLKGIPYEYVEEDLFNKSPLLLQYNPVHKKIPVLVHGGK 62 Query: 64 PLAESLLIIEYIDEAWKQNPLLPDDPYERANARFWAKFFDEKCVPEVMGAFASKGEEQEK 123 P+ ES +I+EY+DE W +NPLLP DP+ERA ARFW KF ++K + F +KGEE EK Sbjct: 63 PICESTIILEYLDETWPENPLLPSDPHERAVARFWVKFIEDKGTA-IWNIFRTKGEELEK 121 Query: 124 AAK-ARENLKMLERALEG---KPFFGGDKIGFLDIAVGWIGIWGRIVEEIAGVSLIDAET 179 A K E LK +E G +FGGDKIG +DIA I W ++EE+AGV +++++ Sbjct: 122 AVKNCLEVLKTIEEHAMGVSDDKYFGGDKIGIVDIAFCGIAHWLGVIEEVAGVKVLESQK 181 Query: 180 MPLLTAWLNNFLEVPVIKACIPSWHELLEHNKGFHKILTGSS 221 P L AW NF E P+IK +P ++ K +++ S+ Sbjct: 182 FPRLHAWTENFKEAPIIKENLPDRDQMTAFFKRRREMILASA 223
>pdb|2VO4|A Chain A, Glutathione Transferase From Glycine Max Length = 219 Back     alignment and structure
>pdb|1GWC|A Chain A, The Structure Of A Tau Class Glutathione S-Transferase From Wheat, Active In Herbicide Detoxification Length = 230 Back     alignment and structure
>pdb|1OYJ|A Chain A, Crystal Structure Solution Of Rice Gst1 (Osgstu1) In Complex With Glutathione. Length = 231 Back     alignment and structure
>pdb|3VLN|A Chain A, Human Glutathione Transferase O1-1 C32s Mutant In Complex With Ascorbic Acid Length = 241 Back     alignment and structure
>pdb|1EEM|A Chain A, Glutathione Transferase From Homo Sapiens Length = 241 Back     alignment and structure
>pdb|3LFL|A Chain A, Crystal Structure Of Human Glutathione Transferase Omega 1, Delta 155 Length = 240 Back     alignment and structure
>pdb|3QAG|A Chain A, Human Glutathione Transferase O2 With Glutathione -New Crystal Form Length = 239 Back     alignment and structure
>pdb|3TOT|A Chain A, Crystal Structure Of Glutathione Transferase (Target Efi-501058) From Ralstonia Solanacearum Gmi1000 Length = 226 Back     alignment and structure
>pdb|4HOJ|A Chain A, Crystal Structure Of Glutathione Transferase Homolog From Neisseria Gonorrhoeae, Target Efi-501841, With Bound Glutathione Length = 210 Back     alignment and structure
>pdb|1E6B|A Chain A, Crystal Structure Of A Zeta Class Glutathione S-Transferase From Arabidopsis Thaliana Length = 221 Back     alignment and structure
>pdb|3LYP|A Chain A, Structure Of Stringent Starvation Protein A Homolog From Pseudomonas Fluorescens Length = 215 Back     alignment and structure
>pdb|1FW1|A Chain A, Glutathione Transferase ZetaMALEYLACETOACETATE ISOMERASE Length = 216 Back     alignment and structure
>pdb|3NIV|A Chain A, The Crystal Structure Of Glutathione S-Transferase From Legionella Pneumophila Length = 222 Back     alignment and structure
>pdb|1YY7|A Chain A, Crystal Structure Of Stringent Starvation Protein A (Sspa), An Rna Polymerase-Associated Transcription Factor Length = 213 Back     alignment and structure
>pdb|3LYK|A Chain A, Structure Of Stringent Starvation Protein A Homolog From Haemophilus Influenzae Length = 216 Back     alignment and structure
>pdb|4GLT|A Chain A, Crystal Structure Of Glutathione S-Transferase Mfla_2116 (Target Efi- 507160) From Methylobacillus Flagellatus Kt With Gsh Bound Length = 225 Back     alignment and structure
>pdb|3UBK|A Chain A, Crystal Structure Of Glutathione Transferase (Target Efi-501770) From Leptospira Interrogans Length = 242 Back     alignment and structure
>pdb|2CZ2|A Chain A, Crystal Structure Of Glutathione Transferase Zeta 1-1 (Maleylacetoacetate Isomerase) From Mus Musculus (Form-1 Crystal) Length = 223 Back     alignment and structure
>pdb|3RBT|A Chain A, Crystal Structure Of Glutathione S-Transferase Omega 3 From The Silkworm Bombyx Mori Length = 246 Back     alignment and structure
>pdb|3CBU|A Chain A, Crystal Structure Of A Putative Glutathione S-Transferase (Reut_a1011) From Ralstonia Eutropha Jmp134 At 2.05 A Resolution Length = 214 Back     alignment and structure
>pdb|1JLV|A Chain A, Anopheles Dirus Species B Glutathione S-transferases 1-3 Length = 209 Back     alignment and structure
>pdb|3MDK|A Chain A, Structure Of Stringent Starvation Protein A (Sspa) From Pseudomonas Putida Length = 217 Back     alignment and structure
>pdb|3R2Q|A Chain A, Crystal Structure Analysis Of Yibf From E. Coli Length = 202 Back     alignment and structure
>pdb|3LXZ|A Chain A, Structure Of Probable Glutathione S-Transferase(Pp0183) From Pseudomonas Putida Length = 229 Back     alignment and structure
>pdb|4IGJ|A Chain A, Crystal Structure Of Maleylacetoacetate Isomerase From Anaeromyxobacter Dehalogenans 2cp-1, Target Efi-507175 Length = 242 Back     alignment and structure
>pdb|1PN9|A Chain A, Crystal Structure Of An Insect Delta-class Glutathione S- Transferase From A Ddt-resistant Strain Of The Malaria Vector Anopheles Gambiae Length = 209 Back     alignment and structure
>pdb|2JL4|A Chain A, Holo Structure Of Maleyl Pyruvate Isomerase, A Bacterial Glutathione-S-Transferase In Zeta Class Length = 213 Back     alignment and structure
>pdb|2V6K|A Chain A, Structure Of Maleyl Pyruvate Isomerase, A Bacterial Glutathione-s-transferase In Zeta Class, In Complex With Substrate Analogue Dicarboxyethyl Glutathione Length = 214 Back     alignment and structure
>pdb|3M8N|A Chain A, Crystal Structure Of A Possible Gutathione S-Tranferase From Rhodopseudomonas Palustris Length = 225 Back     alignment and structure
>pdb|3EIN|A Chain A, Delta Class Gst Length = 209 Back     alignment and structure
>pdb|4G10|A Chain A, Ligg From Sphingobium Sp. Syk-6 Is Related To The Glutathione Transferase Omega Class Length = 265 Back     alignment and structure
>pdb|1V2A|A Chain A, Glutathione S-transferase 1-6 From Anopheles Dirus Species B Length = 210 Back     alignment and structure
>pdb|3LXT|A Chain A, Crystal Structure Of Glutathione S Transferase From Pseudomonas Fluorescens Length = 213 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query222
1gwc_A230 Glutathione S-transferase TSI-1; herbicide detoxif 6e-94
2vo4_A219 2,4-D inducible glutathione S-transferase; herbici 2e-93
1yy7_A213 SSPA, stringent starvation protein A; GST fold, tr 8e-86
3rbt_A246 Glutathione transferase O1; glutathione S-transfer 3e-82
3lyk_A216 Stringent starvation protein A homolog; structural 4e-82
3vln_A241 GSTO-1, glutathione S-transferase omega-1; GST fol 6e-82
4dej_A231 Glutathione S-transferase related protein; transfe 1e-81
1oyj_A231 Glutathione S-transferase; herbicide detoxificatio 2e-80
3lyp_A215 Stringent starvation protein A; structural genomic 1e-79
3q18_A239 GSTO-2, glutathione S-transferase omega-2; glutath 2e-78
3niv_A222 Glutathione S-transferase; structural genomics, PS 7e-73
3tou_A226 Glutathione S-transferase protein; GSH binding sit 1e-70
4ags_A 471 Thiol-dependent reductase 1; transferase, leishman 5e-70
4ags_A471 Thiol-dependent reductase 1; transferase, leishman 6e-69
2cz2_A223 Maleylacetoacetate isomerase; structural genomics, 2e-69
3lxz_A229 Glutathione S-transferase family protein; structur 1e-67
3ubk_A242 Glutathione transferase; GSH binding; 1.95A {Lepto 8e-66
3r2q_A202 Uncharacterized GST-like protein YIBF; transferase 4e-64
3cbu_A214 Probable GST-related protein; thioredoxin fold, GS 3e-63
3m0f_A213 Uncharacterized protein GST_N; PSI-2, NYSGXRC, glu 4e-60
2v6k_A214 Maleylpyruvate isomerase; glutathione-S-transferas 3e-54
1e6b_A221 Glutathione S-transferase; 1.65A {Arabidopsis thal 1e-48
1k0m_A241 CLIC1, NCC27, chloride intracellular channel prote 1e-43
2ahe_A267 Chloride intracellular channel protein 4; glutathi 1e-42
3fy7_A250 Chloride intracellular channel protein 3; GST, glu 3e-42
2r4v_A247 XAP121, chloride intracellular channel protein 2; 4e-42
3qav_A243 RHO-class glutathione S-transferase; cytosol; 2.10 3e-34
3ic8_A310 Uncharacterized GST-like proteinprotein; glutathio 4e-32
3ibh_A233 GST-II, saccharomyces cerevisiae GTT2; glutathione 1e-31
3n5o_A235 Glutathione transferase; seattle structural genomi 9e-31
2yv7_A260 CG10997-PA, LD46306P, CLIC; dmclic, chloride ION c 1e-30
3bby_A215 Uncharacterized GST-like protein YFCF; NP_416804.1 2e-29
1gnw_A211 Glutathione S-transferase; herbicide detoxificatio 4e-28
1axd_A209 Glutathione S-transferase I; transferase, herbicid 1e-25
2c3n_A247 Glutathione S-transferase theta 1; glutathione tra 3e-24
1ljr_A244 HGST T2-2, glutathione S-transferase; HET: GSH; 3. 7e-24
1aw9_A216 Glutathione S-transferase III; herbicide detoxific 1e-23
2imi_A221 Epsilon-class glutathione S-transferase; HET: GSH; 4e-23
1v2a_A210 Glutathione transferase GST1-6; glutathione S-tran 1e-22
3ay8_A216 Glutathione S-transferase; GST fold, GST binding, 2e-22
2dsa_A203 Glutathione S-transferase; HET: GSH HPX; 2.10A {Bu 4e-22
3ir4_A218 Glutaredoxin 2; glutathione, IDP00895, structural 6e-22
1r5a_A218 Glutathione transferase; glutathione S-transferase 2e-21
1n2a_A201 Glutathione S-transferase; HET: GTS; 1.90A {Escher 8e-20
1pn9_A209 GST class-delta, glutathione S-transferase 1-6; pr 2e-19
1nhy_A219 EF-1-gamma 1, elongation factor 1-gamma 1; protein 2e-19
3lsz_A225 Glutathione S-transferase; xenobiotic, biodegradat 5e-19
3ein_A209 GST class-theta, glutathione S-transferase 1-1; de 2e-18
1pmt_A203 PMGST, GST B1-1, glutathione transferase; glutathi 7e-18
2pvq_A201 Glutathione S-transferase; xenobiotics detoxificat 8e-18
4g9h_A211 Glutathione S-transferase; GST, enzyme function in 4e-17
3m8n_A225 Possible glutathione S-transferase; PSI-II, struct 1e-16
1f2e_A201 Glutathione S-transferase; GST complexed with glut 1e-16
2ycd_A230 Glutathione S-transferase; SOIL bacteria, herbicid 2e-16
3uar_A227 Glutathione S-transferase; GSH binding site; HET: 2e-16
1z9h_A290 Membrane-associated prostaglandin E synthase-2; me 7e-16
3m3m_A210 Glutathione S-transferase; PSI-II, structural geno 1e-15
1vf1_A229 Glutathione S-transferase 3; detoxification; HET: 1e-15
3f6d_A219 Adgstd4-4, glutathione transferase GST1-4; HET: GT 2e-15
1k3y_A221 GSTA1-1, glutathione S-transferase A1; S-hexyl glu 3e-15
1b48_A221 GST, mgsta4-4, protein (glutathione S-transferase) 3e-15
2uz8_A174 Eukaryotic translation elongation factor 1 epsilon 4e-15
2x64_A207 Glutathione-S-transferase; detoxification enzyme; 5e-15
1yq1_A208 Glutathione S-transferase; nematoda, structural ge 5e-15
3ik7_A222 Glutathione S-transferase A4; human GST A4-4, enzy 5e-15
2cvd_A198 Glutathione-requiring prostaglandin D synthase; gl 1e-14
3iso_A218 Putative glutathione transferase; GST; HET: GSH; 1 3e-14
4exj_A238 Uncharacterized protein; transferase-like protein, 5e-14
2a2r_A210 Glutathione S-transferase P; detoxification, nitri 1e-13
1b8x_A280 Protein (AML-1B); nuclear matrix targeting signal 1e-13
2fhe_A216 GST, glutathione S-transferase; transferase-substr 2e-13
2fno_A248 AGR_PAT_752P; thioredoxin fold, GST C-terminal dom 2e-13
2on7_A206 Nagst-1, Na glutathione S-transferase 1; hookworm; 2e-13
2ws2_A204 NU-class GST, glutathione S-transferase; parasite, 2e-13
2on5_A206 Nagst-2, Na glutathione S-transferase 2; hookworm; 2e-13
2gsq_A202 Squid GST, glutathione S-transferase; squid digest 2e-13
1dug_A234 Chimera of glutathione S-transferase-synthetic lin 3e-13
1zl9_A207 GST class-sigma, glutathione S-transferase 5; glut 3e-13
1tu7_A208 Glutathione S-transferase 2; HET: GSH; 1.50A {Onch 3e-13
1gsu_A219 GST, CGSTM1-1, class-MU glutathione S-transferase; 4e-13
1bg5_A254 MAB, fusion protein of alpha-Na,K-ATPase with glut 4e-13
3gtu_B224 Glutathione S-transferase; conjugation, detoxifica 4e-13
1okt_A211 Glutathione S-transferase; GST; 1.9A {Plasmodium f 6e-13
2yv9_A291 Chloride intracellular channel EXC-4; chloride ION 1e-12
1tw9_A206 Glutathione S-transferase 2; 1.71A {Heligmosomoide 2e-12
2c4j_A218 Glutathione S-transferase MU 2; glutathione transf 4e-12
1m0u_A249 GST2 gene product; flight muscle protein, sigma, t 6e-12
3h1n_A252 Probable glutathione S-transferase; APC84167, bord 9e-12
2hnl_A225 Glutathione S-transferase 1; prostaglandin synthas 1e-11
2wb9_A211 Glutathione transferase sigma class; thioredoxin f 2e-10
1oe8_A211 Glutathione S-transferase; schistosomiasis, detoxi 3e-10
3c8e_A288 YGHU, glutathione S-transferase homologue; glutath 1e-06
1k0d_A260 URE2 protein; nitrate assimilation, structural gen 8e-06
3gx0_A215 GST-like protein YFCG; transferase, glutathione, g 2e-04
>1gwc_A Glutathione S-transferase TSI-1; herbicide detoxification, plant, TAU class; HET: GTX; 2.25A {Aegilops tauschii} SCOP: a.45.1.1 c.47.1.5 Length = 230 Back     alignment and structure
 Score =  273 bits (700), Expect = 6e-94
 Identities = 104/229 (45%), Positives = 137/229 (59%), Gaps = 9/229 (3%)

Query: 1   MA-EESVKLLGYWASPFALRVKWALKLKGVHYEYVEENLPNKSPLLLRYNPVYKKIPVLV 59
           MA  + +KLLG W SPF  RVK AL LKG+ YE VEE+L  KS LLL+ NPV+KKIPVL+
Sbjct: 1   MAGGDDLKLLGAWPSPFVTRVKLALALKGLSYEDVEEDLYKKSELLLKSNPVHKKIPVLI 60

Query: 60  HNGKPLAESLLIIEYIDEAWKQN--PLLPDDPYERANARFWAKFFDEKCVPEVMGAFASK 117
           HNG P+ ES++I++YIDE +      LLP DPYERA ARFW  + D+K V         K
Sbjct: 61  HNGAPVCESMIILQYIDEVFASTGPSLLPADPYERAIARFWVAYVDDKLVAPWRQWLRGK 120

Query: 118 -GEEQEKAAK-ARENLKMLERALE----GKPFFGGDKIGFLDIAVGWIGIWGRIVEEIAG 171
             EE+ +  K A   + +LE AL     G  FFGGD +G +D+A+G +  W ++ E ++G
Sbjct: 121 TEEEKSEGKKQAFAAVGVLEGALRECSKGGGFFGGDGVGLVDVALGGVLSWMKVTEALSG 180

Query: 172 VSLIDAETMPLLTAWLNNFLEVPVIKACIPSWHELLEHNKGFHKILTGS 220
             + DA   PLL AW+  F+E+   KA +P    LLE  K        S
Sbjct: 181 DKIFDAAKTPLLAAWVERFIELDAAKAALPDVGRLLEFAKAREAAAAAS 229


>2vo4_A 2,4-D inducible glutathione S-transferase; herbicide, TAU class GST, S-(P-nitrobenzyl- glutathione); HET: GTB 4NM; 1.75A {Glycine max} PDB: 3fhs_A* Length = 219 Back     alignment and structure
>1yy7_A SSPA, stringent starvation protein A; GST fold, transcription; HET: CIT; 2.02A {Yersinia pestis} Length = 213 Back     alignment and structure
>3rbt_A Glutathione transferase O1; glutathione S-transferase omega3; 2.20A {Bombyx mori} Length = 246 Back     alignment and structure
>3lyk_A Stringent starvation protein A homolog; structural genomics, GST-superfamily, SSPA, PSI-2, protein structure initiative; 2.10A {Haemophilus influenzae} Length = 216 Back     alignment and structure
>3vln_A GSTO-1, glutathione S-transferase omega-1; GST fold, reductase; HET: ASC; 1.70A {Homo sapiens} PDB: 1eem_A* 3lfl_A* Length = 241 Back     alignment and structure
>4dej_A Glutathione S-transferase related protein; transferase-like protein, transcription regulation; 2.90A {Idiomarina loihiensis} Length = 231 Back     alignment and structure
>1oyj_A Glutathione S-transferase; herbicide detoxification; HET: GSH; 1.95A {Oryza sativa} SCOP: a.45.1.1 c.47.1.5 Length = 231 Back     alignment and structure
>3lyp_A Stringent starvation protein A; structural genomics, GST-superfamily, SSPA, stringent starva protein A homolog, PSI-2; 1.60A {Pseudomonas fluorescens} PDB: 3mdk_A Length = 215 Back     alignment and structure
>3q18_A GSTO-2, glutathione S-transferase omega-2; glutathione transferase, dehydroascorbate reductase, reductase; 1.70A {Homo sapiens} PDB: 3q19_A* 3qag_A* Length = 239 Back     alignment and structure
>3niv_A Glutathione S-transferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.30A {Legionella pneumophila subsp} Length = 222 Back     alignment and structure
>3tou_A Glutathione S-transferase protein; GSH binding site, GSH; HET: GSH; 1.75A {Ralstonia solanacearum} PDB: 3tot_A* Length = 226 Back     alignment and structure
>4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Length = 471 Back     alignment and structure
>4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Length = 471 Back     alignment and structure
>2cz2_A Maleylacetoacetate isomerase; structural genomics, GST, GSTZ1-1, NPPSFA, national project protein structural and functional analyses; HET: GSH; 1.40A {Mus musculus} PDB: 2cz3_A 1fw1_A* Length = 223 Back     alignment and structure
>3lxz_A Glutathione S-transferase family protein; structural genomics, PP0183, PSI-2, protein structure initiative; 1.76A {Pseudomonas putida} PDB: 3pr8_A* Length = 229 Back     alignment and structure
>3ubk_A Glutathione transferase; GSH binding; 1.95A {Leptospira interrogans serovar lai} PDB: 3ubl_A* Length = 242 Back     alignment and structure
>3r2q_A Uncharacterized GST-like protein YIBF; transferase, glutathione; HET: GSH; 1.05A {Escherichia coli} Length = 202 Back     alignment and structure
>3cbu_A Probable GST-related protein; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics; 2.05A {Ralstonia eutropha} Length = 214 Back     alignment and structure
>3m0f_A Uncharacterized protein GST_N; PSI-2, NYSGXRC, glutathione, structural genomics, protein structure initiative; HET: GSH; 1.60A {Pseudomonas fluorescens} PDB: 3lxt_A* Length = 213 Back     alignment and structure
>2v6k_A Maleylpyruvate isomerase; glutathione-S-transferase, GST, plasmid, bacterial, biodegradation, fumaryl pyruvate; HET: TGG; 1.3A {Ralstonia SP} PDB: 2jl4_A* Length = 214 Back     alignment and structure
>1e6b_A Glutathione S-transferase; 1.65A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 Length = 221 Back     alignment and structure
>1k0m_A CLIC1, NCC27, chloride intracellular channel protein 1; glutathione-S-tranferase superfamily, chloride ION channel, metal transport; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1k0n_A* 1k0o_A 1rk4_A 3uvh_A 3o3t_A 3p90_A 3qr6_A 3p8w_A 3tgz_A 3ma4_A 3swl_A Length = 241 Back     alignment and structure
>2ahe_A Chloride intracellular channel protein 4; glutathione-S-transferase superfamily, CLIC4, NCC27, chloride ION channel, metal transport; 1.80A {Homo sapiens} PDB: 2d2z_A Length = 267 Back     alignment and structure
>3fy7_A Chloride intracellular channel protein 3; GST, glutathione, CLIC, chloride channel, ION transport, ionic channel, nucleus, transport, gated channel; 1.95A {Homo sapiens} PDB: 3kjy_A Length = 250 Back     alignment and structure
>2r4v_A XAP121, chloride intracellular channel protein 2; chloride intracellular channels, CLIC2, pore-forming protein ryanodine receptor, chloride channel; HET: GSH; 1.85A {Homo sapiens} PDB: 2r5g_A 2per_A* Length = 247 Back     alignment and structure
>3qav_A RHO-class glutathione S-transferase; cytosol; 2.10A {Laternula elliptica} PDB: 3qaw_A* Length = 243 Back     alignment and structure
>3ic8_A Uncharacterized GST-like proteinprotein; glutathione, transferase, PSI, MCSG, structural genomics; 2.40A {Pseudomonas syringae PV} Length = 310 Back     alignment and structure
>3ibh_A GST-II, saccharomyces cerevisiae GTT2; glutathione S-transferase, transferase; HET: GSH; 2.10A {Saccharomyces cerevisiae} PDB: 3erf_A* 3erg_A* Length = 233 Back     alignment and structure
>3n5o_A Glutathione transferase; seattle structural genomics center for infectious disease, S GST, pathogenic fungus, coccidioidomycosis; HET: GSH; 1.85A {Coccidioides immitis} PDB: 3lg6_A* Length = 235 Back     alignment and structure
>2yv7_A CG10997-PA, LD46306P, CLIC; dmclic, chloride ION channel, GST fold, metal transport; 1.70A {Drosophila melanogaster} Length = 260 Back     alignment and structure
>3bby_A Uncharacterized GST-like protein YFCF; NP_416804.1, glutathione S-transferase, N-terminal domain, S genomics; 1.85A {Escherichia coli} Length = 215 Back     alignment and structure
>1gnw_A Glutathione S-transferase; herbicide detoxification; HET: GTX; 2.20A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 PDB: 1bx9_A* Length = 211 Back     alignment and structure
>1axd_A Glutathione S-transferase I; transferase, herbicide detoxification, transferase-transfera inhibitor complex; HET: GGL CYW; 2.50A {Zea mays} SCOP: a.45.1.1 c.47.1.5 PDB: 1bye_A* Length = 209 Back     alignment and structure
>2c3n_A Glutathione S-transferase theta 1; glutathione transferase, polymorphism; 1.5A {Homo sapiens} PDB: 2c3q_A* 2c3t_A Length = 247 Back     alignment and structure
>1ljr_A HGST T2-2, glutathione S-transferase; HET: GSH; 3.20A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 2ljr_A 3ljr_A* Length = 244 Back     alignment and structure
>1aw9_A Glutathione S-transferase III; herbicide detoxification; 2.20A {Zea mays} SCOP: a.45.1.1 c.47.1.5 Length = 216 Back     alignment and structure
>2imi_A Epsilon-class glutathione S-transferase; HET: GSH; 1.40A {Anopheles gambiae} PDB: 2il3_A* 2imk_A* Length = 221 Back     alignment and structure
>1v2a_A Glutathione transferase GST1-6; glutathione S-transferase, detoxification, xenobiotics; HET: GTS; 2.15A {Anopheles dirus} SCOP: a.45.1.1 c.47.1.5 Length = 210 Back     alignment and structure
>3ay8_A Glutathione S-transferase; GST fold, GST binding, cytosolic; 2.10A {Bombyx mori} Length = 216 Back     alignment and structure
>2dsa_A Glutathione S-transferase; HET: GSH HPX; 2.10A {Burkholderia xenovorans} PDB: 2gdr_A* Length = 203 Back     alignment and structure
>3ir4_A Glutaredoxin 2; glutathione, IDP00895, structural genomics, for structural genomics of infectious diseases, csgid, oxidoreductase; HET: MSE GSH; 1.20A {Salmonella enterica subsp} PDB: 1g7o_A Length = 218 Back     alignment and structure
>1r5a_A Glutathione transferase; glutathione S-transferase, GST, GSH, mosquito, detoxification, xenobiotics; HET: GTS; 2.50A {Anopheles cracens} SCOP: a.45.1.1 c.47.1.5 Length = 218 Back     alignment and structure
>1n2a_A Glutathione S-transferase; HET: GTS; 1.90A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 PDB: 1a0f_A* Length = 201 Back     alignment and structure
>1pn9_A GST class-delta, glutathione S-transferase 1-6; protein inhibitor complex; HET: GTX; 2.00A {Anopheles gambiae} SCOP: a.45.1.1 c.47.1.5 Length = 209 Back     alignment and structure
>1nhy_A EF-1-gamma 1, elongation factor 1-gamma 1; protein synthesis, GST-like, translation; 3.00A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 Length = 219 Back     alignment and structure
>3lsz_A Glutathione S-transferase; xenobiotic, biodegradative metabolism, PSI2, NYSGXRC, structural genomics, protein structure initiative; HET: GSH; 1.70A {Rhodobacter sphaeroides} Length = 225 Back     alignment and structure
>3ein_A GST class-theta, glutathione S-transferase 1-1; delta-class GST; HET: GSH; 1.13A {Drosophila melanogaster} PDB: 3mak_A* 3f6f_A 3gh6_A* 1jlv_A* Length = 209 Back     alignment and structure
>1pmt_A PMGST, GST B1-1, glutathione transferase; glutathione-conjugating, A putative oxidoreduct; HET: GSH; 2.50A {Proteus mirabilis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pmt_A* Length = 203 Back     alignment and structure
>2pvq_A Glutathione S-transferase; xenobiotics detoxification, H-site; HET: GSH; 1.80A {Ochrobactrum anthropi} PDB: 2nto_A* Length = 201 Back     alignment and structure
>4g9h_A Glutathione S-transferase; GST, enzyme function initiative, structural genomics; HET: GSH; 2.10A {Yersinia pestis} Length = 211 Back     alignment and structure
>3m8n_A Possible glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, nysgxrc; 2.04A {Rhodopseudomonas palustris} Length = 225 Back     alignment and structure
>1f2e_A Glutathione S-transferase; GST complexed with glutathione, thioredoxin superfamily fold transferase; HET: GSH; 2.30A {Sphingomonas paucimobilis} SCOP: a.45.1.1 c.47.1.5 Length = 201 Back     alignment and structure
>2ycd_A Glutathione S-transferase; SOIL bacteria, herbicide detoxification; HET: GTB; 1.40A {Agrobacterium tumefaciens} PDB: 3lq7_A Length = 230 Back     alignment and structure
>3uar_A Glutathione S-transferase; GSH binding site; HET: GSH; 2.60A {Methylococcus capsulatus} PDB: 3uap_A* Length = 227 Back     alignment and structure
>1z9h_A Membrane-associated prostaglandin E synthase-2; membran associated protein, indomethacin, isomerase; HET: IMN; 2.60A {Macaca fascicularis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pbj_A* Length = 290 Back     alignment and structure
>3m3m_A Glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, N SGX research center for structural genomics; HET: GSH; 1.75A {Pseudomonas fluorescens} Length = 210 Back     alignment and structure
>1vf1_A Glutathione S-transferase 3; detoxification; HET: GSH; 1.77A {Gallus gallus} PDB: 1vf2_A* 1vf3_A* 1vf4_A Length = 229 Back     alignment and structure
>3f6d_A Adgstd4-4, glutathione transferase GST1-4; HET: GTX; 1.70A {Anopheles dirus} PDB: 3f63_A* 1jlw_A* 3g7i_A* 3g7j_A* Length = 219 Back     alignment and structure
>1k3y_A GSTA1-1, glutathione S-transferase A1; S-hexyl glutatione, water structu transferase; HET: GTX; 1.30A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsf_A* 1guh_A* 1gsd_A* 1k3o_A 1k3l_A* 1pl1_A* 1pkz_A 1pkw_A* 2r6k_A* 1gse_A* 3u6v_A 1usb_A* 1ydk_A* 3q74_A 3ktl_A* 1pl2_A* 2r3x_A* 1xwg_A 3l0h_A* 1ags_A* ... Length = 221 Back     alignment and structure
>1b48_A GST, mgsta4-4, protein (glutathione S-transferase); subunit cooperativity; HET: HAG GSH; 2.60A {Mus musculus} SCOP: a.45.1.1 c.47.1.5 PDB: 1guk_A Length = 221 Back     alignment and structure
>2uz8_A Eukaryotic translation elongation factor 1 epsilon-1; protein biosynthesis, aminoacyl-tRNA synthetase, GST, nuclear protein, RNA-binding protein; HET: MSE; 2.0A {Homo sapiens} Length = 174 Back     alignment and structure
>2x64_A Glutathione-S-transferase; detoxification enzyme; HET: GSH; 2.30A {Xylella fastidiosa} Length = 207 Back     alignment and structure
>1yq1_A Glutathione S-transferase; nematoda, structural genomics, PSI, protein structure initiative; 3.00A {Caenorhabditis elegans} Length = 208 Back     alignment and structure
>3ik7_A Glutathione S-transferase A4; human GST A4-4, enzyme, cytoplasm, polymorphism; HET: BOB; 1.97A {Homo sapiens} PDB: 1gum_A 1gul_A* Length = 222 Back     alignment and structure
>2cvd_A Glutathione-requiring prostaglandin D synthase; glutathione-S-transferase, isomerase; HET: GSH HQL; 1.45A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1iyi_A* 1v40_A* 1iyh_A* 3vi5_A* 3vi7_A* 2vcq_A* 2vcw_A* 2vcx_A* 2vcz_A* 2vd0_A* 2vd1_A* 3kxo_A* 3ee2_A* 1pd2_1* Length = 198 Back     alignment and structure
>3iso_A Putative glutathione transferase; GST; HET: GSH; 1.90A {Clonorchis sinensis} Length = 218 Back     alignment and structure
>4exj_A Uncharacterized protein; transferase-like protein, transcription regulation, transfer structural genomics; 1.64A {Lodderomyces elongisporus nrrl yb-4239} Length = 238 Back     alignment and structure
>2a2r_A Glutathione S-transferase P; detoxification, nitric oxide carrier, S- nitrosoglutathione; HET: MES GSN; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 11gs_A* 12gs_A* 14gs_A* 16gs_A* 18gs_A* 21gs_A* 13gs_A* 2a2s_A* 3dd3_A* 3dgq_A* 3n9j_A* 3pgt_A* 1pgt_A* 2pgt_A* 4pgt_A* 22gs_A* 17gs_A* 3gus_A* 10gs_A* 1aqv_A* ... Length = 210 Back     alignment and structure
>1b8x_A Protein (AML-1B); nuclear matrix targeting signal protein, signal protein; 2.70A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 Length = 280 Back     alignment and structure
>2fhe_A GST, glutathione S-transferase; transferase-substrate complex; HET: GSH; 2.30A {Fasciola hepatica} SCOP: a.45.1.1 c.47.1.5 PDB: 2wrt_A 1fhe_A* Length = 216 Back     alignment and structure
>2fno_A AGR_PAT_752P; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics, JCSG; 2.00A {Agrobacterium tumefaciens} SCOP: a.45.1.1 c.47.1.5 Length = 248 Back     alignment and structure
>2on7_A Nagst-1, Na glutathione S-transferase 1; hookworm; 2.40A {Necator americanus} Length = 206 Back     alignment and structure
>2ws2_A NU-class GST, glutathione S-transferase; parasite, nematode; 2.01A {Haemonchus contortus} Length = 204 Back     alignment and structure
>2on5_A Nagst-2, Na glutathione S-transferase 2; hookworm; HET: GSH; 1.90A {Necator americanus} Length = 206 Back     alignment and structure
>2gsq_A Squid GST, glutathione S-transferase; squid digestive gland, sigma class; HET: GBI; 2.20A {Ommastrephes sloani} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsq_A* Length = 202 Back     alignment and structure
>1dug_A Chimera of glutathione S-transferase-synthetic linker-C-terminal fibrinogen gamma...; gamma chain integrin fragment; HET: GSH; 1.80A {Schistosoma japonicum} SCOP: a.45.1.1 c.47.1.5 PDB: 1gne_A* 3qmz_T 1y6e_A 1m9a_A* 1gtb_A* 1gta_A* 1m99_A* 1m9b_A* 1ua5_A* 1u87_A* 1u88_A* 3crt_A* 3cru_A* 3d0z_A* Length = 234 Back     alignment and structure
>1zl9_A GST class-sigma, glutathione S-transferase 5; glutathione transferase, C.elegans; HET: GSH; 2.01A {Caenorhabditis elegans} Length = 207 Back     alignment and structure
>1tu7_A Glutathione S-transferase 2; HET: GSH; 1.50A {Onchocerca volvulus} SCOP: a.45.1.1 c.47.1.5 PDB: 1tu8_A* Length = 208 Back     alignment and structure
>1gsu_A GST, CGSTM1-1, class-MU glutathione S-transferase; detoxification enzyme, S-hexyl glutathione; HET: GTX; 1.94A {Gallus gallus} SCOP: a.45.1.1 c.47.1.5 PDB: 1c72_A* Length = 219 Back     alignment and structure
>1bg5_A MAB, fusion protein of alpha-Na,K-ATPase with glutathione S-transferase; ankyrin binding, carrier crystallization, ION transport; 2.60A {Rattus norvegicus} SCOP: a.45.1.1 c.47.1.5 Length = 254 Back     alignment and structure
>3gtu_B Glutathione S-transferase; conjugation, detoxification, cytosolic, heterodimer; 2.80A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 Length = 224 Back     alignment and structure
>1okt_A Glutathione S-transferase; GST; 1.9A {Plasmodium falciparum} SCOP: a.45.1.1 c.47.1.5 PDB: 1pa3_A 1q4j_A* 3fr9_A* 3frc_A* 2aaw_A* 3fr6_A 3fr3_A* Length = 211 Back     alignment and structure
>2yv9_A Chloride intracellular channel EXC-4; chloride ION channel, CLIC, GST fold, metal transport; 1.60A {Caenorhabditis elegans} Length = 291 Back     alignment and structure
>1tw9_A Glutathione S-transferase 2; 1.71A {Heligmosomoides polygyrus} SCOP: a.45.1.1 c.47.1.5 Length = 206 Back     alignment and structure
>2c4j_A Glutathione S-transferase MU 2; glutathione transferase, multigene family; HET: GSO; 1.35A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1xw5_A* 1ykc_A* 2ab6_A* 2gtu_A 3gtu_A 3gur_A* 1hna_A* 1hnb_A* 1hnc_A* 1xw6_A* 1xwk_A* 1yj6_A* 2f3m_A* 2dc5_A 1gtu_A 4gtu_A 6gsu_A* 6gsv_A* 6gsw_A* 2gst_A* ... Length = 218 Back     alignment and structure
>1m0u_A GST2 gene product; flight muscle protein, sigma, transferase; HET: GSH; 1.75A {Drosophila melanogaster} SCOP: a.45.1.1 c.47.1.5 Length = 249 Back     alignment and structure
>3h1n_A Probable glutathione S-transferase; APC84167, bordetella bronchisepti structural genomics, PSI-2, protein structure initiative; 1.83A {Bordetella bronchiseptica RB50} Length = 252 Back     alignment and structure
>2hnl_A Glutathione S-transferase 1; prostaglandin synthase, river BLI onchocerca volvulus, immune modulation; HET: GSH; 2.00A {Onchocerca volvulus} Length = 225 Back     alignment and structure
>2wb9_A Glutathione transferase sigma class; thioredoxin fold; HET: GSH; 1.59A {Fasciola hepatica} PDB: 2wdu_A* Length = 211 Back     alignment and structure
>1oe8_A Glutathione S-transferase; schistosomiasis, detoxifying enzyme, prostaglandin D2 synthase, vaccine candidate; HET: GSH; 1.65A {Schistosoma haematobium} SCOP: a.45.1.1 c.47.1.5 PDB: 1oe7_A* 2c80_A* 2ca8_A* 2f8f_A* 2c8u_A 2caq_A* 2cai_A* 1u3i_A* Length = 211 Back     alignment and structure
>3c8e_A YGHU, glutathione S-transferase homologue; glutathione transferase homologue, E. coli; HET: GSH; 1.50A {Escherichia coli} Length = 288 Back     alignment and structure
>1k0d_A URE2 protein; nitrate assimilation, structural genomics, gene regulation; HET: GSH; 2.20A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 PDB: 1jzr_A* 1k0b_A* 1k0c_A* 1k0a_A* 1g6w_A 1g6y_A 1hqo_A Length = 260 Back     alignment and structure
>3gx0_A GST-like protein YFCG; transferase, glutathione, glutathione disulfide, disulfide bond oxidoreductase; HET: GDS; 2.30A {Escherichia coli} Length = 215 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query222
2vo4_A219 2,4-D inducible glutathione S-transferase; herbici 100.0
4hoj_A210 REGF protein; GST, glutathione S-transferase, enzy 100.0
3lyk_A216 Stringent starvation protein A homolog; structural 100.0
1gwc_A230 Glutathione S-transferase TSI-1; herbicide detoxif 100.0
4glt_A225 Glutathione S-transferase-like protein; structural 100.0
1oyj_A231 Glutathione S-transferase; herbicide detoxificatio 100.0
4g10_A265 Glutathione S-transferase homolog; thioredoxin fol 100.0
4hi7_A228 GI20122; GST, glutathione S-transferase, enzyme fu 100.0
3vk9_A216 Glutathione S-transferase delta; glutathione bindi 100.0
3lyp_A215 Stringent starvation protein A; structural genomic 100.0
3ubk_A242 Glutathione transferase; GSH binding; 1.95A {Lepto 100.0
1yy7_A213 SSPA, stringent starvation protein A; GST fold, tr 100.0
3lxz_A229 Glutathione S-transferase family protein; structur 100.0
4dej_A231 Glutathione S-transferase related protein; transfe 100.0
3vln_A241 GSTO-1, glutathione S-transferase omega-1; GST fol 100.0
3q18_A239 GSTO-2, glutathione S-transferase omega-2; glutath 100.0
3r2q_A202 Uncharacterized GST-like protein YIBF; transferase 100.0
3m0f_A213 Uncharacterized protein GST_N; PSI-2, NYSGXRC, glu 100.0
4gf0_A215 Glutathione S-transferase; GST, enzyme function in 100.0
3ibh_A233 GST-II, saccharomyces cerevisiae GTT2; glutathione 100.0
3rbt_A246 Glutathione transferase O1; glutathione S-transfer 100.0
3tou_A226 Glutathione S-transferase protein; GSH binding sit 100.0
3n5o_A235 Glutathione transferase; seattle structural genomi 100.0
4iel_A229 Glutathione S-transferase, N-terminal domain PROT; 100.0
3gtu_B224 Glutathione S-transferase; conjugation, detoxifica 100.0
2cz2_A223 Maleylacetoacetate isomerase; structural genomics, 100.0
3ay8_A216 Glutathione S-transferase; GST fold, GST binding, 100.0
4gci_A211 Glutathione S-transferase; GST, enzyme function in 100.0
3cbu_A214 Probable GST-related protein; thioredoxin fold, GS 100.0
3qav_A243 RHO-class glutathione S-transferase; cytosol; 2.10 100.0
3niv_A222 Glutathione S-transferase; structural genomics, PS 100.0
3ein_A209 GST class-theta, glutathione S-transferase 1-1; de 100.0
1gnw_A211 Glutathione S-transferase; herbicide detoxificatio 100.0
2imi_A221 Epsilon-class glutathione S-transferase; HET: GSH; 100.0
2v6k_A214 Maleylpyruvate isomerase; glutathione-S-transferas 100.0
3iso_A218 Putative glutathione transferase; GST; HET: GSH; 1 100.0
2gsq_A202 Squid GST, glutathione S-transferase; squid digest 100.0
1axd_A209 Glutathione S-transferase I; transferase, herbicid 100.0
1pn9_A209 GST class-delta, glutathione S-transferase 1-6; pr 100.0
3m3m_A210 Glutathione S-transferase; PSI-II, structural geno 100.0
1r5a_A218 Glutathione transferase; glutathione S-transferase 100.0
2x64_A207 Glutathione-S-transferase; detoxification enzyme; 100.0
4hz2_A230 Glutathione S-transferase domain; glutathione,enzy 100.0
2cvd_A198 Glutathione-requiring prostaglandin D synthase; gl 100.0
3f6d_A219 Adgstd4-4, glutathione transferase GST1-4; HET: GT 100.0
1v2a_A210 Glutathione transferase GST1-6; glutathione S-tran 100.0
3bby_A215 Uncharacterized GST-like protein YFCF; NP_416804.1 100.0
2fhe_A216 GST, glutathione S-transferase; transferase-substr 100.0
1tu7_A208 Glutathione S-transferase 2; HET: GSH; 1.50A {Onch 100.0
1yq1_A208 Glutathione S-transferase; nematoda, structural ge 100.0
1gsu_A219 GST, CGSTM1-1, class-MU glutathione S-transferase; 100.0
1e6b_A221 Glutathione S-transferase; 1.65A {Arabidopsis thal 100.0
1k0m_A241 CLIC1, NCC27, chloride intracellular channel prote 100.0
3gx0_A215 GST-like protein YFCG; transferase, glutathione, g 100.0
2pvq_A201 Glutathione S-transferase; xenobiotics detoxificat 100.0
2a2r_A210 Glutathione S-transferase P; detoxification, nitri 100.0
3lsz_A225 Glutathione S-transferase; xenobiotic, biodegradat 100.0
3uar_A227 Glutathione S-transferase; GSH binding site; HET: 100.0
1n2a_A201 Glutathione S-transferase; HET: GTS; 1.90A {Escher 100.0
1f2e_A201 Glutathione S-transferase; GST complexed with glut 100.0
3ik7_A222 Glutathione S-transferase A4; human GST A4-4, enzy 100.0
4hz4_A217 Glutathione-S-transferase; enzyme function initiat 100.0
1ljr_A244 HGST T2-2, glutathione S-transferase; HET: GSH; 3. 100.0
4id0_A214 Glutathione S-transferase-like protein YIBF; GST, 100.0
1oe8_A211 Glutathione S-transferase; schistosomiasis, detoxi 100.0
2dsa_A203 Glutathione S-transferase; HET: GSH HPX; 2.10A {Bu 100.0
2wb9_A211 Glutathione transferase sigma class; thioredoxin f 100.0
3m8n_A225 Possible glutathione S-transferase; PSI-II, struct 100.0
1m0u_A249 GST2 gene product; flight muscle protein, sigma, t 100.0
4ecj_A244 Glutathione S-transferase; transferase-like protei 100.0
1pmt_A203 PMGST, GST B1-1, glutathione transferase; glutathi 100.0
1aw9_A216 Glutathione S-transferase III; herbicide detoxific 100.0
1tw9_A206 Glutathione S-transferase 2; 1.71A {Heligmosomoide 100.0
1dug_A234 Chimera of glutathione S-transferase-synthetic lin 100.0
1nhy_A219 EF-1-gamma 1, elongation factor 1-gamma 1; protein 100.0
4exj_A238 Uncharacterized protein; transferase-like protein, 100.0
2c4j_A218 Glutathione S-transferase MU 2; glutathione transf 100.0
4ikh_A244 Glutathione S-transferase; enzyme function initiat 100.0
2hnl_A225 Glutathione S-transferase 1; prostaglandin synthas 100.0
2r4v_A247 XAP121, chloride intracellular channel protein 2; 100.0
2on5_A206 Nagst-2, Na glutathione S-transferase 2; hookworm; 100.0
2on7_A206 Nagst-1, Na glutathione S-transferase 1; hookworm; 100.0
1zl9_A207 GST class-sigma, glutathione S-transferase 5; glut 100.0
1k3y_A221 GSTA1-1, glutathione S-transferase A1; S-hexyl glu 100.0
4ags_A 471 Thiol-dependent reductase 1; transferase, leishman 100.0
2ahe_A267 Chloride intracellular channel protein 4; glutathi 100.0
1okt_A211 Glutathione S-transferase; GST; 1.9A {Plasmodium f 100.0
1b8x_A280 Protein (AML-1B); nuclear matrix targeting signal 100.0
2ycd_A230 Glutathione S-transferase; SOIL bacteria, herbicid 100.0
3fy7_A250 Chloride intracellular channel protein 3; GST, glu 100.0
1b48_A221 GST, mgsta4-4, protein (glutathione S-transferase) 100.0
1vf1_A229 Glutathione S-transferase 3; detoxification; HET: 100.0
4ags_A471 Thiol-dependent reductase 1; transferase, leishman 100.0
2c3n_A247 Glutathione S-transferase theta 1; glutathione tra 100.0
2ws2_A204 NU-class GST, glutathione S-transferase; parasite, 100.0
1k0d_A260 URE2 protein; nitrate assimilation, structural gen 100.0
3c8e_A288 YGHU, glutathione S-transferase homologue; glutath 100.0
3h1n_A252 Probable glutathione S-transferase; APC84167, bord 100.0
2yv7_A260 CG10997-PA, LD46306P, CLIC; dmclic, chloride ION c 100.0
1bg5_A254 MAB, fusion protein of alpha-Na,K-ATPase with glut 100.0
3ic8_A310 Uncharacterized GST-like proteinprotein; glutathio 100.0
3ir4_A218 Glutaredoxin 2; glutathione, IDP00895, structural 100.0
2yv9_A291 Chloride intracellular channel EXC-4; chloride ION 100.0
2fno_A248 AGR_PAT_752P; thioredoxin fold, GST C-terminal dom 99.98
3m1g_A362 Putative glutathione S-transferase; ECM4-like subf 99.97
3ppu_A352 Glutathione-S-transferase; GST fold; HET: GSH; 2.3 99.97
4f03_A253 Glutathione transferase; GST fold; 1.80A {Phaneroc 99.97
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 99.96
1z9h_A290 Membrane-associated prostaglandin E synthase-2; me 99.96
4fqu_A313 Putative glutathione transferase; glutathionyl-hyd 99.96
4g0i_A328 Protein YQJG; glutathionyl-hydroquinone reductase, 99.95
2uz8_A174 Eukaryotic translation elongation factor 1 epsilon 99.94
2hra_A209 Glutamyl-tRNA synthetase, cytoplasmic; GST-fold, l 99.91
2hsn_A160 Methionyl-tRNA synthetase, cytoplasmic; protein co 99.78
2hqt_A124 GU4 nucleic-binding protein 1; GST-fold, biosynthe 99.25
1fov_A82 Glutaredoxin 3, GRX3; active site disulfide, CIS P 99.22
2lqo_A92 Putative glutaredoxin RV3198.1/MT3292; TRX fold, o 99.1
3msz_A89 Glutaredoxin 1; alpha-beta sandwich, center for st 99.08
2klx_A89 Glutaredoxin; thioredoxin type domain, ssgcid, ele 99.08
2khp_A92 Glutaredoxin; thioredoxin type domain, ssgcid, ele 99.04
3qmx_A99 Glutaredoxin A, glutaredoxin 3; electron transport 98.96
1nm3_A241 Protein HI0572; hybrid, peroxiredoxin, glutaredoxi 98.92
3ic4_A92 Glutaredoxin (GRX-1); structural genomics, PSI, MC 98.9
1aba_A87 Glutaredoxin; electron transport; HET: MES; 1.45A 98.77
1r7h_A75 NRDH-redoxin; thioredoxin, glutaredoxin, redox pro 98.71
1t1v_A93 SH3BGRL3, SH3 domain-binding glutamic acid-rich pr 98.64
3nzn_A103 Glutaredoxin; structural genomics, PSI2, MCSG, pro 98.59
3h8q_A114 Thioredoxin reductase 3; oxidoreductase, structura 98.52
3rhb_A113 ATGRXC5, glutaredoxin-C5, chloroplastic; thioredox 98.52
3zyw_A111 Glutaredoxin-3; metal binding protein; 1.84A {Homo 98.49
1wik_A109 Thioredoxin-like protein 2; picot homology 2 domai 98.47
2cq9_A130 GLRX2 protein, glutaredoxin 2; glutathione-S-trans 98.44
2ct6_A111 SH3 domain-binding glutamic acid-rich-like protein 98.43
2yan_A105 Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {H 98.42
1kte_A105 Thioltransferase; redox-active center, electron tr 98.41
3ipz_A109 Monothiol glutaredoxin-S14, chloroplastic; electro 98.39
1ego_A85 Glutaredoxin; electron transport; NMR {Escherichia 98.32
2ht9_A146 Glutaredoxin-2; thioredoxin fold, iron-sulfur clus 98.31
2wci_A135 Glutaredoxin-4; redox-active center, iron-sulfur c 98.29
3ctg_A129 Glutaredoxin-2; reduced form, electron transport, 98.28
1h75_A81 Glutaredoxin-like protein NRDH; electron transport 98.26
3c1r_A118 Glutaredoxin-1; oxidized form, oxidoreductase, cyt 98.22
2hze_A114 Glutaredoxin-1; thioredoxin fold, arsenic, dimethy 98.21
2wem_A118 Glutaredoxin-related protein 5; chromosome 14 open 98.18
3l4n_A127 Monothiol glutaredoxin-6; C-terminal domain of GRX 98.18
3gx8_A121 Monothiol glutaredoxin-5, mitochondrial; TRX fold, 98.07
1u6t_A121 SH3 domain-binding glutamic acid-rich-like protein 98.0
2fgx_A107 Putative thioredoxin; NET3, NESG, GFT-glutaredoxin 97.92
2kok_A120 Arsenate reductase; brucellosis, zoonotic, oxidore 97.77
1z3e_A132 Regulatory protein SPX; bacterial transcription re 97.72
1ttz_A87 Conserved hypothetical protein; structural genomic 97.67
2k8s_A80 Thioredoxin; dimer, structural genomics, PSI-2, pr 97.57
2wul_A118 Glutaredoxin related protein 5; chromosome 14 open 97.44
1wjk_A100 C330018D20RIK protein; glutaredoxin, thioredoxin f 97.38
2jad_A362 Yellow fluorescent protein glutaredoxin fusion pro 97.32
2e7p_A116 Glutaredoxin; thioredoxin fold, poplar, electron t 97.27
3rdw_A121 Putative arsenate reductase; structural genomics, 97.14
1rw1_A114 Conserved hypothetical protein YFFB; thioredoxin f 97.11
1s3c_A141 Arsenate reductase; ARSC, arsenite, oxidoreductase 97.08
3fz4_A120 Putative arsenate reductase; APC61768, structural 97.07
3l78_A120 Regulatory protein SPX; transcription, transcripti 97.04
2x8g_A 598 Thioredoxin glutathione reductase; redox-active ce 97.0
3gkx_A120 Putative ARSC family related protein; ARSC family 96.97
3f0i_A119 Arsenate reductase; structural genomics, IDP01300, 96.78
2axo_A270 Hypothetical protein ATU2684; alpha beta protein., 94.63
1fo5_A85 Thioredoxin; disulfide oxidoreductase, structural 93.74
3kp8_A106 Vkorc1/thioredoxin domain protein; blood coagulati 88.33
1nho_A85 Probable thioredoxin; beta sheet, alpha helix, oxi 87.29
3kp9_A291 Vkorc1/thioredoxin domain protein; warfarin, disul 87.18
2hls_A243 Protein disulfide oxidoreductase; thioredoxin fold 84.52
1hyu_A 521 AHPF, alkyl hydroperoxide reductase subunit F; thi 82.78
>2vo4_A 2,4-D inducible glutathione S-transferase; herbicide, TAU class GST, S-(P-nitrobenzyl- glutathione); HET: GTB 4NM; 1.75A {Glycine max} PDB: 3fhs_A* Back     alignment and structure
Probab=100.00  E-value=6.2e-42  Score=264.40  Aligned_cols=215  Identities=46%  Similarity=0.811  Sum_probs=187.4

Q ss_pred             CCCcceEEeeccCCchHHHHHHHHHHhCCCceEEeCCCCCCchhhhhhCCCCCcccEEEeCCeecchHHHHHHHHHhhCC
Q 027498            1 MAEESVKLLGYWASPFALRVKWALKLKGVHYEYVEENLPNKSPLLLRYNPVYKKIPVLVHNGKPLAESLLIIEYIDEAWK   80 (222)
Q Consensus         1 m~~~~~~L~~~~~s~~~~~vr~~L~~~gi~~~~~~~~~~~~~~~~~~~~p~~~~vP~l~~~~~~i~es~~I~~yL~~~~~   80 (222)
                      |+. +++||+++.||+|+++|++|+++||+|+.+.++...+.+++.+.||.+|+||+|++||..++||.+|++||+++++
T Consensus         1 M~~-~~~Ly~~~~sp~~~~v~~~L~~~gi~~e~~~v~~~~~~~~~~~~nP~~g~vP~L~~~g~~l~eS~aI~~yL~~~~~   79 (219)
T 2vo4_A            1 MQD-EVVLLDFWPSPFGMRVRIALAEKGIKYEYKEEDLRNKSPLLLQMNPVHKKIPVLIHNGKPICESLIAVQYIEEVWN   79 (219)
T ss_dssp             CCC-CEEEEECTTCHHHHHHHHHHHHTTCCCEEEECCTTSCCHHHHHHCTTTCCSCEEEETTEEEESHHHHHHHHHHHST
T ss_pred             CCC-ceEEEeccCCchHHHHHHHHHHcCCCceEEecCcccCCHHHHHhCCCCCcCCEEEECCEeeehHHHHHHHHHHhCC
Confidence            775 6999999999999999999999999999999998777899999999537999999999999999999999999998


Q ss_pred             C-CCCCCCCHHHHHHHHHHHHHHhcccchhhhhhhcCCcHHHHHHHH-HHHHHHHHHHHhcCCCcccCCCCChhHHHHHh
Q 027498           81 Q-NPLLPDDPYERANARFWAKFFDEKCVPEVMGAFASKGEEQEKAAK-ARENLKMLERALEGKPFFGGDKIGFLDIAVGW  158 (222)
Q Consensus        81 ~-~~l~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~l~~le~~L~~~~~l~G~~~t~aD~~l~~  158 (222)
                      + ++|+|.++.+++.+++|+.++++.+.+.+...+...++..+...+ +.+.|+.||+.|++++|++|+++|+||+++++
T Consensus        80 ~~~~L~p~~~~~~a~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~l~~le~~L~~~~~l~G~~~t~ADi~l~~  159 (219)
T 2vo4_A           80 DRNPLLPSDPYQRAQTRFWADYVDKKIYDLGRKIWTSKGEEKEAAKKEFIEALKLLEEQLGDKTYFGGDNLGFVDIALVP  159 (219)
T ss_dssp             TSCCCSCSSHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHTTCSBTTBSSCCHHHHHHHH
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHhccchhHHHhhccCcHHHHHHHHHHHHHHHHHHHhhcCCCcccCCCCCHHHHHHHH
Confidence            7 579999999999999999999887777666666555555566677 99999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHhcccccCCCcccHHHHHHHHHhcchhhhhcCCChHHHHHHhhhhhhhhc
Q 027498          159 IGIWGRIVEEIAGVSLIDAETMPLLTAWLNNFLEVPVIKACIPSWHELLEHNKGFHKILT  218 (222)
Q Consensus       159 ~l~~~~~~~~~~~~~~~~~~~~p~l~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~  218 (222)
                      .+.++.......+.++  .++||+|.+|++++.++|++++++++.+...+.+++.++++.
T Consensus       160 ~l~~~~~~~~~~~~~~--~~~~p~l~~w~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~  217 (219)
T 2vo4_A          160 FYTWFKAYETFGTLNI--ESECPKFIAWAKRCLQKESVAKSLPDQQKVYEFIMDLRKKLG  217 (219)
T ss_dssp             HHTTHHHHHHHTTCCH--HHHCHHHHHHHHHHHTSHHHHTTCCCHHHHHHHHHHTHHHHT
T ss_pred             HHHHHHHHHHhcCcch--hhcChHHHHHHHHHhcChHHHHhCCCHHHHHHHHHHHHHHhc
Confidence            9887754322223333  247999999999999999999999999999999999888753



>4hoj_A REGF protein; GST, glutathione S-transferase, enzyme function initiative, structural genomics, transferase; HET: GSH; 1.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3lyk_A Stringent starvation protein A homolog; structural genomics, GST-superfamily, SSPA, PSI-2, protein structure initiative; 2.10A {Haemophilus influenzae} Back     alignment and structure
>1gwc_A Glutathione S-transferase TSI-1; herbicide detoxification, plant, TAU class; HET: GTX; 2.25A {Aegilops tauschii} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>4glt_A Glutathione S-transferase-like protein; structural genomics, function initiative, EFI; HET: GSH; 2.20A {Methylobacillus flagellatus} Back     alignment and structure
>1oyj_A Glutathione S-transferase; herbicide detoxification; HET: GSH; 1.95A {Oryza sativa} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>4g10_A Glutathione S-transferase homolog; thioredoxin fold; HET: MSE GSH; 1.20A {Sphingomonas paucimobilis} Back     alignment and structure
>4hi7_A GI20122; GST, glutathione S-transferase, enzyme function initiative, structural genomics, unknown function; HET: GSH; 1.25A {Drosophila mojavensis} Back     alignment and structure
>3vk9_A Glutathione S-transferase delta; glutathione binding; 2.00A {Bombyx mori} Back     alignment and structure
>3lyp_A Stringent starvation protein A; structural genomics, GST-superfamily, SSPA, stringent starva protein A homolog, PSI-2; 1.60A {Pseudomonas fluorescens} PDB: 3mdk_A Back     alignment and structure
>3ubk_A Glutathione transferase; GSH binding; 1.95A {Leptospira interrogans serovar lai} PDB: 3ubl_A* Back     alignment and structure
>1yy7_A SSPA, stringent starvation protein A; GST fold, transcription; HET: CIT; 2.02A {Yersinia pestis} Back     alignment and structure
>3lxz_A Glutathione S-transferase family protein; structural genomics, PP0183, PSI-2, protein structure initiative; 1.76A {Pseudomonas putida} PDB: 3pr8_A* Back     alignment and structure
>4dej_A Glutathione S-transferase related protein; transferase-like protein, transcription regulation; 2.90A {Idiomarina loihiensis} Back     alignment and structure
>3vln_A GSTO-1, glutathione S-transferase omega-1; GST fold, reductase; HET: ASC; 1.70A {Homo sapiens} PDB: 1eem_A* 3lfl_A* Back     alignment and structure
>3q18_A GSTO-2, glutathione S-transferase omega-2; glutathione transferase, dehydroascorbate reductase, reductase; 1.70A {Homo sapiens} PDB: 3q19_A* 3qag_A* Back     alignment and structure
>3r2q_A Uncharacterized GST-like protein YIBF; transferase, glutathione; HET: GSH; 1.05A {Escherichia coli} Back     alignment and structure
>3m0f_A Uncharacterized protein GST_N; PSI-2, NYSGXRC, glutathione, structural genomics, protein structure initiative; HET: GSH; 1.60A {Pseudomonas fluorescens} PDB: 3lxt_A* Back     alignment and structure
>4gf0_A Glutathione S-transferase; GST, enzyme function initiative, EFI, structural genomics; HET: GSH; 1.75A {Sulfitobacter} Back     alignment and structure
>3ibh_A GST-II, saccharomyces cerevisiae GTT2; glutathione S-transferase, transferase; HET: GSH; 2.10A {Saccharomyces cerevisiae} PDB: 3erf_A* 3erg_A* Back     alignment and structure
>3rbt_A Glutathione transferase O1; glutathione S-transferase omega3; 2.20A {Bombyx mori} Back     alignment and structure
>3tou_A Glutathione S-transferase protein; GSH binding site, GSH; HET: GSH; 1.75A {Ralstonia solanacearum} PDB: 3tot_A* Back     alignment and structure
>3n5o_A Glutathione transferase; seattle structural genomics center for infectious disease, S GST, pathogenic fungus, coccidioidomycosis; HET: GSH; 1.85A {Coccidioides immitis} PDB: 3lg6_A* Back     alignment and structure
>4iel_A Glutathione S-transferase, N-terminal domain PROT; GST, glutathione S-transferase, enzyme function initiative, structural genomics; HET: GSH; 1.60A {Burkholderia ambifaria} Back     alignment and structure
>3gtu_B Glutathione S-transferase; conjugation, detoxification, cytosolic, heterodimer; 2.80A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2cz2_A Maleylacetoacetate isomerase; structural genomics, GST, GSTZ1-1, NPPSFA, national project protein structural and functional analyses; HET: GSH; 1.40A {Mus musculus} PDB: 2cz3_A 1fw1_A* Back     alignment and structure
>3ay8_A Glutathione S-transferase; GST fold, GST binding, cytosolic; 2.10A {Bombyx mori} Back     alignment and structure
>4gci_A Glutathione S-transferase; GST, enzyme function initiative, structural genomics; HET: GSH; 1.50A {Yersinia pestis} PDB: 4g9h_A* Back     alignment and structure
>3cbu_A Probable GST-related protein; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics; 2.05A {Ralstonia eutropha} Back     alignment and structure
>3qav_A RHO-class glutathione S-transferase; cytosol; 2.10A {Laternula elliptica} PDB: 3qaw_A* Back     alignment and structure
>3niv_A Glutathione S-transferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.30A {Legionella pneumophila subsp} Back     alignment and structure
>3ein_A GST class-theta, glutathione S-transferase 1-1; delta-class GST; HET: GSH; 1.13A {Drosophila melanogaster} PDB: 3mak_A* 3f6f_A 3gh6_A* 1jlv_A* Back     alignment and structure
>1gnw_A Glutathione S-transferase; herbicide detoxification; HET: GTX; 2.20A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 PDB: 1bx9_A* Back     alignment and structure
>2imi_A Epsilon-class glutathione S-transferase; HET: GSH; 1.40A {Anopheles gambiae} PDB: 2il3_A* 2imk_A* Back     alignment and structure
>2v6k_A Maleylpyruvate isomerase; glutathione-S-transferase, GST, plasmid, bacterial, biodegradation, fumaryl pyruvate; HET: TGG; 1.3A {Ralstonia SP} PDB: 2jl4_A* Back     alignment and structure
>3iso_A Putative glutathione transferase; GST; HET: GSH; 1.90A {Clonorchis sinensis} Back     alignment and structure
>2gsq_A Squid GST, glutathione S-transferase; squid digestive gland, sigma class; HET: GBI; 2.20A {Ommastrephes sloani} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsq_A* Back     alignment and structure
>1axd_A Glutathione S-transferase I; transferase, herbicide detoxification, transferase-transfera inhibitor complex; HET: GGL CYW; 2.50A {Zea mays} SCOP: a.45.1.1 c.47.1.5 PDB: 1bye_A* Back     alignment and structure
>1pn9_A GST class-delta, glutathione S-transferase 1-6; protein inhibitor complex; HET: GTX; 2.00A {Anopheles gambiae} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3m3m_A Glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, N SGX research center for structural genomics; HET: GSH; 1.75A {Pseudomonas fluorescens} Back     alignment and structure
>1r5a_A Glutathione transferase; glutathione S-transferase, GST, GSH, mosquito, detoxification, xenobiotics; HET: GTS; 2.50A {Anopheles cracens} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2x64_A Glutathione-S-transferase; detoxification enzyme; HET: GSH; 2.30A {Xylella fastidiosa} Back     alignment and structure
>4hz2_A Glutathione S-transferase domain; glutathione,enzyme function initiative; HET: GSH; 1.50A {Xanthobacter autotrophicus} Back     alignment and structure
>2cvd_A Glutathione-requiring prostaglandin D synthase; glutathione-S-transferase, isomerase; HET: GSH HQL; 1.45A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1iyi_A* 1v40_A* 1iyh_A* 3vi5_A* 3vi7_A* 2vcq_A* 2vcw_A* 2vcx_A* 2vcz_A* 2vd0_A* 2vd1_A* 3kxo_A* 3ee2_A* 1pd2_1* Back     alignment and structure
>3f6d_A Adgstd4-4, glutathione transferase GST1-4; HET: GTX; 1.70A {Anopheles dirus} PDB: 3f63_A* 1jlw_A* 3g7i_A* 3g7j_A* Back     alignment and structure
>1v2a_A Glutathione transferase GST1-6; glutathione S-transferase, detoxification, xenobiotics; HET: GTS; 2.15A {Anopheles dirus} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3bby_A Uncharacterized GST-like protein YFCF; NP_416804.1, glutathione S-transferase, N-terminal domain, S genomics; 1.85A {Escherichia coli} Back     alignment and structure
>2fhe_A GST, glutathione S-transferase; transferase-substrate complex; HET: GSH; 2.30A {Fasciola hepatica} SCOP: a.45.1.1 c.47.1.5 PDB: 2wrt_A 1fhe_A* Back     alignment and structure
>1tu7_A Glutathione S-transferase 2; HET: GSH; 1.50A {Onchocerca volvulus} SCOP: a.45.1.1 c.47.1.5 PDB: 1tu8_A* Back     alignment and structure
>1yq1_A Glutathione S-transferase; nematoda, structural genomics, PSI, protein structure initiative; 3.00A {Caenorhabditis elegans} Back     alignment and structure
>1gsu_A GST, CGSTM1-1, class-MU glutathione S-transferase; detoxification enzyme, S-hexyl glutathione; HET: GTX; 1.94A {Gallus gallus} SCOP: a.45.1.1 c.47.1.5 PDB: 1c72_A* Back     alignment and structure
>1e6b_A Glutathione S-transferase; 1.65A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1k0m_A CLIC1, NCC27, chloride intracellular channel protein 1; glutathione-S-tranferase superfamily, chloride ION channel, metal transport; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1k0n_A* 1k0o_A 1rk4_A 3uvh_A 3o3t_A 3p90_A 3qr6_A 3p8w_A 3tgz_A 3ma4_A 3swl_A Back     alignment and structure
>3gx0_A GST-like protein YFCG; transferase, glutathione, glutathione disulfide, disulfide bond oxidoreductase; HET: GDS; 2.30A {Escherichia coli} Back     alignment and structure
>2pvq_A Glutathione S-transferase; xenobiotics detoxification, H-site; HET: GSH; 1.80A {Ochrobactrum anthropi} PDB: 2nto_A* Back     alignment and structure
>2a2r_A Glutathione S-transferase P; detoxification, nitric oxide carrier, S- nitrosoglutathione; HET: MES GSN; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 11gs_A* 12gs_A* 14gs_A* 16gs_A* 18gs_A* 21gs_A* 13gs_A* 2a2s_A* 3dd3_A* 3dgq_A* 3n9j_A* 3pgt_A* 1pgt_A* 2pgt_A* 4pgt_A* 22gs_A* 17gs_A* 3gus_A* 10gs_A* 1aqv_A* ... Back     alignment and structure
>3lsz_A Glutathione S-transferase; xenobiotic, biodegradative metabolism, PSI2, NYSGXRC, structural genomics, protein structure initiative; HET: GSH; 1.70A {Rhodobacter sphaeroides} Back     alignment and structure
>3uar_A Glutathione S-transferase; GSH binding site; HET: GSH; 2.60A {Methylococcus capsulatus} PDB: 3uap_A* Back     alignment and structure
>1n2a_A Glutathione S-transferase; HET: GTS; 1.90A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 PDB: 1a0f_A* Back     alignment and structure
>1f2e_A Glutathione S-transferase; GST complexed with glutathione, thioredoxin superfamily fold transferase; HET: GSH; 2.30A {Sphingomonas paucimobilis} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3ik7_A Glutathione S-transferase A4; human GST A4-4, enzyme, cytoplasm, polymorphism; HET: BOB; 1.97A {Homo sapiens} PDB: 1gum_A 1gul_A* Back     alignment and structure
>4hz4_A Glutathione-S-transferase; enzyme function initiative; 1.62A {Actinobacillus pleuropneumoniae} Back     alignment and structure
>1ljr_A HGST T2-2, glutathione S-transferase; HET: GSH; 3.20A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 2ljr_A 3ljr_A* Back     alignment and structure
>4id0_A Glutathione S-transferase-like protein YIBF; GST, enzyme function initiative, structural genomics; HET: GSF; 1.10A {Pseudomonas fluorescens} PDB: 4ibp_A* Back     alignment and structure
>1oe8_A Glutathione S-transferase; schistosomiasis, detoxifying enzyme, prostaglandin D2 synthase, vaccine candidate; HET: GSH; 1.65A {Schistosoma haematobium} SCOP: a.45.1.1 c.47.1.5 PDB: 1oe7_A* 2c80_A* 2ca8_A* 2f8f_A* 2c8u_A 2caq_A* 2cai_A* 1u3i_A* Back     alignment and structure
>2dsa_A Glutathione S-transferase; HET: GSH HPX; 2.10A {Burkholderia xenovorans} PDB: 2gdr_A* Back     alignment and structure
>2wb9_A Glutathione transferase sigma class; thioredoxin fold; HET: GSH; 1.59A {Fasciola hepatica} PDB: 2wdu_A* Back     alignment and structure
>3m8n_A Possible glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, nysgxrc; 2.04A {Rhodopseudomonas palustris} Back     alignment and structure
>1m0u_A GST2 gene product; flight muscle protein, sigma, transferase; HET: GSH; 1.75A {Drosophila melanogaster} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>4ecj_A Glutathione S-transferase; transferase-like protein, transcription regulation; HET: GSH; 1.76A {Pseudomonas aeruginosa} PDB: 4eci_A* Back     alignment and structure
>1pmt_A PMGST, GST B1-1, glutathione transferase; glutathione-conjugating, A putative oxidoreduct; HET: GSH; 2.50A {Proteus mirabilis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pmt_A* Back     alignment and structure
>1aw9_A Glutathione S-transferase III; herbicide detoxification; 2.20A {Zea mays} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1tw9_A Glutathione S-transferase 2; 1.71A {Heligmosomoides polygyrus} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1dug_A Chimera of glutathione S-transferase-synthetic linker-C-terminal fibrinogen gamma...; gamma chain integrin fragment; HET: GSH; 1.80A {Schistosoma japonicum} SCOP: a.45.1.1 c.47.1.5 PDB: 1gne_A* 3qmz_T 1y6e_A 1m9a_A* 1gtb_A* 1gta_A* 1m99_A* 1m9b_A* 1ua5_A* 1u87_A* 1u88_A* 3crt_A* 3cru_A* 3d0z_A* Back     alignment and structure
>1nhy_A EF-1-gamma 1, elongation factor 1-gamma 1; protein synthesis, GST-like, translation; 3.00A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>4exj_A Uncharacterized protein; transferase-like protein, transcription regulation, transfer structural genomics; 1.64A {Lodderomyces elongisporus nrrl yb-4239} Back     alignment and structure
>2c4j_A Glutathione S-transferase MU 2; glutathione transferase, multigene family; HET: GSO; 1.35A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1xw5_A* 1ykc_A* 2ab6_A* 2gtu_A 3gtu_A 3gur_A* 1hna_A* 1hnb_A* 1hnc_A* 1xw6_A* 1xwk_A* 1yj6_A* 2f3m_A* 2dc5_A 1gtu_A 4gtu_A 6gsu_A* 6gsv_A* 6gsw_A* 2gst_A* ... Back     alignment and structure
>4ikh_A Glutathione S-transferase; enzyme function initiative, EFI, structural genomics; HET: GSH; 2.10A {Pseudomonas protegens} Back     alignment and structure
>2hnl_A Glutathione S-transferase 1; prostaglandin synthase, river BLI onchocerca volvulus, immune modulation; HET: GSH; 2.00A {Onchocerca volvulus} Back     alignment and structure
>2r4v_A XAP121, chloride intracellular channel protein 2; chloride intracellular channels, CLIC2, pore-forming protein ryanodine receptor, chloride channel; HET: GSH; 1.85A {Homo sapiens} PDB: 2r5g_A 2per_A* Back     alignment and structure
>2on5_A Nagst-2, Na glutathione S-transferase 2; hookworm; HET: GSH; 1.90A {Necator americanus} Back     alignment and structure
>2on7_A Nagst-1, Na glutathione S-transferase 1; hookworm; 2.40A {Necator americanus} Back     alignment and structure
>1zl9_A GST class-sigma, glutathione S-transferase 5; glutathione transferase, C.elegans; HET: GSH; 2.01A {Caenorhabditis elegans} Back     alignment and structure
>1k3y_A GSTA1-1, glutathione S-transferase A1; S-hexyl glutatione, water structu transferase; HET: GTX; 1.30A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsf_A* 1guh_A* 1gsd_A* 1k3o_A 1k3l_A* 1pl1_A* 1pkz_A 1pkw_A* 2r6k_A* 1gse_A* 3u6v_A 1usb_A* 1ydk_A* 3q74_A 3ktl_A* 1pl2_A* 2r3x_A* 1xwg_A 3l0h_A* 1ags_A* ... Back     alignment and structure
>4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Back     alignment and structure
>2ahe_A Chloride intracellular channel protein 4; glutathione-S-transferase superfamily, CLIC4, NCC27, chloride ION channel, metal transport; 1.80A {Homo sapiens} PDB: 2d2z_A Back     alignment and structure
>1okt_A Glutathione S-transferase; GST; 1.9A {Plasmodium falciparum} SCOP: a.45.1.1 c.47.1.5 PDB: 1pa3_A 1q4j_A* 3fr9_A* 3frc_A* 2aaw_A* 3fr6_A 3fr3_A* Back     alignment and structure
>1b8x_A Protein (AML-1B); nuclear matrix targeting signal protein, signal protein; 2.70A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2ycd_A Glutathione S-transferase; SOIL bacteria, herbicide detoxification; HET: GTB; 1.40A {Agrobacterium tumefaciens} PDB: 3lq7_A Back     alignment and structure
>3fy7_A Chloride intracellular channel protein 3; GST, glutathione, CLIC, chloride channel, ION transport, ionic channel, nucleus, transport, gated channel; 1.95A {Homo sapiens} PDB: 3kjy_A Back     alignment and structure
>1b48_A GST, mgsta4-4, protein (glutathione S-transferase); subunit cooperativity; HET: HAG GSH; 2.60A {Mus musculus} SCOP: a.45.1.1 c.47.1.5 PDB: 1guk_A Back     alignment and structure
>1vf1_A Glutathione S-transferase 3; detoxification; HET: GSH; 1.77A {Gallus gallus} PDB: 1vf2_A* 1vf3_A* 1vf4_A Back     alignment and structure
>4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Back     alignment and structure
>2c3n_A Glutathione S-transferase theta 1; glutathione transferase, polymorphism; 1.5A {Homo sapiens} PDB: 2c3q_A* 2c3t_A Back     alignment and structure
>2ws2_A NU-class GST, glutathione S-transferase; parasite, nematode; 2.01A {Haemonchus contortus} Back     alignment and structure
>1k0d_A URE2 protein; nitrate assimilation, structural genomics, gene regulation; HET: GSH; 2.20A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 PDB: 1jzr_A* 1k0b_A* 1k0c_A* 1k0a_A* 1g6w_A 1g6y_A 1hqo_A Back     alignment and structure
>3c8e_A YGHU, glutathione S-transferase homologue; glutathione transferase homologue, E. coli; HET: GSH; 1.50A {Escherichia coli} Back     alignment and structure
>3h1n_A Probable glutathione S-transferase; APC84167, bordetella bronchisepti structural genomics, PSI-2, protein structure initiative; 1.83A {Bordetella bronchiseptica RB50} Back     alignment and structure
>2yv7_A CG10997-PA, LD46306P, CLIC; dmclic, chloride ION channel, GST fold, metal transport; 1.70A {Drosophila melanogaster} Back     alignment and structure
>1bg5_A MAB, fusion protein of alpha-Na,K-ATPase with glutathione S-transferase; ankyrin binding, carrier crystallization, ION transport; 2.60A {Rattus norvegicus} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3ic8_A Uncharacterized GST-like proteinprotein; glutathione, transferase, PSI, MCSG, structural genomics; 2.40A {Pseudomonas syringae PV} Back     alignment and structure
>3ir4_A Glutaredoxin 2; glutathione, IDP00895, structural genomics, for structural genomics of infectious diseases, csgid, oxidoreductase; HET: MSE GSH; 1.20A {Salmonella enterica subsp} PDB: 1g7o_A Back     alignment and structure
>2yv9_A Chloride intracellular channel EXC-4; chloride ION channel, CLIC, GST fold, metal transport; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2fno_A AGR_PAT_752P; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics, JCSG; 2.00A {Agrobacterium tumefaciens} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3m1g_A Putative glutathione S-transferase; ECM4-like subfamily, GST_C family, structural genomics, PSI- protein structure initiative; 2.10A {Corynebacterium glutamicum} Back     alignment and structure
>3ppu_A Glutathione-S-transferase; GST fold; HET: GSH; 2.30A {Phanerochaete chrysosporium} Back     alignment and structure
>4f03_A Glutathione transferase; GST fold; 1.80A {Phanerochaete chrysosporium} PDB: 4g19_A* Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>1z9h_A Membrane-associated prostaglandin E synthase-2; membran associated protein, indomethacin, isomerase; HET: IMN; 2.60A {Macaca fascicularis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pbj_A* Back     alignment and structure
>4fqu_A Putative glutathione transferase; glutathionyl-hydroquinone reductases, oxidoredu; 3.00A {Sphingobium chlorophenolicum} Back     alignment and structure
>4g0i_A Protein YQJG; glutathionyl-hydroquinone reductase, oxidoreductase; HET: MES; 2.05A {Escherichia coli} PDB: 3r3e_A* 4g0k_A* 4g0l_A* Back     alignment and structure
>2uz8_A Eukaryotic translation elongation factor 1 epsilon-1; protein biosynthesis, aminoacyl-tRNA synthetase, GST, nuclear protein, RNA-binding protein; HET: MSE; 2.0A {Homo sapiens} Back     alignment and structure
>2hra_A Glutamyl-tRNA synthetase, cytoplasmic; GST-fold, ligase; 1.90A {Saccharomyces cerevisiae} PDB: 2hrk_A 2hsm_A Back     alignment and structure
>2hsn_A Methionyl-tRNA synthetase, cytoplasmic; protein complex protein interaction GST-fold, ligase/RNA binding protein complex; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2hqt_A GU4 nucleic-binding protein 1; GST-fold, biosynthetic protein, RNA binding; 1.90A {Saccharomyces cerevisiae} SCOP: a.45.1.2 PDB: 2hrk_B 2hsm_B 2hsn_B Back     alignment and structure
>1fov_A Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53, electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 3grx_A* Back     alignment and structure
>2lqo_A Putative glutaredoxin RV3198.1/MT3292; TRX fold, oxidoreductase; NMR {Mycobacterium tuberculosis} Back     alignment and structure
>3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A* Back     alignment and structure
>2klx_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Bartonella henselae} Back     alignment and structure
>2khp_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Brucella melitensis} Back     alignment and structure
>3qmx_A Glutaredoxin A, glutaredoxin 3; electron transport; 1.82A {Synechocystis SP} SCOP: c.47.1.0 Back     alignment and structure
>1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10 Back     alignment and structure
>3ic4_A Glutaredoxin (GRX-1); structural genomics, PSI, MCSG, protein structure initiative, midwest center for structural genomic oxidoreductase; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>1aba_A Glutaredoxin; electron transport; HET: MES; 1.45A {Enterobacteria phage T4} SCOP: c.47.1.1 PDB: 1aaz_A 1de1_A 1de2_A Back     alignment and structure
>1r7h_A NRDH-redoxin; thioredoxin, glutaredoxin, redox protein, domain swapping, electron transport; 2.69A {Corynebacterium ammoniagenes} SCOP: c.47.1.1 Back     alignment and structure
>1t1v_A SH3BGRL3, SH3 domain-binding glutamic acid-rich protein-LIK; glutaredoxin, thioredoxin fold, protein 3D-structure, X-RAY crystallography; 1.60A {Mus musculus} SCOP: c.47.1.14 PDB: 1j0f_A 1sj6_A Back     alignment and structure
>3nzn_A Glutaredoxin; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics, rossmann fold; 1.10A {Methanosarcina mazei} Back     alignment and structure
>3h8q_A Thioredoxin reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC, developmental protein, differentiation; 2.21A {Homo sapiens} SCOP: c.47.1.0 Back     alignment and structure
>3rhb_A ATGRXC5, glutaredoxin-C5, chloroplastic; thioredoxin fold, thiol-disulfide oxidoreductase, glutaredox oxidoreductase; HET: GSH; 1.20A {Arabidopsis thaliana} PDB: 3rhc_A* 3fz9_A* 3fza_A* Back     alignment and structure
>3zyw_A Glutaredoxin-3; metal binding protein; 1.84A {Homo sapiens} Back     alignment and structure
>1wik_A Thioredoxin-like protein 2; picot homology 2 domain, picot protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 Back     alignment and structure
>2cq9_A GLRX2 protein, glutaredoxin 2; glutathione-S-transferase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct6_A SH3 domain-binding glutamic acid-rich-like protein 2; SH3BGRL2,FASH3, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yan_A Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {Homo sapiens} Back     alignment and structure
>1kte_A Thioltransferase; redox-active center, electron transport, acetylation; 2.20A {Sus scrofa} SCOP: c.47.1.1 PDB: 1jhb_A 1b4q_A* Back     alignment and structure
>3ipz_A Monothiol glutaredoxin-S14, chloroplastic; electron transport, PL redox-active center, transit peptide, transport, oxidoreduc; 2.40A {Arabidopsis thaliana} PDB: 2lku_A Back     alignment and structure
>1ego_A Glutaredoxin; electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 1egr_A 1grx_A* 1qfn_A Back     alignment and structure
>2ht9_A Glutaredoxin-2; thioredoxin fold, iron-sulfur cluster, 2Fe2S, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: GSH; 1.90A {Homo sapiens} PDB: 2fls_A* Back     alignment and structure
>2wci_A Glutaredoxin-4; redox-active center, iron-sulfur cluster scaffolder, Fe2S2, homodimer, transport, glutathione, thioredoxin fold; HET: GSH; 1.90A {Escherichia coli} PDB: 1yka_A Back     alignment and structure
>3ctg_A Glutaredoxin-2; reduced form, electron transport, mitochondrion, redox-activ transit peptide, transport, oxidoreductase; 1.50A {Saccharomyces cerevisiae} PDB: 3ctf_A 3d4m_A 3d5j_A* Back     alignment and structure
>1h75_A Glutaredoxin-like protein NRDH; electron transport, thioredoxin, redox protein; 1.7A {Escherichia coli} SCOP: c.47.1.1 Back     alignment and structure
>3c1r_A Glutaredoxin-1; oxidized form, oxidoreductase, cytoplasm, electron transport, redox-active center, transport; HET: MES; 2.00A {Saccharomyces cerevisiae} PDB: 3c1s_A* 2jac_A* Back     alignment and structure
>2hze_A Glutaredoxin-1; thioredoxin fold, arsenic, dimethylarsenite., electron trans oxidoreductase; 1.80A {Ectromelia virus} PDB: 2hzf_A 2hze_B Back     alignment and structure
>3l4n_A Monothiol glutaredoxin-6; C-terminal domain of GRX6, oxidoreductase; HET: GSH; 1.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3gx8_A Monothiol glutaredoxin-5, mitochondrial; TRX fold, electron transport, mitochondrion, redox-active center, transit peptide, transport; 1.67A {Saccharomyces cerevisiae} Back     alignment and structure
>1u6t_A SH3 domain-binding glutamic acid-rich-like protein; SH3-binding, glutaredoxin, thioredoxin fold, crystallography, protein binding; HET: CIT; 1.90A {Homo sapiens} PDB: 1wry_A Back     alignment and structure
>2fgx_A Putative thioredoxin; NET3, NESG, GFT-glutaredoxin-like, structural genomics, PSI, protein structure initiative; NMR {Nitrosomonas europaea} Back     alignment and structure
>2kok_A Arsenate reductase; brucellosis, zoonotic, oxidoreductase, S genomics, seattle structural genomics center for infectious ssgcid; NMR {Brucella abortus} Back     alignment and structure
>1z3e_A Regulatory protein SPX; bacterial transcription regulation, disulfide stress; 1.50A {Bacillus subtilis} SCOP: c.47.1.12 PDB: 3gfk_A 3ihq_A Back     alignment and structure
>1ttz_A Conserved hypothetical protein; structural genomics, unknown function, PSI, protein structure initiative; 2.11A {Xanthomonas campestris} SCOP: c.47.1.1 PDB: 1xpv_A Back     alignment and structure
>2k8s_A Thioredoxin; dimer, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Nitrosomonas europaea} Back     alignment and structure
>2wul_A Glutaredoxin related protein 5; chromosome 14 open reading frame 87, oxidoreductase, thiored family, GLRX5, FLB4739; HET: GSH; 2.40A {Homo sapiens} Back     alignment and structure
>1wjk_A C330018D20RIK protein; glutaredoxin, thioredoxin fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 Back     alignment and structure
>2jad_A Yellow fluorescent protein glutaredoxin fusion protein; electron transport, redox- active center, yeast, GRX1P, transport; HET: PIA; 2.7A {Aequorea victoria} Back     alignment and structure
>2e7p_A Glutaredoxin; thioredoxin fold, poplar, electron transport; HET: GSH; 2.10A {Populus tremula x populus tremuloides} PDB: 1z7p_A 1z7r_A Back     alignment and structure
>3rdw_A Putative arsenate reductase; structural genomics, center for structural genomics of infec diseases, csgid, oxidoreductase; 2.20A {Yersinia pestis} Back     alignment and structure
>1rw1_A Conserved hypothetical protein YFFB; thioredoxin fold, structure 2 function project, S2F, structu genomics, unknown function; HET: MSE IPA; 1.02A {Pseudomonas aeruginosa} SCOP: c.47.1.12 Back     alignment and structure
>1s3c_A Arsenate reductase; ARSC, arsenite, oxidoreductase; 1.25A {Escherichia coli} PDB: 1sd9_A 1i9d_A 1j9b_A 1sd8_A 1jzw_A* 1sk1_A* 1sjz_A* 1sk0_A* 1sk2_A 1s3d_A Back     alignment and structure
>3fz4_A Putative arsenate reductase; APC61768, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.38A {Streptococcus mutans UA159} SCOP: c.47.1.0 Back     alignment and structure
>3l78_A Regulatory protein SPX; transcription, transcriptional factor, disulfide bond, redox-active center, transcription regulati; 1.90A {Streptococcus mutans} SCOP: c.47.1.12 Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>3gkx_A Putative ARSC family related protein; ARSC family protein, structural genomi 2, protein structure initiative; 2.20A {Bacteroides fragilis} SCOP: c.47.1.0 Back     alignment and structure
>3f0i_A Arsenate reductase; structural genomics, IDP01300, vibrio CH center for structural genomics of infectious diseases, CSGI oxidoreductase; HET: MSE; 1.88A {Vibrio cholerae} Back     alignment and structure
>2axo_A Hypothetical protein ATU2684; alpha beta protein., structural genomics, PSI, protein struc initiative; 1.80A {Agrobacterium tumefaciens str} SCOP: c.47.1.19 Back     alignment and structure
>1fo5_A Thioredoxin; disulfide oxidoreductase, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; NMR {Methanocaldococcus jannaschii} SCOP: c.47.1.1 Back     alignment and structure
>3kp8_A Vkorc1/thioredoxin domain protein; blood coagulation, disulfide formation, redox partner, oxidoreductase; 1.66A {Synechococcus SP} Back     alignment and structure
>1nho_A Probable thioredoxin; beta sheet, alpha helix, oxidoreductase; NMR {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.47.1.1 Back     alignment and structure
>3kp9_A Vkorc1/thioredoxin domain protein; warfarin, disulfide formation, blood coagulation, oxidoreduc blood coagulation,oxidoreductase; HET: U10; 3.60A {Synechococcus SP} Back     alignment and structure
>2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 222
d1oyja1145 a.45.1.1 (A:86-230) Class tau GST {Rice (Oryza sat 1e-32
d1gwca1138 a.45.1.1 (A:87-224) Class tau GST {Aegilops tausch 3e-27
d1oyja284 c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativ 3e-26
d1gwca283 c.47.1.5 (A:4-86) Class tau GST {Aegilops tauschii 6e-20
d1eema298 c.47.1.5 (A:5-102) Class omega GST {Human (Homo sa 2e-19
d1eema1139 a.45.1.1 (A:103-241) Class omega GST {Human (Homo 9e-19
d1e6ba280 c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress 8e-16
d1fw1a283 c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapi 1e-15
d1e6ba1133 a.45.1.1 (A:88-220) Class zeta GST {Mouse-ear cres 2e-15
d1axda280 c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), 3e-15
d1r5aa285 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anoph 3e-15
d1jlva284 c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anoph 6e-15
d1z9ha2113 c.47.1.5 (A:100-212) Microsomal prostaglandin E sy 1e-14
d1fw1a1125 a.45.1.1 (A:88-212) Class zeta GST {Human (Homo sa 3e-14
d1ljra279 c.47.1.5 (A:1-79) Class theta GST {Human (Homo sap 5e-14
d1aw9a281 c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), 8e-13
d1gnwa284 c.47.1.5 (A:2-85) Class phi GST {Mouse-ear cress ( 5e-12
d1k0ma286 c.47.1.5 (A:6-91) Chloride intracellular channel 1 1e-11
d1pmta280 c.47.1.5 (A:1-80) Class beta GST {Proteus mirabili 2e-11
d1n2aa280 c.47.1.5 (A:1-80) Class beta GST {Escherichia coli 4e-11
d1k0da292 c.47.1.5 (A:109-200) Yeast prion protein ure2p, ni 5e-11
d1pmta1121 a.45.1.1 (A:81-201) Class beta GST {Proteus mirabi 1e-10
d1g7oa275 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli 1e-10
d1f2ea280 c.47.1.5 (A:1-80) Class beta GST {Sphingomonas pau 1e-10
d1v2aa283 c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anoph 5e-10
d1n2aa1121 a.45.1.1 (A:81-201) Class beta GST {Escherichia co 5e-09
d2a2ra277 c.47.1.5 (A:1-77) Class pi GST {Human (Homo sapien 3e-08
d1f2ea1121 a.45.1.1 (A:81-201) Class beta GST {Sphingomonas p 7e-08
d1v2aa1125 a.45.1.1 (A:84-208) Class delta GST {Mosquito (Ano 3e-07
d2cvda1124 a.45.1.1 (A:76-199) Class sigma GST {Human (Homo s 4e-07
d1jlva1123 a.45.1.1 (A:85-207) Class delta GST {Mosquito (Ano 4e-07
d2cvda274 c.47.1.5 (A:2-75) Class sigma GST {Human (Homo sap 5e-07
d1b48a278 c.47.1.5 (A:2-79) Class alpha GST {Mouse (Mus musc 6e-07
d1tw9a277 c.47.1.5 (A:1-77) Class sigma GST {Heligmosomoides 1e-06
d2gsta1133 a.45.1.1 (A:85-217) Class mu GST {Rat (Rattus norv 2e-06
d1nhya1144 a.45.1.1 (A:76-219) GST-like domain of elongation 2e-06
d1k3ya279 c.47.1.5 (A:2-80) Class alpha GST {Human (Homo sap 4e-06
d1k0ma1149 a.45.1.1 (A:92-240) Chloride intracellular channel 4e-06
d2a2ra1132 a.45.1.1 (A:78-209) Class pi GST {Human (Homo sapi 6e-06
d1gula277 c.47.1.5 (A:4-80) Class alpha GST {Human (Homo sap 6e-06
d1tu7a277 c.47.1.5 (A:1-77) Class pi GST {Onchocerca volvulu 6e-06
d2gsqa1127 a.45.1.1 (A:76-202) Class sigma GST {Squid (Ommast 7e-06
d1gsua1133 a.45.1.1 (A:85-217) Class mu GST {Chicken (Gallus 1e-05
d1m0ua276 c.47.1.5 (A:47-122) Class sigma GST {Fruit fly (Dr 1e-05
d1tw9a1129 a.45.1.1 (A:78-206) Class sigma GST {Heligmosomoid 2e-05
d2c4ja1133 a.45.1.1 (A:86-218) Class mu GST {Human (Homo sapi 2e-05
d2c4ja284 c.47.1.5 (A:2-85) Class mu GST {Human (Homo sapien 2e-05
d1z9ha1161 a.45.1.1 (A:213-373) Microsomal prostaglandin E sy 2e-05
d1b48a1143 a.45.1.1 (A:80-222) Class alpha GST {Mouse (Mus mu 3e-05
d1r5aa1129 a.45.1.1 (A:87-215) Class delta GST {Mosquito (Ano 3e-05
d1k3ya1142 a.45.1.1 (A:81-222) Class alpha GST {Human (Homo s 4e-05
d1gula1140 a.45.1.1 (A:81-220) Class alpha GST {Human (Homo s 5e-05
d1m0ua1127 a.45.1.1 (A:123-249) Class sigma GST {Fruit fly (D 6e-05
d1okta285 c.47.1.5 (A:1-85) Pf GST {Malarial parasite (Plasm 8e-05
d1k0da1151 a.45.1.1 (A:201-351) Yeast prion protein ure2p, ni 9e-05
d1fhea280 c.47.1.5 (A:1-80) Class alpha GST {Fasciola hepati 1e-04
d2gsqa275 c.47.1.5 (A:1-75) Class sigma GST {Squid (Ommastre 1e-04
d1jlwa1127 a.45.1.1 (A:91-217) Class delta GST {Mosquito (Ano 2e-04
d1duga1140 a.45.1.1 (A:81-220) Class alpha GST {Schistosoma j 2e-04
d1tu7a1131 a.45.1.1 (A:78-208) Class pi GST {Onchocerca volvu 4e-04
d2fhea1136 a.45.1.1 (A:81-216) Class alpha GST {Fasciola hepa 4e-04
d1ljra1165 a.45.1.1 (A:80-244) Class theta GST {Human (Homo s 5e-04
d1nhya275 c.47.1.5 (A:1-75) GST-like domain of elongation fa 5e-04
d1okta1126 a.45.1.1 (A:86-211) Pf GST {Malarial parasite (Pla 0.002
d1axda1129 a.45.1.1 (A:81-210) Class phi GST {Maize (Zea mays 0.003
>d1oyja1 a.45.1.1 (A:86-230) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} Length = 145 Back     information, alignment and structure

class: All alpha proteins
fold: GST C-terminal domain-like
superfamily: GST C-terminal domain-like
family: Glutathione S-transferase (GST), C-terminal domain
domain: Class tau GST
species: Rice (Oryza sativa) [TaxId: 4530]
 Score =  113 bits (284), Expect = 1e-32
 Identities = 41/141 (29%), Positives = 59/141 (41%), Gaps = 6/141 (4%)

Query: 81  QNPLLPDDPYERANARFWAKFFDEKCVPEVMGAFASKGEEQEKAAK-ARENLKMLERALE 139
            N    D  Y RA ARFWA + D K        +  KGE Q  A +   E L+ LE  L 
Sbjct: 5   ANSGDADAAYARATARFWADYVDRKLYDCGSRLWRLKGEPQAAAGREMAEILRTLEAELG 64

Query: 140 GKPFFGG---DKIGFLDIAVGWIGIWGRIVEEIAGVSLIDAETMPLLTAWLNNFLEVPVI 196
            + FFGG    ++GF+D+A+     W    E   G S+ +    P L AW      +  +
Sbjct: 65  DREFFGGGGGGRLGFVDVALVPFTAWFYSYERCGGFSVEE--VAPRLAAWARRCGRIDSV 122

Query: 197 KACIPSWHELLEHNKGFHKIL 217
              +PS  ++ +      K  
Sbjct: 123 VKHLPSPEKVYDFVGVLKKKY 143


>d1gwca1 a.45.1.1 (A:87-224) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} Length = 138 Back     information, alignment and structure
>d1oyja2 c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} Length = 84 Back     information, alignment and structure
>d1gwca2 c.47.1.5 (A:4-86) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} Length = 83 Back     information, alignment and structure
>d1eema2 c.47.1.5 (A:5-102) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1eema1 a.45.1.1 (A:103-241) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} Length = 139 Back     information, alignment and structure
>d1e6ba2 c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure
>d1fw1a2 c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1e6ba1 a.45.1.1 (A:88-220) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 133 Back     information, alignment and structure
>d1axda2 c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} Length = 80 Back     information, alignment and structure
>d1r5aa2 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} Length = 85 Back     information, alignment and structure
>d1jlva2 c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} Length = 84 Back     information, alignment and structure
>d1z9ha2 c.47.1.5 (A:100-212) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} Length = 113 Back     information, alignment and structure
>d1fw1a1 a.45.1.1 (A:88-212) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1ljra2 c.47.1.5 (A:1-79) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1aw9a2 c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} Length = 81 Back     information, alignment and structure
>d1gnwa2 c.47.1.5 (A:2-85) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 84 Back     information, alignment and structure
>d1k0ma2 c.47.1.5 (A:6-91) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d1pmta2 c.47.1.5 (A:1-80) Class beta GST {Proteus mirabilis [TaxId: 584]} Length = 80 Back     information, alignment and structure
>d1n2aa2 c.47.1.5 (A:1-80) Class beta GST {Escherichia coli [TaxId: 562]} Length = 80 Back     information, alignment and structure
>d1k0da2 c.47.1.5 (A:109-200) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 92 Back     information, alignment and structure
>d1pmta1 a.45.1.1 (A:81-201) Class beta GST {Proteus mirabilis [TaxId: 584]} Length = 121 Back     information, alignment and structure
>d1g7oa2 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} Length = 75 Back     information, alignment and structure
>d1f2ea2 c.47.1.5 (A:1-80) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} Length = 80 Back     information, alignment and structure
>d1v2aa2 c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} Length = 83 Back     information, alignment and structure
>d1n2aa1 a.45.1.1 (A:81-201) Class beta GST {Escherichia coli [TaxId: 562]} Length = 121 Back     information, alignment and structure
>d2a2ra2 c.47.1.5 (A:1-77) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1f2ea1 a.45.1.1 (A:81-201) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} Length = 121 Back     information, alignment and structure
>d1v2aa1 a.45.1.1 (A:84-208) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} Length = 125 Back     information, alignment and structure
>d2cvda1 a.45.1.1 (A:76-199) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1jlva1 a.45.1.1 (A:85-207) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} Length = 123 Back     information, alignment and structure
>d2cvda2 c.47.1.5 (A:2-75) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d1b48a2 c.47.1.5 (A:2-79) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1tw9a2 c.47.1.5 (A:1-77) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} Length = 77 Back     information, alignment and structure
>d2gsta1 a.45.1.1 (A:85-217) Class mu GST {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 133 Back     information, alignment and structure
>d1nhya1 a.45.1.1 (A:76-219) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 144 Back     information, alignment and structure
>d1k3ya2 c.47.1.5 (A:2-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1k0ma1 a.45.1.1 (A:92-240) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} Length = 149 Back     information, alignment and structure
>d2a2ra1 a.45.1.1 (A:78-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} Length = 132 Back     information, alignment and structure
>d1gula2 c.47.1.5 (A:4-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1tu7a2 c.47.1.5 (A:1-77) Class pi GST {Onchocerca volvulus [TaxId: 6282]} Length = 77 Back     information, alignment and structure
>d2gsqa1 a.45.1.1 (A:76-202) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} Length = 127 Back     information, alignment and structure
>d1gsua1 a.45.1.1 (A:85-217) Class mu GST {Chicken (Gallus gallus) [TaxId: 9031]} Length = 133 Back     information, alignment and structure
>d1m0ua2 c.47.1.5 (A:47-122) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 76 Back     information, alignment and structure
>d1tw9a1 a.45.1.1 (A:78-206) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} Length = 129 Back     information, alignment and structure
>d2c4ja1 a.45.1.1 (A:86-218) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Length = 133 Back     information, alignment and structure
>d2c4ja2 c.47.1.5 (A:2-85) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1z9ha1 a.45.1.1 (A:213-373) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} Length = 161 Back     information, alignment and structure
>d1b48a1 a.45.1.1 (A:80-222) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} Length = 143 Back     information, alignment and structure
>d1r5aa1 a.45.1.1 (A:87-215) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} Length = 129 Back     information, alignment and structure
>d1k3ya1 a.45.1.1 (A:81-222) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Length = 142 Back     information, alignment and structure
>d1gula1 a.45.1.1 (A:81-220) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Length = 140 Back     information, alignment and structure
>d1m0ua1 a.45.1.1 (A:123-249) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 127 Back     information, alignment and structure
>d1okta2 c.47.1.5 (A:1-85) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 85 Back     information, alignment and structure
>d1k0da1 a.45.1.1 (A:201-351) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 151 Back     information, alignment and structure
>d1fhea2 c.47.1.5 (A:1-80) Class alpha GST {Fasciola hepatica [TaxId: 6192]} Length = 80 Back     information, alignment and structure
>d2gsqa2 c.47.1.5 (A:1-75) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} Length = 75 Back     information, alignment and structure
>d1jlwa1 a.45.1.1 (A:91-217) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-4 [TaxId: 123217]} Length = 127 Back     information, alignment and structure
>d1duga1 a.45.1.1 (A:81-220) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} Length = 140 Back     information, alignment and structure
>d1tu7a1 a.45.1.1 (A:78-208) Class pi GST {Onchocerca volvulus [TaxId: 6282]} Length = 131 Back     information, alignment and structure
>d2fhea1 a.45.1.1 (A:81-216) Class alpha GST {Fasciola hepatica [TaxId: 6192]} Length = 136 Back     information, alignment and structure
>d1ljra1 a.45.1.1 (A:80-244) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} Length = 165 Back     information, alignment and structure
>d1nhya2 c.47.1.5 (A:1-75) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 75 Back     information, alignment and structure
>d1okta1 a.45.1.1 (A:86-211) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 126 Back     information, alignment and structure
>d1axda1 a.45.1.1 (A:81-210) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} Length = 129 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query222
d1oyja284 Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} 99.9
d1eema298 Class omega GST {Human (Homo sapiens) [TaxId: 9606 99.9
d1aw9a281 Class phi GST {Maize (Zea mays), type III [TaxId: 99.89
d1e6ba280 Class zeta GST {Mouse-ear cress (Arabidopsis thali 99.89
d1v2aa283 Class delta GST {Mosquito (Anopheles dirus b), iso 99.89
d1gwca1138 Class tau GST {Aegilops tauschii, also known as Tr 99.89
d1jlva284 Class delta GST {Mosquito (Anopheles dirus b), iso 99.88
d1fw1a283 Class zeta GST {Human (Homo sapiens) [TaxId: 9606] 99.88
d1axda280 Class phi GST {Maize (Zea mays), type I [TaxId: 45 99.88
d1r5aa285 Class delta GST {Mosquito (Anopheles dirus b), iso 99.88
d1gnwa284 Class phi GST {Mouse-ear cress (Arabidopsis thalia 99.87
d1ljra279 Class theta GST {Human (Homo sapiens) [TaxId: 9606 99.86
d1gwca283 Class tau GST {Aegilops tauschii, also known as Tr 99.86
d1k0da292 Yeast prion protein ure2p, nitrogen regulation fra 99.85
d1oyja1145 Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} 99.85
d1k0ma286 Chloride intracellular channel 1 (clic1) {Human (H 99.85
d1eema1139 Class omega GST {Human (Homo sapiens) [TaxId: 9606 99.84
d1g7oa275 Glutaredoxin 2 {Escherichia coli [TaxId: 562]} 99.83
d2gsqa275 Class sigma GST {Squid (Ommastrephes sloani pacifi 99.83
d2cvda274 Class sigma GST {Human (Homo sapiens) [TaxId: 9606 99.83
d2a2ra277 Class pi GST {Human (Homo sapiens) [TaxId: 9606]} 99.82
d1pmta280 Class beta GST {Proteus mirabilis [TaxId: 584]} 99.81
d1gula277 Class alpha GST {Human (Homo sapiens), (a1-1) [Tax 99.81
d1f2ea280 Class beta GST {Sphingomonas paucimobilis [TaxId: 99.81
d1tu7a277 Class pi GST {Onchocerca volvulus [TaxId: 6282]} 99.81
d3gtub1140 Class mu GST {Human (Homo sapiens) [TaxId: 9606]} 99.8
d1b48a278 Class alpha GST {Mouse (Mus musculus), (a1-4) [Tax 99.8
d1n2aa280 Class beta GST {Escherichia coli [TaxId: 562]} 99.8
d2c4ja284 Class mu GST {Human (Homo sapiens) [TaxId: 9606]} 99.8
d1okta285 Pf GST {Malarial parasite (Plasmodium falciparum) 99.8
d1k3ya279 Class alpha GST {Human (Homo sapiens), (a1-1) [Tax 99.79
d1axda1129 Class phi GST {Maize (Zea mays), type I [TaxId: 45 99.79
d2gsta1133 Class mu GST {Rat (Rattus norvegicus) [TaxId: 1011 99.79
d1n2aa1121 Class beta GST {Escherichia coli [TaxId: 562]} 99.79
d1gsua1133 Class mu GST {Chicken (Gallus gallus) [TaxId: 9031 99.78
d2c4ja1133 Class mu GST {Human (Homo sapiens) [TaxId: 9606]} 99.78
d1ljra1165 Class theta GST {Human (Homo sapiens) [TaxId: 9606 99.78
d1m0ua276 Class sigma GST {Fruit fly (Drosophila melanogaste 99.78
d1fw1a1125 Class zeta GST {Human (Homo sapiens) [TaxId: 9606] 99.78
d1f2ea1121 Class beta GST {Sphingomonas paucimobilis [TaxId: 99.78
d1tw9a277 Class sigma GST {Heligmosomoides polygyrus [TaxId: 99.78
d1duga1140 Class alpha GST {Schistosoma japonicum [TaxId: 618 99.77
d1pmta1121 Class beta GST {Proteus mirabilis [TaxId: 584]} 99.77
d2cvda1124 Class sigma GST {Human (Homo sapiens) [TaxId: 9606 99.77
d1jlwa1127 Class delta GST {Mosquito (Anopheles dirus b), iso 99.76
d1nhya1144 GST-like domain of elongation factor 1-gamma {Bake 99.76
d2fhea1136 Class alpha GST {Fasciola hepatica [TaxId: 6192]} 99.76
d1k3ya1142 Class alpha GST {Human (Homo sapiens), (a1-1) [Tax 99.76
d2a2ra1132 Class pi GST {Human (Homo sapiens) [TaxId: 9606]} 99.75
d1aw9a1135 Class phi GST {Maize (Zea mays), type III [TaxId: 99.75
d1r5aa1129 Class delta GST {Mosquito (Anopheles dirus b), iso 99.75
d1v2aa1125 Class delta GST {Mosquito (Anopheles dirus b), iso 99.75
d1m0ua1127 Class sigma GST {Fruit fly (Drosophila melanogaste 99.75
d1e6ba1133 Class zeta GST {Mouse-ear cress (Arabidopsis thali 99.74
d1jlva1123 Class delta GST {Mosquito (Anopheles dirus b), iso 99.74
d1b48a1143 Class alpha GST {Mouse (Mus musculus), (a1-4) [Tax 99.74
d2gsqa1127 Class sigma GST {Squid (Ommastrephes sloani pacifi 99.74
d1gnwa1126 Class phi GST {Mouse-ear cress (Arabidopsis thalia 99.73
d1duga280 Class alpha GST {Schistosoma japonicum [TaxId: 618 99.73
d1gula1140 Class alpha GST {Human (Homo sapiens), (a1-1) [Tax 99.73
d2fnoa287 Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobac 99.73
d1fhea280 Class alpha GST {Fasciola hepatica [TaxId: 6192]} 99.72
d1k0da1151 Yeast prion protein ure2p, nitrogen regulation fra 99.72
d1z9ha2113 Microsomal prostaglandin E synthase-2 {Crab-eating 99.72
d1tw9a1129 Class sigma GST {Heligmosomoides polygyrus [TaxId: 99.68
d1tu7a1131 Class pi GST {Onchocerca volvulus [TaxId: 6282]} 99.67
d1okta1126 Pf GST {Malarial parasite (Plasmodium falciparum) 99.66
d1nhya275 GST-like domain of elongation factor 1-gamma {Bake 99.64
d1oe8a281 Class alpha GST {Blood fluke (Schistosoma haematob 99.63
d1oe8a1123 Class alpha GST {Blood fluke (Schistosoma haematob 99.61
d1k0ma1149 Chloride intracellular channel 1 (clic1) {Human (H 99.56
d2hrkb1118 GU4 nucleic-binding protein 1, Arc1p {Baker's yeas 99.42
d1nm3a174 C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus 99.09
d1z9ha1161 Microsomal prostaglandin E synthase-2 {Crab-eating 98.88
d1r7ha_74 Glutaredoxin-like NRDH-redoxin {Corynebacterium am 98.78
d1fova_82 Glutaredoxin (Grx, thioltransferase) {Escherichia 98.78
d1h75a_76 Glutaredoxin-like NRDH-redoxin {Escherichia coli [ 98.71
d1wika_109 Thioredoxin-like protein 2 {Mouse (Mus musculus) [ 98.0
d1abaa_87 Glutaredoxin (Grx, thioltransferase) {Bacteriophag 98.0
d1egoa_85 Glutaredoxin (Grx, thioltransferase) {Escherichia 97.97
d1t1va_93 SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} 97.92
d1ktea_105 Glutaredoxin (Grx, thioltransferase) {Pig (Sus scr 97.82
d1wjka_100 Thioredoxin-like structure containing protein C330 97.72
d2fnoa1149 Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobac 97.53
d1ttza_75 Hypothetical protein XCC2852 {Xanthomonas campestr 97.4
d1g7oa1140 Glutaredoxin 2 {Escherichia coli [TaxId: 562]} 96.45
d1z3ea1114 Regulatory protein Spx {Bacillus subtilis [TaxId: 95.5
d1rw1a_114 Hypothetical protein PA3664 (YffB) {Pseudomonas ae 95.1
d1hyua496 Alkyl hydroperoxide reductase subunit F (AhpF), N- 93.69
d1j9ba_138 Arsenate reductase ArsC {Escherichia coli [TaxId: 93.28
d1iloa_77 MTH985, a thioredoxin {Archaeon Methanobacterium t 92.1
d1fo5a_85 MJ0307, thioredoxin/glutaredoxin-like protein {Arc 88.64
d1nhoa_85 MTH807, thioredoxin/glutaredoxin-like protein {Arc 87.34
>d1oyja2 c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Thioredoxin fold
superfamily: Thioredoxin-like
family: Glutathione S-transferase (GST), N-terminal domain
domain: Class tau GST
species: Rice (Oryza sativa) [TaxId: 4530]
Probab=99.90  E-value=5.5e-24  Score=137.09  Aligned_cols=80  Identities=51%  Similarity=0.938  Sum_probs=75.4

Q ss_pred             CcceEEeeccCCchHHHHHHHHHHhCCCceEEeCCCCCCchhhhhhCCCCCcccEEEeCCeecchHHHHHHHHHhhCCCC
Q 027498            3 EESVKLLGYWASPFALRVKWALKLKGVHYEYVEENLPNKSPLLLRYNPVYKKIPVLVHNGKPLAESLLIIEYIDEAWKQN   82 (222)
Q Consensus         3 ~~~~~L~~~~~s~~~~~vr~~L~~~gi~~~~~~~~~~~~~~~~~~~~p~~~~vP~l~~~~~~i~es~~I~~yL~~~~~~~   82 (222)
                      +.+++||++..||||+|||++|.++||+|+.+.++...+.+++.+.||.+|+||+|++||..+.||.+|++||++.||++
T Consensus         3 ~~~l~Ly~~~~Sp~~~rvr~~L~~kgi~~e~~~v~~~~~~~~~~~~nP~~g~vP~L~~~g~~l~eS~~I~~YL~e~~P~~   82 (84)
T d1oyja2           3 EKELVLLDFWVSPFGQRCRIAMAEKGLEFEYREEDLGNKSDLLLRSNPVHRKIPVLLHAGRPVSESLVILQYLDDAFPGT   82 (84)
T ss_dssp             SCCEEEEECTTCHHHHHHHHHHHHHTCCCEEEECCTTSCCHHHHHHSTTTCCSCEEEETTEEEESHHHHHHHHHHHCTTS
T ss_pred             CCceEEEcCCCChHHHHHHHHHHHcCCCcEEEEEccCcCCHHHHhhCCCcCcccEEEECCceEEcHHHHHHHHHHHCCCC
Confidence            35799999999999999999999999999999999998899999999964899999999999999999999999999865



>d1eema2 c.47.1.5 (A:5-102) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1aw9a2 c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} Back     information, alignment and structure
>d1e6ba2 c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1v2aa2 c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} Back     information, alignment and structure
>d1gwca1 a.45.1.1 (A:87-224) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} Back     information, alignment and structure
>d1jlva2 c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} Back     information, alignment and structure
>d1fw1a2 c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1axda2 c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} Back     information, alignment and structure
>d1r5aa2 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} Back     information, alignment and structure
>d1gnwa2 c.47.1.5 (A:2-85) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ljra2 c.47.1.5 (A:1-79) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gwca2 c.47.1.5 (A:4-86) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} Back     information, alignment and structure
>d1k0da2 c.47.1.5 (A:109-200) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oyja1 a.45.1.1 (A:86-230) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1k0ma2 c.47.1.5 (A:6-91) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eema1 a.45.1.1 (A:103-241) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g7oa2 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gsqa2 c.47.1.5 (A:1-75) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} Back     information, alignment and structure
>d2cvda2 c.47.1.5 (A:2-75) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a2ra2 c.47.1.5 (A:1-77) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmta2 c.47.1.5 (A:1-80) Class beta GST {Proteus mirabilis [TaxId: 584]} Back     information, alignment and structure
>d1gula2 c.47.1.5 (A:4-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Back     information, alignment and structure
>d1f2ea2 c.47.1.5 (A:1-80) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} Back     information, alignment and structure
>d1tu7a2 c.47.1.5 (A:1-77) Class pi GST {Onchocerca volvulus [TaxId: 6282]} Back     information, alignment and structure
>d3gtub1 a.45.1.1 (B:85-224) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b48a2 c.47.1.5 (A:2-79) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} Back     information, alignment and structure
>d1n2aa2 c.47.1.5 (A:1-80) Class beta GST {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c4ja2 c.47.1.5 (A:2-85) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1okta2 c.47.1.5 (A:1-85) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1k3ya2 c.47.1.5 (A:2-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Back     information, alignment and structure
>d1axda1 a.45.1.1 (A:81-210) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} Back     information, alignment and structure
>d2gsta1 a.45.1.1 (A:85-217) Class mu GST {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1n2aa1 a.45.1.1 (A:81-201) Class beta GST {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gsua1 a.45.1.1 (A:85-217) Class mu GST {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2c4ja1 a.45.1.1 (A:86-218) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ljra1 a.45.1.1 (A:80-244) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m0ua2 c.47.1.5 (A:47-122) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1fw1a1 a.45.1.1 (A:88-212) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f2ea1 a.45.1.1 (A:81-201) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} Back     information, alignment and structure
>d1tw9a2 c.47.1.5 (A:1-77) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} Back     information, alignment and structure
>d1duga1 a.45.1.1 (A:81-220) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} Back     information, alignment and structure
>d1pmta1 a.45.1.1 (A:81-201) Class beta GST {Proteus mirabilis [TaxId: 584]} Back     information, alignment and structure
>d2cvda1 a.45.1.1 (A:76-199) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jlwa1 a.45.1.1 (A:91-217) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-4 [TaxId: 123217]} Back     information, alignment and structure
>d1nhya1 a.45.1.1 (A:76-219) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fhea1 a.45.1.1 (A:81-216) Class alpha GST {Fasciola hepatica [TaxId: 6192]} Back     information, alignment and structure
>d1k3ya1 a.45.1.1 (A:81-222) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Back     information, alignment and structure
>d2a2ra1 a.45.1.1 (A:78-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1aw9a1 a.45.1.1 (A:83-217) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} Back     information, alignment and structure
>d1r5aa1 a.45.1.1 (A:87-215) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} Back     information, alignment and structure
>d1v2aa1 a.45.1.1 (A:84-208) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} Back     information, alignment and structure
>d1m0ua1 a.45.1.1 (A:123-249) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1e6ba1 a.45.1.1 (A:88-220) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jlva1 a.45.1.1 (A:85-207) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} Back     information, alignment and structure
>d1b48a1 a.45.1.1 (A:80-222) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} Back     information, alignment and structure
>d2gsqa1 a.45.1.1 (A:76-202) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} Back     information, alignment and structure
>d1gnwa1 a.45.1.1 (A:86-211) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1duga2 c.47.1.5 (A:1-80) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} Back     information, alignment and structure
>d1gula1 a.45.1.1 (A:81-220) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Back     information, alignment and structure
>d2fnoa2 c.47.1.5 (A:1-87) Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1fhea2 c.47.1.5 (A:1-80) Class alpha GST {Fasciola hepatica [TaxId: 6192]} Back     information, alignment and structure
>d1k0da1 a.45.1.1 (A:201-351) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z9ha2 c.47.1.5 (A:100-212) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} Back     information, alignment and structure
>d1tw9a1 a.45.1.1 (A:78-206) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} Back     information, alignment and structure
>d1tu7a1 a.45.1.1 (A:78-208) Class pi GST {Onchocerca volvulus [TaxId: 6282]} Back     information, alignment and structure
>d1okta1 a.45.1.1 (A:86-211) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1nhya2 c.47.1.5 (A:1-75) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oe8a2 c.47.1.5 (A:4-84) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} Back     information, alignment and structure
>d1oe8a1 a.45.1.1 (A:85-207) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} Back     information, alignment and structure
>d1k0ma1 a.45.1.1 (A:92-240) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hrkb1 a.45.1.2 (B:4-121) GU4 nucleic-binding protein 1, Arc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nm3a1 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1z9ha1 a.45.1.1 (A:213-373) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} Back     information, alignment and structure
>d1r7ha_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Corynebacterium ammoniagenes [TaxId: 1697]} Back     information, alignment and structure
>d1fova_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli, Grx3 [TaxId: 562]} Back     information, alignment and structure
>d1h75a_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wika_ c.47.1.1 (A:) Thioredoxin-like protein 2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1abaa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1egoa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t1va_ c.47.1.14 (A:) SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ktea_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1wjka_ c.47.1.1 (A:) Thioredoxin-like structure containing protein C330018D20Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fnoa1 a.45.1.1 (A:88-236) Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1ttza_ c.47.1.1 (A:) Hypothetical protein XCC2852 {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d1g7oa1 a.45.1.1 (A:76-215) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z3ea1 c.47.1.12 (A:1-114) Regulatory protein Spx {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1rw1a_ c.47.1.12 (A:) Hypothetical protein PA3664 (YffB) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1hyua4 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1j9ba_ c.47.1.12 (A:) Arsenate reductase ArsC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iloa_ c.47.1.1 (A:) MTH985, a thioredoxin {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1fo5a_ c.47.1.1 (A:) MJ0307, thioredoxin/glutaredoxin-like protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1nhoa_ c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-like protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure