Citrus Sinensis ID: 027528


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220--
MEKLRHGQAVDIPNYDFKSYKNNVFPARRVNPSDVILLEGILVFHDSRVRELMNMKIFVDTDADVRLARRIRRDTVEKGRDIATVLDQYSKFVKPAFDDFILPTKKYADIIIPRGGDNHVAIDLIVQHIRTKLGQHDLCKIYPNLYVIHSTFQIRGMHTLIRDSQTTKHDFVFYSDRLIRLVVEHGLGHLPFTEKQVITPTGAVYTGVDFCKRLCGVSVIRR
ccHHHccccEEcccccccccccccccCEEEccccEEEEEcccccccHHHHHHcccEEEEEcccHHHHHHHHHHHHHHccccHHHHHHHHcccccccccccccccccCEEEEcccccccHHHHHHHHHHHHHHHcccccccccccEEEcccccccccEEEEEcccccccccEEEEccHHHHHHHHHHccccccEEEEEEcccccEEEcccccccEEEEEEECc
MEKL*HGQAVDIPNYDFKSYKNNVFPARRVNPSDVILLEGILVFHDSRVRELMNMKIFVDTDADVRLARRIRRDTVEKGRDIATVLDQYSKFVKPAFDDFILPTKKYADIIIPRGGDNHVAIDLIVQHIRTKLGQHDLCKIYPNLYVIHSTFQIRGMHTLIRDSQTTKHDFVFYSDRLIRLVVEHGLGHLPFTEKQVITPTGAVYTGVDFCKRLCGVSVIRR
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEKLRHGQAVDIPNYDFKSYKNNVFPARRVNPSDVILLEGILVFHDSRVRELMNMKIFVDTDADVRLARRIRRDTVEKGRDIATVLDQYSKFVKPAFDDFILPTKKYADIIIPRGGDNHVAIDLIVQHIRTKLGQHDLCKIYPNLYVIHSTFQIRGMHTLIRDSQTTKHDFVFYSDRLIRLVVEHGLGHLPFTEKQVITPTGAVYTGVDFCKRLCGVSVIRR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Uridine kinase-like protein 3 Involved in the pyrimidine salvage pathway. The uracil phosphoribosyltransferase (UPRT) activity, that catalyzes the conversion of uracil and 5-phospho-alpha-D-ribose 1-diphosphate (PRPP) to UMP and diphosphate, is unsure.probableQ8VYB2
Uridine kinase probableB7GIU0
Uridine kinase probableC5D4Y5

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2JEO, chain A
Confidence level:very confident
Coverage over the Query: 4-135
View the alignment between query and template
View the model in PyMOL
Template: 1BD3, chain D
Confidence level:very confident
Coverage over the Query: 138-222
View the alignment between query and template
View the model in PyMOL