Citrus Sinensis ID: 027502


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220--
MNRYSVIVLSVLVCGFIELGLCREGNFIQMRPGGVYDYGGNQNSAEIEGLARFAVQEHNKKENALLQFARVLKAKEQVVAGKLYYLTLEVIDAGKNKIYEAKIWVKPWINFKQLQEFKHAEHGPFSALSDLNLKRGCHGQEWLAVSTNDLEVKNAANHAVKSMQRKSNSLFLYELLEILQAKAKVIEDYAKFELHLKLRRGSEEEKHWVEIIKNSEGKFYLK
ccccHHHHHHHHHHHHHHHHHcccccccccccccEECcccccccHHHHHHHHHHHHHHHHcccccEEEEEEEEEEEEEEccEEEEEEEEEEcccccEEEEEEEEEECcccccEEEEECcccccccccccccccccccccccEEEEccccHHHHHHHHHHHHHHHHHccccccEEEEEEEEEEEEEEEcEEEEEEEEEEcccccEEEEEEEEEEccccEEEEc
**RYSVIVLSVLVCGFIELGLCREGNFIQMRPGGVYDYGGNQNSAEIEGLARFAVQEHNKKENALLQFARVLKAKEQVVAGKLYYLTLEVIDAGKNKIYEAKIWVKPWINFKQLQEFKHAEH******SDLNL*****GQEWLAVSTNDLEVKNAANHAV******SNSLFLYELLEILQAKAKVIEDYAKFELHLKLRRGSEEEKHWVEIIKNS***F***
xxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNRYSVIVLSVLVCGFIELGLCREGNFIQMRPGGVYDYGGNQNSAEIEGLARFAVQEHNKKENALLQFARVLKAKEQVVAGKLYYLTLEVIDAGKNKIYEAKIWVKPWINFKQLQEFKHAEHGPFSALSDLNLKRGCHGQEWLAVSTNDLEVKNAANHAVKSMQRKSNSLFLYELLEILQAKAKVIEDYAKFELHLKLRRGSEEEKHWVEIIKNSEGKFYLK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cysteine proteinase inhibitor 6 Specific inhibitor of cysteine proteinases. Probably involved in the regulation of endogenous processes and in defense against pests and pathogens.probableQ8H0X6
Cysteine proteinase inhibitor 12 Specific inhibitor of cysteine proteinases. Probably involved in the regulation of endogenous processes and in defense against pests and pathogens.probableQ0JNR2

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1EQK, chain A
Confidence level:very confident
Coverage over the Query: 29-124
View the alignment between query and template
View the model in PyMOL
Template: 2CH9, chain A
Confidence level:very confident
Coverage over the Query: 136-216
View the alignment between query and template
View the model in PyMOL