Citrus Sinensis ID: 027521


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220--
MGTPETSREPCPDRILDDVGGAFGMGAVGGAAFHFLKGTYNSPSGARLSGGTQAVRMNAPRVGGSFAVWGGLFSTFDCTMVYLRQKEDPWNSIIAGAATGGFLSMRQGLGSASRSALFGGVLLALIEGAGIMLNKVLSAPQNMPMMEEPAPNMAGVPGYPMGQMPGQVPVPVESSSPSSSSSSSWFGGFFGGKKEDQATSGGSKTEVLESFDAPPVPSFEYK
cccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccccc
******S***CPDRILDDVGGAFGMGAVGGAAFHFLKGTYNSPSGARLSGGTQAVRMNAPRVGGSFAVWGGLFSTFDCTMVYLRQKEDPWNSIIAGAATGGFLSMRQGLGSASRSALFGGVLLALIEGAGIMLNKVL*****************************************************************************PVP*****
xxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGTPETSREPCPDRILDDVGGAFGMGAVGGAAFHFLKGTYNSPSGARLSGGTQAVRMNAPRVGGSFAVWGGLFSTFDCTMVYLRQKEDPWNSIIAGAATGGFLSMRQGLGSASRSALFGGVLLALIEGAGIMLNKVLSAPQNMPMMEEPAPNMAGVPGYPMGQMPGQVPVPVESSSPSSSSSSSWFGGFFGGKKEDQATSGGSKTEVLESFDAPPVPSFEYK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Mitochondrial import inner membrane translocase subunit TIM17-2 Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.confidentQ9SP35
Mitochondrial import inner membrane translocase subunit Tim17-B Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.probableO60830
Mitochondrial import inner membrane translocase subunit TIM17 Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.probableP39515

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted