Citrus Sinensis ID: 027528

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220--
MEKLRHGQAVDIPNYDFKSYKNNVFPARRVNPSDVILLEGILVFHDSRVRELMNMKIFVDTDADVRLARRIRRDTVEKGRDIATVLDQYSKFVKPAFDDFILPTKKYADIIIPRGGDNHVAIDLIVQHIRTKLGQHDLCKIYPNLYVIHSTFQIRGMHTLIRDSQTTKHDFVFYSDRLIRLVVEHGLGHLPFTEKQVITPTGAVYTGVDFCKRLCGVSVIRR
cHHHHccccEEcccccccccccccccEEEEccccEEEEEcccccccHHHHHHcccEEEEEcccHHHHHHHHHHHHHHccccHHHHHHHHcccccccccccccccccEEEEEcccccccHHHHHHHHHHHHHHHcccccccccccEEEcccccccccEEEEEcccccccccEEEEccHHHHHHHHHHccccccEEEEEEcccccEEEcccccccEEEEEEEEc
ccHHHcccEEEEEEEEcccccccccccEEEccccEEEEEEEEEEccHHHHHHcccEEEEcccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccHcHHHHHcHcHccccEEEEcccccHHHHHHHHHHHHHHHHHcHHHHHcccEEEccEcHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHccEEEEEEEcccccEEEEEEEcccEEEEEEccc
meklrhgqavdipnydfksyknnvfparrvnpsdviLLEGILVFHDSRVRELMNMKIFVDTDADVRLARRIRRDTVEKGRDIATVLDQYSKfvkpafddfilptkkyadiiiprggdnHVAIDLIVQHIRTklgqhdlckiypnlyviHSTFQIRGMHTLirdsqttkhdfVFYSDRLIRLVVEHglghlpftekqvitptgavytgvdfckrlcgvsvirr
meklrhgqavdipnydfksykNNVFPARRVNPSDVILLEGILVFHDSRVRELMNmkifvdtdadvrlarrirrdtvekgrdiatvldqyskfvkpafddfilPTKKYADIIIPRGGDNHVAIDLIVQHIRTKLGQHDLCKIYPNLYVIHSTFQIRGMHTLIRDSQTTKHDFVFYSDRLIRLVVEHGLghlpftekqvitptgavytgvdfckrlcgvsvirr
MEKLRHGQAVDIPNYDFKSYKNNVFPARRVNPSDVILLEGILVFHDSRVRELMNMKIFVDTDADVRLARRIRRDTVEKGRDIATVLDQYSKFVKPAFDDFILPTKKYADIIIPRGGDNHVAIDLIVQHIRTKLGQHDLCKIYPNLYVIHSTFQIRGMHTLIRDSQTTKHDFVFYSDRLIRLVVEHGLGHLPFTEKQVITPTGAVYTGVDFCKRLCGVSVIRR
*********VDIPNYDFKSYKNNVFPARRVNPSDVILLEGILVFHDSRVRELMNMKIFVDTDADVRLARRIRRDTVEKGRDIATVLDQYSKFVKPAFDDFILPTKKYADIIIPRGGDNHVAIDLIVQHIRTKLGQHDLCKIYPNLYVIHSTFQIRGMHTLIRDSQTTKHDFVFYSDRLIRLVVEHGLGHLPFTEKQVITPTGAVYTGVDFCKRLCGVSVI**
MEKL*HGQAVDIPNYDFKSYKNNVFPARRVNPSDVILLEGILVFHDSRVRELMNMKIFVDTDADVRLARRIRRDTVEKGRDIATVLDQYSKFVKPAFDDFILPTKKYADIIIPRGGDNHVAIDLIVQHIRTKLGQHDLCKIYPNLYVIHSTFQIRG**TLI*DSQTTKHDFVFYSDRLIRLVVEHGLGHLPFTEKQVITPTGAVYTGVDFCKRLCGVSVIRR
MEKLRHGQAVDIPNYDFKSYKNNVFPARRVNPSDVILLEGILVFHDSRVRELMNMKIFVDTDADVRLARRIRRDTVEKGRDIATVLDQYSKFVKPAFDDFILPTKKYADIIIPRGGDNHVAIDLIVQHIRTKLGQHDLCKIYPNLYVIHSTFQIRGMHTLIRDSQTTKHDFVFYSDRLIRLVVEHGLGHLPFTEKQVITPTGAVYTGVDFCKRLCGVSVIRR
MEKLRHGQAVDIPNYDFKSYKNNVFPARRVNPSDVILLEGILVFHDSRVRELMNMKIFVDTDADVRLARRIRRDTVEKGRDIATVLDQYSKFVKPAFDDFILPTKKYADIIIPRGGDNHVAIDLIVQHIRTKLGQHDLCKIYPNLYVIHSTFQIRGMHTLIRDSQTTKHDFVFYSDRLIRLVVEHGLGHLPFTEKQVITPTGAVYTGVDFCKRLCGVSVIRR
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEKLRHGQAVDIPNYDFKSYKNNVFPARRVNPSDVILLEGILVFHDSRVRELMNMKIFVDTDADVRLARRIRRDTVEKGRDIATVLDQYSKFVKPAFDDFILPTKKYADIIIPRGGDNHVAIDLIVQHIRTKLGQHDLCKIYPNLYVIHSTFQIRGMHTLIRDSQTTKHDFVFYSDRLIRLVVEHGLGHLPFTEKQVITPTGAVYTGVDFCKRLCGVSVIRR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query222 2.2.26 [Sep-21-2011]
Q8VYB2 466 Uridine kinase-like prote yes no 0.995 0.474 0.923 1e-120
O65583 469 Uridine kinase-like prote no no 0.986 0.466 0.909 1e-114
Q9FKS0 486 Uridine kinase-like prote no no 0.990 0.452 0.804 1e-103
Q9LK34 483 Uridine kinase-like prote no no 0.981 0.451 0.802 1e-102
Q9LTY6 465 Uridine kinase-like prote no no 0.990 0.473 0.773 7e-99
Q55EL3 499 Uridine-cytidine kinase A yes no 0.990 0.440 0.489 9e-57
Q91YL3 548 Uridine-cytidine kinase-l yes no 0.990 0.401 0.474 1e-56
Q9NWZ5 548 Uridine-cytidine kinase-l yes no 0.990 0.401 0.470 4e-56
Q8T154243 Uridine-cytidine kinase B no no 0.612 0.559 0.562 5e-37
Q9BZX2261 Uridine-cytidine kinase 2 no no 0.581 0.494 0.569 9e-37
>sp|Q8VYB2|UKL3_ARATH Uridine kinase-like protein 3 OS=Arabidopsis thaliana GN=UKL3 PE=1 SV=1 Back     alignment and function desciption
 Score =  429 bits (1104), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 204/221 (92%), Positives = 215/221 (97%)

Query: 1   MEKLRHGQAVDIPNYDFKSYKNNVFPARRVNPSDVILLEGILVFHDSRVRELMNMKIFVD 60
           MEKLR GQAVDIPNYDFKSYKNNVFP RRVNPSDVI+LEGIL+FHD RVR+LMNMKIFVD
Sbjct: 113 MEKLRKGQAVDIPNYDFKSYKNNVFPPRRVNPSDVIILEGILIFHDPRVRDLMNMKIFVD 172

Query: 61  TDADVRLARRIRRDTVEKGRDIATVLDQYSKFVKPAFDDFILPTKKYADIIIPRGGDNHV 120
            DADVRLARRI+RDTVEKGRDIATVLDQYSKFVKPAF+DFILPTKKYADIIIPRGGDNHV
Sbjct: 173 ADADVRLARRIKRDTVEKGRDIATVLDQYSKFVKPAFEDFILPTKKYADIIIPRGGDNHV 232

Query: 121 AIDLIVQHIRTKLGQHDLCKIYPNLYVIHSTFQIRGMHTLIRDSQTTKHDFVFYSDRLIR 180
           AIDLIVQHI TKLGQHDLCKIYPNLYVI STFQIRGMHTLIRDS+TTKHDF+FYSDRLIR
Sbjct: 233 AIDLIVQHIHTKLGQHDLCKIYPNLYVIQSTFQIRGMHTLIRDSKTTKHDFIFYSDRLIR 292

Query: 181 LVVEHGLGHLPFTEKQVITPTGAVYTGVDFCKRLCGVSVIR 221
           LVVEHGLGHLPFTEKQV+TPTG+VY+GVDFCK+LCGVSVIR
Sbjct: 293 LVVEHGLGHLPFTEKQVVTPTGSVYSGVDFCKKLCGVSVIR 333
Involved in the pyrimidine salvage pathway. The uracil phosphoribosyltransferase (UPRT) activity, that catalyzes the conversion of uracil and 5-phospho-alpha-D-ribose 1-diphosphate (PRPP) to UMP and diphosphate, is unsure.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 4EC: .EC: 2EC: .EC: 9
>sp|O65583|UKL4_ARATH Uridine kinase-like protein 4 OS=Arabidopsis thaliana GN=UKL4 PE=1 SV=2 Back     alignment and function description
>sp|Q9FKS0|UKL1_ARATH Uridine kinase-like protein 1, chloroplastic OS=Arabidopsis thaliana GN=UKL1 PE=1 SV=1 Back     alignment and function description
>sp|Q9LK34|UKL2_ARATH Uridine kinase-like protein 2, chloroplastic OS=Arabidopsis thaliana GN=UKL2 PE=1 SV=1 Back     alignment and function description
>sp|Q9LTY6|UKL5_ARATH Uridine kinase-like protein 5 OS=Arabidopsis thaliana GN=UKL5 PE=2 SV=1 Back     alignment and function description
>sp|Q55EL3|UCKA_DICDI Uridine-cytidine kinase A OS=Dictyostelium discoideum GN=udkA PE=3 SV=1 Back     alignment and function description
>sp|Q91YL3|UCKL1_MOUSE Uridine-cytidine kinase-like 1 OS=Mus musculus GN=Uckl1 PE=1 SV=1 Back     alignment and function description
>sp|Q9NWZ5|UCKL1_HUMAN Uridine-cytidine kinase-like 1 OS=Homo sapiens GN=UCKL1 PE=1 SV=2 Back     alignment and function description
>sp|Q8T154|UCKB_DICDI Uridine-cytidine kinase B OS=Dictyostelium discoideum GN=udkB PE=3 SV=2 Back     alignment and function description
>sp|Q9BZX2|UCK2_HUMAN Uridine-cytidine kinase 2 OS=Homo sapiens GN=UCK2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query222
224056851 449 predicted protein [Populus trichocarpa] 0.990 0.489 0.954 1e-120
255557206 482 uridine cytidine kinase I, putative [Ric 0.995 0.458 0.941 1e-120
224122116 482 predicted protein [Populus trichocarpa] 0.995 0.458 0.941 1e-120
225463508 479 PREDICTED: uridine kinase-like protein 4 0.995 0.461 0.941 1e-119
15222778 466 putative uracil phosphoribosyltransferas 0.995 0.474 0.923 1e-118
145362341 461 putative uracil phosphoribosyltransferas 0.995 0.479 0.923 1e-118
449444018 481 PREDICTED: uridine kinase-like protein 3 0.995 0.459 0.927 1e-117
356552443 478 PREDICTED: uridine kinase-like protein 4 0.995 0.462 0.900 1e-115
356527242 477 PREDICTED: uridine kinase-like protein 4 0.990 0.461 0.909 1e-113
357460287 476 Uridine-cytidine kinase, putative [Medic 0.986 0.460 0.904 1e-113
>gi|224056851|ref|XP_002299055.1| predicted protein [Populus trichocarpa] gi|222846313|gb|EEE83860.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  435 bits (1119), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 211/221 (95%), Positives = 216/221 (97%), Gaps = 1/221 (0%)

Query: 1   MEKLRHGQAVDIPNYDFKSYKNNVFPARRVNPSDVILLEGILVFHDSRVRELMNMKIFVD 60
           MEKLRHGQAVDIPNYDFKSYKN VFPARRVNPSDVI+LEGIL+FHD R+RELMNMKIFVD
Sbjct: 88  MEKLRHGQAVDIPNYDFKSYKN-VFPARRVNPSDVIILEGILIFHDPRIRELMNMKIFVD 146

Query: 61  TDADVRLARRIRRDTVEKGRDIATVLDQYSKFVKPAFDDFILPTKKYADIIIPRGGDNHV 120
           TDADVRLARRIRRD VEKGRDIATVLDQYSKFVKPAFDDFILPTKKYADIIIPRGGDNHV
Sbjct: 147 TDADVRLARRIRRDIVEKGRDIATVLDQYSKFVKPAFDDFILPTKKYADIIIPRGGDNHV 206

Query: 121 AIDLIVQHIRTKLGQHDLCKIYPNLYVIHSTFQIRGMHTLIRDSQTTKHDFVFYSDRLIR 180
           AIDLIVQHIRTKLGQHDLCKIYPNLYVI STFQIRGMHTLIRDSQTTKHDFVFY+DRLIR
Sbjct: 207 AIDLIVQHIRTKLGQHDLCKIYPNLYVIQSTFQIRGMHTLIRDSQTTKHDFVFYADRLIR 266

Query: 181 LVVEHGLGHLPFTEKQVITPTGAVYTGVDFCKRLCGVSVIR 221
           LVVEHGLGHLPFTEKQV TPTG+VYTGVDFCKRLCGVSVIR
Sbjct: 267 LVVEHGLGHLPFTEKQVTTPTGSVYTGVDFCKRLCGVSVIR 307

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255557206|ref|XP_002519634.1| uridine cytidine kinase I, putative [Ricinus communis] gi|223541224|gb|EEF42779.1| uridine cytidine kinase I, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224122116|ref|XP_002330545.1| predicted protein [Populus trichocarpa] gi|222872103|gb|EEF09234.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225463508|ref|XP_002263911.1| PREDICTED: uridine kinase-like protein 4 [Vitis vinifera] gi|296090033|emb|CBI39852.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|15222778|ref|NP_175977.1| putative uracil phosphoribosyltransferase [Arabidopsis thaliana] gi|42571893|ref|NP_974037.1| putative uracil phosphoribosyltransferase [Arabidopsis thaliana] gi|75331125|sp|Q8VYB2.1|UKL3_ARATH RecName: Full=Uridine kinase-like protein 3; Includes: RecName: Full=Uridine kinase; Short=UK; Includes: RecName: Full=Putative uracil phosphoribosyltransferase; Short=UPRTase; AltName: Full=UMP pyrophosphorylase gi|18176410|gb|AAL60039.1| putative uracil phosphoribosyltransferase [Arabidopsis thaliana] gi|21689715|gb|AAM67479.1| putative uracil phosphoribosyltransferase [Arabidopsis thaliana] gi|222423899|dbj|BAH19913.1| AT1G55810 [Arabidopsis thaliana] gi|332195179|gb|AEE33300.1| putative uracil phosphoribosyltransferase [Arabidopsis thaliana] gi|332195180|gb|AEE33301.1| putative uracil phosphoribosyltransferase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|145362341|ref|NP_974036.2| putative uracil phosphoribosyltransferase [Arabidopsis thaliana] gi|332195181|gb|AEE33302.1| putative uracil phosphoribosyltransferase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449444018|ref|XP_004139772.1| PREDICTED: uridine kinase-like protein 3-like [Cucumis sativus] gi|449482610|ref|XP_004156347.1| PREDICTED: uridine kinase-like protein 3-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356552443|ref|XP_003544577.1| PREDICTED: uridine kinase-like protein 4-like [Glycine max] Back     alignment and taxonomy information
>gi|356527242|ref|XP_003532221.1| PREDICTED: uridine kinase-like protein 4-like [Glycine max] Back     alignment and taxonomy information
>gi|357460287|ref|XP_003600425.1| Uridine-cytidine kinase, putative [Medicago truncatula] gi|355489473|gb|AES70676.1| Uridine-cytidine kinase, putative [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query222
TAIR|locus:2012125 466 UKL3 "AT1G55810" [Arabidopsis 0.995 0.474 0.923 2.9e-110
TAIR|locus:2131498 469 UKL4 "AT4G26510" [Arabidopsis 0.986 0.466 0.909 5.1e-106
TAIR|locus:2164516 486 UK/UPRT1 "AT5G40870" [Arabidop 0.990 0.452 0.804 2.2e-96
TAIR|locus:2086523 483 UKL2 "AT3G27190" [Arabidopsis 0.981 0.451 0.802 2e-95
TAIR|locus:2086691 465 UKL5 "AT3G27440" [Arabidopsis 0.990 0.473 0.773 1.2e-90
MGI|MGI:1915806 548 Uckl1 "uridine-cytidine kinase 0.990 0.401 0.474 6.3e-53
DICTYBASE|DDB_G0269034 499 udkA "uridine kinase" [Dictyos 0.990 0.440 0.489 1e-52
UNIPROTKB|E1BP85 548 UCKL1 "Uridine kinase" [Bos ta 0.990 0.401 0.474 1.3e-52
UNIPROTKB|Q9NWZ5 548 UCKL1 "Uridine-cytidine kinase 0.990 0.401 0.470 2.1e-52
UNIPROTKB|F1P819 554 UCKL1 "Uridine kinase" [Canis 0.990 0.397 0.468 1.9e-51
TAIR|locus:2012125 UKL3 "AT1G55810" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1089 (388.4 bits), Expect = 2.9e-110, P = 2.9e-110
 Identities = 204/221 (92%), Positives = 215/221 (97%)

Query:     1 MEKLRHGQAVDIPNYDFKSYKNNVFPARRVNPSDVILLEGILVFHDSRVRELMNMKIFVD 60
             MEKLR GQAVDIPNYDFKSYKNNVFP RRVNPSDVI+LEGIL+FHD RVR+LMNMKIFVD
Sbjct:   113 MEKLRKGQAVDIPNYDFKSYKNNVFPPRRVNPSDVIILEGILIFHDPRVRDLMNMKIFVD 172

Query:    61 TDADVRLARRIRRDTVEKGRDIATVLDQYSKFVKPAFDDFILPTKKYADIIIPRGGDNHV 120
              DADVRLARRI+RDTVEKGRDIATVLDQYSKFVKPAF+DFILPTKKYADIIIPRGGDNHV
Sbjct:   173 ADADVRLARRIKRDTVEKGRDIATVLDQYSKFVKPAFEDFILPTKKYADIIIPRGGDNHV 232

Query:   121 AIDLIVQHIRTKLGQHDLCKIYPNLYVIHSTFQIRGMHTLIRDSQTTKHDFVFYSDRLIR 180
             AIDLIVQHI TKLGQHDLCKIYPNLYVI STFQIRGMHTLIRDS+TTKHDF+FYSDRLIR
Sbjct:   233 AIDLIVQHIHTKLGQHDLCKIYPNLYVIQSTFQIRGMHTLIRDSKTTKHDFIFYSDRLIR 292

Query:   181 LVVEHGLGHLPFTEKQVITPTGAVYTGVDFCKRLCGVSVIR 221
             LVVEHGLGHLPFTEKQV+TPTG+VY+GVDFCK+LCGVSVIR
Sbjct:   293 LVVEHGLGHLPFTEKQVVTPTGSVYSGVDFCKKLCGVSVIR 333
GO:0004845 "uracil phosphoribosyltransferase activity" evidence=ISS
GO:0005524 "ATP binding" evidence=IEA;ISS
GO:0005575 "cellular_component" evidence=ND
GO:0008152 "metabolic process" evidence=IEA
GO:0009058 "biosynthetic process" evidence=ISS
GO:0016301 "kinase activity" evidence=IEA;ISS
GO:0016773 "phosphotransferase activity, alcohol group as acceptor" evidence=IEA
GO:0006094 "gluconeogenesis" evidence=RCA
GO:0007010 "cytoskeleton organization" evidence=RCA
GO:0010498 "proteasomal protein catabolic process" evidence=RCA
TAIR|locus:2131498 UKL4 "AT4G26510" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2164516 UK/UPRT1 "AT5G40870" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2086523 UKL2 "AT3G27190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2086691 UKL5 "AT3G27440" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
MGI|MGI:1915806 Uckl1 "uridine-cytidine kinase 1-like 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0269034 udkA "uridine kinase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|E1BP85 UCKL1 "Uridine kinase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q9NWZ5 UCKL1 "Uridine-cytidine kinase-like 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1P819 UCKL1 "Uridine kinase" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
C5D4Y5URK_GEOSW2, ., 7, ., 1, ., 4, 80.50370.60360.6350yesno
B7GIU0URK_ANOFW2, ., 7, ., 1, ., 4, 80.50350.61260.6445yesno
Q8VYB2UKL3_ARATH2, ., 4, ., 2, ., 90.92300.99540.4742yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.7.10.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_fgenesh4_pg.C_LG_I3337
hypothetical protein (449 aa)
(Populus trichocarpa)
Predicted Functional Partners:
grail3.0074007001
hypothetical protein (475 aa)
     •• 0.901
estExt_Genewise1_v1.C_LG_I7094
SubName- Full=Putative uncharacterized protein; (475 aa)
     •• 0.900
gw1.XV.2929.1
adenylate kinase family protein (EC-2.7.4.14) (224 aa)
     •  0.899
gw1.VI.1035.1
cytidine deaminase (EC-3.5.4.5) (290 aa)
     •  0.899
grail3.0996000101
cytidine deaminase (EC-3.5.4.5) (292 aa)
     •  0.899
grail3.0145001501
cytidine deaminase (EC-3.5.4.5) (292 aa)
     •  0.899
fgenesh4_pg.C_LG_VIII000753
hypothetical protein (536 aa)
     •  0.899
eugene3.00031452
hypothetical protein (211 aa)
     •  0.899
eugene3.00021246
SubName- Full=Putative uncharacterized protein; (200 aa)
     •  0.899
estExt_fgenesh4_pm.C_LG_X0646
hypothetical protein (508 aa)
     •  0.899

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query222
cd02023198 cd02023, UMPK, Uridine monophosphate kinase (UMPK, 1e-68
PRK05480209 PRK05480, PRK05480, uridine/cytidine kinase; Provi 2e-60
TIGR00235207 TIGR00235, udk, uridine kinase 4e-49
COG0572218 COG0572, Udk, Uridine kinase [Nucleotide transport 4e-49
pfam00485197 pfam00485, PRK, Phosphoribulokinase / Uridine kina 1e-32
PTZ00301210 PTZ00301, PTZ00301, uridine kinase; Provisional 1e-22
PLN02348395 PLN02348, PLN02348, phosphoribulokinase 1e-18
cd02026273 cd02026, PRK, Phosphoribulokinase (PRK) is an enzy 3e-18
PRK07429327 PRK07429, PRK07429, phosphoribulokinase; Provision 8e-18
PRK08233182 PRK08233, PRK08233, hypothetical protein; Provisio 1e-09
COG0035 210 COG0035, Upp, Uracil phosphoribosyltransferase [Nu 2e-09
cd02028179 cd02028, UMPK_like, Uridine monophosphate kinase_l 5e-09
PLN02318 656 PLN02318, PLN02318, phosphoribulokinase/uridine ki 2e-08
>gnl|CDD|238981 cd02023, UMPK, Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information 
 Score =  208 bits (532), Expect = 1e-68
 Identities = 81/132 (61%), Positives = 107/132 (81%), Gaps = 1/132 (0%)

Query: 1   MEKLRHGQAVDIPNYDFKSYKNNVFPARRVNPSDVILLEGILVFHDSRVRELMNMKIFVD 60
           ++ L++G++V+IP YDFK++         V P+DVI+LEGIL  +D  +R+LM++KIFVD
Sbjct: 68  LQDLKNGKSVEIPVYDFKTHSRLKETVT-VYPADVIILEGILALYDKELRDLMDLKIFVD 126

Query: 61  TDADVRLARRIRRDTVEKGRDIATVLDQYSKFVKPAFDDFILPTKKYADIIIPRGGDNHV 120
           TDADVRL RRI RD VE+GRD+ +V++QY KFVKP  + FI PTK+YAD+IIPRGGDNHV
Sbjct: 127 TDADVRLIRRIERDIVERGRDLESVINQYLKFVKPMHEQFIEPTKRYADVIIPRGGDNHV 186

Query: 121 AIDLIVQHIRTK 132
           AIDLIVQHI++K
Sbjct: 187 AIDLIVQHIKSK 198

7.1.48), also known as uridine kinase or uridine-cytidine kinase (UCK), catalyzes the reversible phosphoryl transfer from ATP to uridine or cytidine to yield UMP or CMP. In the primidine nucleotide-salvage pathway, this enzyme combined with nucleoside diphosphate kinases further phosphorylates UMP and CMP to form UTP and CTP. This kinase also catalyzes the phosphorylation of several cytotoxic ribonucleoside analogs such as 5-flurrouridine and cyclopentenyl-cytidine. Length = 198
>gnl|CDD|235492 PRK05480, PRK05480, uridine/cytidine kinase; Provisional Back     alignment and domain information
>gnl|CDD|232890 TIGR00235, udk, uridine kinase Back     alignment and domain information
>gnl|CDD|223645 COG0572, Udk, Uridine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|201257 pfam00485, PRK, Phosphoribulokinase / Uridine kinase family Back     alignment and domain information
>gnl|CDD|140322 PTZ00301, PTZ00301, uridine kinase; Provisional Back     alignment and domain information
>gnl|CDD|215198 PLN02348, PLN02348, phosphoribulokinase Back     alignment and domain information
>gnl|CDD|238984 cd02026, PRK, Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>gnl|CDD|180975 PRK07429, PRK07429, phosphoribulokinase; Provisional Back     alignment and domain information
>gnl|CDD|181310 PRK08233, PRK08233, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|223113 COG0035, Upp, Uracil phosphoribosyltransferase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|238986 cd02028, UMPK_like, Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>gnl|CDD|177952 PLN02318, PLN02318, phosphoribulokinase/uridine kinase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 222
KOG4203 473 consensus Armadillo/beta-Catenin/plakoglobin [Sign 100.0
COG0572218 Udk Uridine kinase [Nucleotide transport and metab 99.98
PTZ00301210 uridine kinase; Provisional 99.97
PF00485194 PRK: Phosphoribulokinase / Uridine kinase family; 99.95
PLN02318 656 phosphoribulokinase/uridine kinase 99.93
cd02029277 PRK_like Phosphoribulokinase-like (PRK-like) is a 99.89
PRK05480209 uridine/cytidine kinase; Provisional 99.88
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phos 99.87
TIGR00235207 udk uridine kinase. Model contains a number of lon 99.87
PLN02348395 phosphoribulokinase 99.87
COG0035 210 Upp Uracil phosphoribosyltransferase [Nucleotide t 99.86
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_ 99.86
TIGR00554290 panK_bact pantothenate kinase, bacterial type. Sho 99.84
PRK05439311 pantothenate kinase; Provisional 99.84
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 99.83
PRK15453290 phosphoribulokinase; Provisional 99.83
PLN02541 244 uracil phosphoribosyltransferase 99.81
TIGR01091 207 upp uracil phosphoribosyltransferase. that include 99.81
PRK00129 209 upp uracil phosphoribosyltransferase; Reviewed 99.81
cd02026273 PRK Phosphoribulokinase (PRK) is an enzyme involve 99.8
PRK07429327 phosphoribulokinase; Provisional 99.78
PF14681 207 UPRTase: Uracil phosphoribosyltransferase; PDB: 1V 99.77
KOG1017 267 consensus Predicted uracil phosphoribosyltransfera 99.66
PRK09270229 nucleoside triphosphate hydrolase domain-containin 99.56
PRK07667193 uridine kinase; Provisional 99.53
PRK06696223 uridine kinase; Validated 99.52
COG1072283 CoaA Panthothenate kinase [Coenzyme metabolism] 99.43
PRK06547172 hypothetical protein; Provisional 99.41
cd02024187 NRK1 Nicotinamide riboside kinase (NRK) is an enzy 99.36
KOG2702323 consensus Predicted panthothenate kinase/uridine k 99.04
PRK08233182 hypothetical protein; Provisional 98.88
PLN03046460 D-glycerate 3-kinase; Provisional 98.51
cd02022179 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.2 98.26
PRK14730195 coaE dephospho-CoA kinase; Provisional 98.19
PRK14732196 coaE dephospho-CoA kinase; Provisional 98.18
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 98.17
PRK14734200 coaE dephospho-CoA kinase; Provisional 98.01
PRK00081194 coaE dephospho-CoA kinase; Reviewed 97.9
PLN02422232 dephospho-CoA kinase 97.84
PRK03333 395 coaE dephospho-CoA kinase/protein folding accessor 97.81
PLN02796347 D-glycerate 3-kinase 97.81
PF01121180 CoaE: Dephospho-CoA kinase; InterPro: IPR001977 Th 97.8
PRK14731208 coaE dephospho-CoA kinase; Provisional 97.75
PRK14733204 coaE dephospho-CoA kinase; Provisional 97.72
PTZ00451244 dephospho-CoA kinase; Provisional 97.7
TIGR00152188 dephospho-CoA kinase. This model produces scores i 97.66
PRK01184184 hypothetical protein; Provisional 97.59
TIGR02173171 cyt_kin_arch cytidylate kinase, putative. Proteins 97.5
PRK04182180 cytidylate kinase; Provisional 97.4
PRK00023225 cmk cytidylate kinase; Provisional 97.25
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and me 97.02
PRK13477512 bifunctional pantoate ligase/cytidylate kinase; Pr 96.8
PRK08118167 topology modulation protein; Reviewed 96.67
TIGR00017217 cmk cytidylate kinase. This family consists of cyt 96.67
PRK06217183 hypothetical protein; Validated 96.64
KOG3308225 consensus Uncharacterized protein of the uridine k 96.43
COG3954289 PrkB Phosphoribulokinase [Energy production and co 96.33
KOG3220225 consensus Similar to bacterial dephospho-CoA kinas 96.28
PRK07261171 topology modulation protein; Provisional 96.15
PRK00131175 aroK shikimate kinase; Reviewed 96.13
PRK09518 712 bifunctional cytidylate kinase/GTPase Der; Reviewe 96.0
PRK11860661 bifunctional 3-phosphoshikimate 1-carboxyvinyltran 95.87
COG0237201 CoaE Dephospho-CoA kinase [Coenzyme metabolism] 95.83
PRK13946184 shikimate kinase; Provisional 95.76
PRK05057172 aroK shikimate kinase I; Reviewed 95.35
COG0283222 Cmk Cytidylate kinase [Nucleotide transport and me 95.14
PF02224157 Cytidylate_kin: Cytidylate kinase; InterPro: IPR01 94.67
PRK06762166 hypothetical protein; Provisional 94.64
PRK13949169 shikimate kinase; Provisional 94.16
PRK04040188 adenylate kinase; Provisional 94.12
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 93.89
PRK00625173 shikimate kinase; Provisional 93.69
cd02030219 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO 93.44
COG1428216 Deoxynucleoside kinases [Nucleotide transport and 93.0
PRK08356195 hypothetical protein; Provisional 92.87
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 92.75
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 92.63
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 92.42
PRK14737186 gmk guanylate kinase; Provisional 92.17
PRK03731171 aroL shikimate kinase II; Reviewed 92.06
PRK12269 863 bifunctional cytidylate kinase/ribosomal protein S 91.78
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 91.65
PRK08154309 anaerobic benzoate catabolism transcriptional regu 91.54
PRK05541176 adenylylsulfate kinase; Provisional 91.32
KOG2878282 consensus Predicted kinase [General function predi 91.29
COG4240300 Predicted kinase [General function prediction only 90.88
PF01202158 SKI: Shikimate kinase; InterPro: IPR000623 Shikima 90.82
PRK00698205 tmk thymidylate kinase; Validated 90.17
PF01712146 dNK: Deoxynucleoside kinase; InterPro: IPR002624 T 90.1
COG0703172 AroK Shikimate kinase [Amino acid transport and me 89.94
cd01672200 TMPK Thymidine monophosphate kinase (TMPK), also k 89.68
PLN02200234 adenylate kinase family protein 88.76
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 88.64
PRK13947171 shikimate kinase; Provisional 88.54
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 87.85
PRK13974212 thymidylate kinase; Provisional 87.48
COG0125208 Tmk Thymidylate kinase [Nucleotide transport and m 87.13
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 86.88
PRK14527191 adenylate kinase; Provisional 86.69
PRK13808333 adenylate kinase; Provisional 86.45
PRK13975196 thymidylate kinase; Provisional 85.73
PRK14530215 adenylate kinase; Provisional 85.31
PRK13973213 thymidylate kinase; Provisional 84.81
PF02223186 Thymidylate_kin: Thymidylate kinase; InterPro: IPR 84.53
cd01673193 dNK Deoxyribonucleoside kinase (dNK) catalyzes the 84.14
PRK07933213 thymidylate kinase; Validated 83.89
PRK13976209 thymidylate kinase; Provisional 82.24
PRK02496184 adk adenylate kinase; Provisional 81.54
PRK12338319 hypothetical protein; Provisional 81.44
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 81.24
>KOG4203 consensus Armadillo/beta-Catenin/plakoglobin [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information 
Probab=100.00  E-value=7.8e-36  Score=275.48  Aligned_cols=221  Identities=60%  Similarity=1.037  Sum_probs=212.2

Q ss_pred             ccccCCCceeecccccccCccCCCCeeEeCCCcEEEEeccccCCChhhhccCCeEEEEECCHHHHHHHHHhhcccccCCC
Q 027528            2 EKLRHGQAVDIPNYDFKSYKNNVFPARRVNPSDVILLEGILVFHDSRVRELMNMKIFVDTDADVRLARRIRRDTVEKGRD   81 (222)
Q Consensus         2 ~~Lk~g~~v~~P~YD~~~~~r~~~~~~~v~~~~vvIvEGi~~l~~~~l~~~~D~~Ifvd~d~d~rl~Rri~RD~~~rg~~   81 (222)
                      +.+++|+++.+|.|||.++++..+..+.+.|++++++||++++|+++.+++++.++|+|++.+.+++||+.||..++|++
T Consensus       123 ~~~~kg~~v~ip~y~~~~~~~~~~~~~~l~~~~~~ilegil~~yd~~~~~l~~~k~fvd~~~d~rla~ri~r~~~~~g~~  202 (473)
T KOG4203|consen  123 KNLKKGKAVEIPVYDFVTHSRDEEKTIVVYPADVIILEGILAFYDERVRDLFTMKLFVDTDADVRLARRILRDIVERGRD  202 (473)
T ss_pred             hcccccceeeceeeeeecccCCCCceEEecCCCceeehhHHHHhHHHHHHHhcceEEEecCcchhhHHHHhcchhhhccc
Confidence            46778999999999999999855557888999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHhccccchhhhccccCCCccEEEcCCCCchhhHHHHHHHHHHHhccCCccccCCceeeeccchhhhhhhhhh
Q 027528           82 IATVLDQYSKFVKPAFDDFILPTKKYADIIIPRGGDNHVAIDLIVQHIRTKLGQHDLCKIYPNLYVIHSTFQIRGMHTLI  161 (222)
Q Consensus        82 ~~~~~~~~~~~~~p~~~~~i~p~~~~ADlvi~~~~~~~~~~~~~~~~i~~~l~~~~~~~~~~~v~vl~~~p~~~~~lt~l  161 (222)
                      ++.++.+|..+++|+|+.||+|++.+||++|+.+++|.++++.+.++|+..|.++..+.+..|+..++++|++++++|.+
T Consensus       203 l~~i~~q~~~f~kp~~~~~i~p~~~~ad~ii~~~~~n~vai~l~~~~i~~~L~~~~~~~l~~~~~~l~~t~~i~~~~t~~  282 (473)
T KOG4203|consen  203 LESILTQYSTFVKPAFEEFILPTKKYADVIIPRGGDNDVAIDLIVQHILSILAEKSYVRLYNNVLSLPDTNQIKGKLTLL  282 (473)
T ss_pred             HHHHHHHHHhhcCchHHHHhhHHHHhhhheeeccccccccceeeehhhhhhhhccccccccccceecCCccccCCceeEe
Confidence            99999999999999999999999999999999999999999999999999999999889999999999999999999999


Q ss_pred             hcCCCCchhhhhhHHHHHHHHHHHHhCCCCCeeeEEeCCCCceeEeeeecCcEeEEEeeCC
Q 027528          162 RDSQTTKHDFVFYSDRLIRLVVEHGLGHLPFTEKQVITPTGAVYTGVDFCKRLCGVSVIRR  222 (222)
Q Consensus       162 Rd~~t~~~~Fr~~~~~i~~lL~~ea~~~l~~~~~~V~TP~~~~~~g~~~~~~i~~V~IlRA  222 (222)
                      ||+.|++.+|.++.+++++++.++++..+|+.+..+.||.|..+.|.....++|+|+|+||
T Consensus       283 ~~~~Ts~~~~~~~~~~~vrl~l~~~~~~~p~~~~~i~~~~~~~~~~~~~~~~i~gv~i~r~  343 (473)
T KOG4203|consen  283 RDHTTSRHPFSFYSDHLVRLVLEHGLGHLPYTEKRIVTPRGLAYSGVNFCKQICGVSIPRS  343 (473)
T ss_pred             ecCCcCCCCHHHHHHHHHHHHhhcccCcccceeeeEecccccchhcccccchhccCCCCcc
Confidence            9999999999999999999999999999999999999999998889987799999999996

>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PTZ00301 uridine kinase; Provisional Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>PLN02318 phosphoribulokinase/uridine kinase Back     alignment and domain information
>cd02029 PRK_like Phosphoribulokinase-like (PRK-like) is a family of proteins similar to phosphoribulokinase (PRK), the enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>PLN02348 phosphoribulokinase Back     alignment and domain information
>COG0035 Upp Uracil phosphoribosyltransferase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>TIGR00554 panK_bact pantothenate kinase, bacterial type Back     alignment and domain information
>PRK05439 pantothenate kinase; Provisional Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK15453 phosphoribulokinase; Provisional Back     alignment and domain information
>PLN02541 uracil phosphoribosyltransferase Back     alignment and domain information
>TIGR01091 upp uracil phosphoribosyltransferase Back     alignment and domain information
>PRK00129 upp uracil phosphoribosyltransferase; Reviewed Back     alignment and domain information
>cd02026 PRK Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>PRK07429 phosphoribulokinase; Provisional Back     alignment and domain information
>PF14681 UPRTase: Uracil phosphoribosyltransferase; PDB: 1V9S_B 1UPF_A 1UPU_D 1JLR_B 1BD4_A 1BD3_C 1JLS_D 1XTV_C 1XTU_H 3G6W_C Back     alignment and domain information
>KOG1017 consensus Predicted uracil phosphoribosyltransferase [General function prediction only] Back     alignment and domain information
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>COG1072 CoaA Panthothenate kinase [Coenzyme metabolism] Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) Back     alignment and domain information
>KOG2702 consensus Predicted panthothenate kinase/uridine kinase-related protein [Nucleotide transport and metabolism; Coenzyme transport and metabolism] Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>PLN03046 D-glycerate 3-kinase; Provisional Back     alignment and domain information
>cd02022 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2 Back     alignment and domain information
>PRK14730 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK14732 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>PRK14734 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK00081 coaE dephospho-CoA kinase; Reviewed Back     alignment and domain information
>PLN02422 dephospho-CoA kinase Back     alignment and domain information
>PRK03333 coaE dephospho-CoA kinase/protein folding accessory domain-containing protein; Provisional Back     alignment and domain information
>PLN02796 D-glycerate 3-kinase Back     alignment and domain information
>PF01121 CoaE: Dephospho-CoA kinase; InterPro: IPR001977 This family contains dephospho-CoA kinases (2 Back     alignment and domain information
>PRK14731 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK14733 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PTZ00451 dephospho-CoA kinase; Provisional Back     alignment and domain information
>TIGR00152 dephospho-CoA kinase Back     alignment and domain information
>PRK01184 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02173 cyt_kin_arch cytidylate kinase, putative Back     alignment and domain information
>PRK04182 cytidylate kinase; Provisional Back     alignment and domain information
>PRK00023 cmk cytidylate kinase; Provisional Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13477 bifunctional pantoate ligase/cytidylate kinase; Provisional Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>TIGR00017 cmk cytidylate kinase Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>KOG3308 consensus Uncharacterized protein of the uridine kinase family [Nucleotide transport and metabolism] Back     alignment and domain information
>COG3954 PrkB Phosphoribulokinase [Energy production and conversion] Back     alignment and domain information
>KOG3220 consensus Similar to bacterial dephospho-CoA kinase [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>PRK11860 bifunctional 3-phosphoshikimate 1-carboxyvinyltransferase/cytidine monophosphate kinase; Provisional Back     alignment and domain information
>COG0237 CoaE Dephospho-CoA kinase [Coenzyme metabolism] Back     alignment and domain information
>PRK13946 shikimate kinase; Provisional Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>COG0283 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF02224 Cytidylate_kin: Cytidylate kinase; InterPro: IPR011994 Cytidylate kinase (2 Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>cd02030 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO42) is a family of proteins that are highly similar to deoxyribonucleoside kinases (dNK) Back     alignment and domain information
>COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK08356 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK03731 aroL shikimate kinase II; Reviewed Back     alignment and domain information
>PRK12269 bifunctional cytidylate kinase/ribosomal protein S1; Provisional Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>KOG2878 consensus Predicted kinase [General function prediction only] Back     alignment and domain information
>COG4240 Predicted kinase [General function prediction only] Back     alignment and domain information
>PF01202 SKI: Shikimate kinase; InterPro: IPR000623 Shikimate kinase (2 Back     alignment and domain information
>PRK00698 tmk thymidylate kinase; Validated Back     alignment and domain information
>PF01712 dNK: Deoxynucleoside kinase; InterPro: IPR002624 This family consists of various deoxynucleoside kinases including cytidine (2 Back     alignment and domain information
>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>PRK13974 thymidylate kinase; Provisional Back     alignment and domain information
>COG0125 Tmk Thymidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>PRK13808 adenylate kinase; Provisional Back     alignment and domain information
>PRK13975 thymidylate kinase; Provisional Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>PRK13973 thymidylate kinase; Provisional Back     alignment and domain information
>PF02223 Thymidylate_kin: Thymidylate kinase; InterPro: IPR018094 Thymidylate kinase (2 Back     alignment and domain information
>cd01673 dNK Deoxyribonucleoside kinase (dNK) catalyzes the phosphorylation of deoxyribonucleosides to yield corresponding monophosphates (dNMPs) Back     alignment and domain information
>PRK07933 thymidylate kinase; Validated Back     alignment and domain information
>PRK13976 thymidylate kinase; Provisional Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>PRK12338 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query222
1xrj_A261 Rapid Structure Determination Of Human Uridine-Cyti 7e-38
1udw_A252 Crystal Structure Of Human Uridine-cytidine Kinase 8e-38
2jeo_A245 Crystal Structure Of Human Uridine-Cytidine Kinase 2e-36
3asy_A211 Ligand-Free Structure Of Uridine Kinase From Thermu 8e-28
1bd3_D 243 Structure Of The Apo Uracil Phosphoribosyltransfera 1e-20
1upu_D 224 Structure Of The Uracil Phosphoribosyltransferase, 1e-20
>pdb|1XRJ|A Chain A, Rapid Structure Determination Of Human Uridine-Cytidine Kinase 2 Using A Conventional Laboratory X-Ray Source And A Single Samarium Derivative Length = 261 Back     alignment and structure 
Iteration: 1

 Score =  153 bits (386), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 74/130 (56%), Positives = 95/130 (73%), Gaps = 1/130 (0%)
Query: 1   MEKLRHGQAVDIPNYDFKSYKNNVFPARRVNPSDVILLEGILVFHDSRVRELMNMKIFVD 60
           ++++  G+ V IP YDF S+         V P+DV+L EGIL F+   VR+L  MK+FVD
Sbjct: 98  LKEITEGKTVQIPVYDFVSHSRKE-ETVTVYPADVVLFEGILAFYSQEVRDLFQMKLFVD 156
Query: 61  TDADVRLARRIRRDTVEKGRDIATVLDQYSKFVKPAFDDFILPTKKYADIIIPRGGDNHV 120
           TDAD RL+RR+ RD  E+GRD+  +L QY  FVKPAF++F LPTKKYAD+IIPRG DN V
Sbjct: 157 TDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADVIIPRGADNLV 216
Query: 121 AIDLIVQHIR 130
           AI+LIVQHI+
Sbjct: 217 AINLIVQHIQ 226
>pdb|1UDW|A Chain A, Crystal Structure Of Human Uridine-cytidine Kinase 2 Complexed With A Feedback-inhibitor, Ctp Length = 252 Back     alignment and structure
>pdb|2JEO|A Chain A, Crystal Structure Of Human Uridine-Cytidine Kinase 1 Length = 245 Back     alignment and structure
>pdb|3ASY|A Chain A, Ligand-Free Structure Of Uridine Kinase From Thermus Thermophilus Hb8 Length = 211 Back     alignment and structure
>pdb|1BD3|D Chain D, Structure Of The Apo Uracil Phosphoribosyltransferase, 2 Mutant C128v Length = 243 Back     alignment and structure
>pdb|1UPU|D Chain D, Structure Of The Uracil Phosphoribosyltransferase, Mutant C128v, Bound To Product Uridine-1-Monophosphate (Ump) Length = 224 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query222
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 3e-62
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 1e-56
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 5e-55
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 4e-33
1a7j_A290 Phosphoribulokinase; transferase, calvin cycle; 2. 5e-31
1bd3_D 243 Uprtase, uracil phosphoribosyltransferase; glycosy 1e-30
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 2e-30
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 4e-29
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 4e-28
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 1e-26
1o5o_A 221 Uracil phosphoribosyltransferase; TM0721, structur 7e-25
3dmp_A 217 Uracil phosphoribosyltransferase; structural genom 3e-24
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 4e-24
1i5e_A 209 Uracil phosphoribosyltransferase; salvage pathway; 4e-23
1v9s_A 208 Uracil phosphoribosyltransferase; pyrimidine salva 7e-21
2e55_A 208 Uracil phosphoribosyltransferase; structural genom 7e-21
2ehj_A 208 Uracil phosphoribosyltransferase; structural genom 8e-18
1xtt_A 216 Probable uracil phosphoribosyltransferase; tetrame 4e-16
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-05
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Length = 211 Back     alignment and structure
 Score =  192 bits (489), Expect = 3e-62
 Identities = 57/135 (42%), Positives = 88/135 (65%), Gaps = 1/135 (0%)

Query: 1   MEKLRHGQAVDIPNYDFKSYKNNVFPARRVNPSDVILLEGILVFHDSRVRELMNMKIFVD 60
            + L  G  V++P YDF++Y         V P+ V++LEGILV +   +R+LM++K+FVD
Sbjct: 74  AQALLRGLPVEMPVYDFRAYTR-SPRRTPVRPAPVVILEGILVLYPKELRDLMDLKVFVD 132

Query: 61  TDADVRLARRIRRDTVEKGRDIATVLDQYSKFVKPAFDDFILPTKKYADIIIPRGGDNHV 120
            DAD R  RR++RD +E+GR +  V+ QY + VKP    F+ PTK+YAD+I+PRGG N V
Sbjct: 133 ADADERFIRRLKRDVLERGRSLEGVVAQYLEQVKPMHLHFVEPTKRYADVIVPRGGQNPV 192

Query: 121 AIDLIVQHIRTKLGQ 135
           A++++      +L +
Sbjct: 193 ALEMLAAKALARLAR 207
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Length = 245 Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Length = 252 Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Length = 201 Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Length = 290 Back     alignment and structure
>1bd3_D Uprtase, uracil phosphoribosyltransferase; glycosyltransferase; 1.93A {Toxoplasma gondii} SCOP: c.61.1.1 PDB: 1bd4_D 1jlr_A* 1jls_B* 1upf_D 1upu_D* Length = 243 Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Length = 312 Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Length = 207 Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Length = 308 Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Length = 321 Back     alignment and structure
>1o5o_A Uracil phosphoribosyltransferase; TM0721, structural genomic PSI, protein structure initiative, joint center for structu genomics; HET: U5P; 2.30A {Thermotoga maritima} SCOP: c.61.1.1 Length = 221 Back     alignment and structure
>3dmp_A Uracil phosphoribosyltransferase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.60A {Burkholderia pseudomallei} Length = 217 Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Length = 208 Back     alignment and structure
>1i5e_A Uracil phosphoribosyltransferase; salvage pathway; HET: U5P; 3.00A {Bacillus caldolyticus} SCOP: c.61.1.1 Length = 209 Back     alignment and structure
>1v9s_A Uracil phosphoribosyltransferase; pyrimidine salvage, oligomerization, structural genomics, RI structural genomics/proteomics initiative; 2.10A {Thermus thermophilus} SCOP: c.61.1.1 Length = 208 Back     alignment and structure
>2e55_A Uracil phosphoribosyltransferase; structural genomics; 2.15A {Aquifex aeolicus} Length = 208 Back     alignment and structure
>2ehj_A Uracil phosphoribosyltransferase; structural genomics; 2.80A {Escherichia coli} Length = 208 Back     alignment and structure
>1xtt_A Probable uracil phosphoribosyltransferase; tetramer, type 1 phosphoribosyltransferase, UMP complex; HET: U5P; 1.80A {Sulfolobus solfataricus} SCOP: c.61.1.1 PDB: 1vst_A* 1xtu_A* 1xtv_A* 3g6w_A* Length = 216 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query222
1bd3_D 243 Uprtase, uracil phosphoribosyltransferase; glycosy 99.86
3dmp_A 217 Uracil phosphoribosyltransferase; structural genom 99.86
1xtt_A 216 Probable uracil phosphoribosyltransferase; tetrame 99.84
1v9s_A 208 Uracil phosphoribosyltransferase; pyrimidine salva 99.84
2ehj_A 208 Uracil phosphoribosyltransferase; structural genom 99.83
1o5o_A 221 Uracil phosphoribosyltransferase; TM0721, structur 99.83
2e55_A 208 Uracil phosphoribosyltransferase; structural genom 99.82
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 99.81
1i5e_A 209 Uracil phosphoribosyltransferase; salvage pathway; 99.81
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 99.7
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 99.66
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 99.64
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 99.64
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 99.6
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 99.59
1a7j_A290 Phosphoribulokinase; transferase, calvin cycle; 2. 99.57
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 99.54
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 99.45
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 99.42
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 98.56
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 98.49
4i1u_A210 Dephospho-COA kinase; structural genomics, niaid, 98.33
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 98.31
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 98.16
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 98.07
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 98.01
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 97.96
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 97.96
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 97.9
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 97.85
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 97.82
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 97.79
3d3q_A340 TRNA delta(2)-isopentenylpyrophosphate transferase 97.74
2h92_A219 Cytidylate kinase; rossmann fold, transferase; HET 97.71
3r20_A233 Cytidylate kinase; structural genomics, seattle st 97.52
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 97.43
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 96.49
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 96.44
3vaa_A199 Shikimate kinase, SK; structural genomics, center 96.36
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 96.22
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 96.17
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 96.15
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 96.13
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 96.07
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 95.68
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 95.54
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 95.3
3fdi_A201 Uncharacterized protein; cytidylate kinase like pr 95.22
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 95.07
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 94.95
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 94.37
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 94.3
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 94.23
3hdt_A223 Putative kinase; structura genomics, PSI-2, protei 94.15
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 94.05
2ocp_A241 DGK, deoxyguanosine kinase; protein-nucleotide com 94.04
1p5z_B263 DCK, deoxycytidine kinase; nucleoside kinase, P-lo 93.96
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 93.76
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 93.72
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 93.54
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 93.53
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 93.38
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 93.27
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 93.27
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 93.26
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 92.96
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 92.92
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 92.71
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 92.67
4tmk_A213 Protein (thymidylate kinase); ATP:DTMP phosphotran 92.46
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 92.37
4hlc_A205 DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri 92.31
3lv8_A236 DTMP kinase, thymidylate kinase; structural genomi 92.21
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 91.52
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 91.29
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 91.22
3ld9_A223 DTMP kinase, thymidylate kinase; ssgcid, NIH, niai 89.9
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 89.85
1kag_A173 SKI, shikimate kinase I; transferase, structural g 89.84
1via_A175 Shikimate kinase; structural genomics, transferase 89.66
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 89.62
2vli_A183 Antibiotic resistance protein; transferase, tunica 88.52
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 88.39
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 88.0
3hjn_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 86.29
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 84.86
3tlx_A243 Adenylate kinase 2; structural genomics, structura 83.83
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 83.38
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 83.36
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 81.54
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 81.17
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 80.87
>1bd3_D Uprtase, uracil phosphoribosyltransferase; glycosyltransferase; 1.93A {Toxoplasma gondii} SCOP: c.61.1.1 PDB: 1bd4_D 1jlr_A* 1jls_B* 1upf_D 1upu_D* Back     alignment and structure
Probab=99.86  E-value=3.4e-22  Score=169.60  Aligned_cols=85  Identities=47%  Similarity=0.906  Sum_probs=80.5

Q ss_pred             ccccCCceeeeccchhhhhhhhhhhcCCCCchhhhhhHHHHHHHHHHHHhCCCCCeeeEEeCCCCceeEeeeecCcEeEE
Q 027528          138 LCKIYPNLYVIHSTFQIRGMHTLIRDSQTTKHDFVFYSDRLIRLVVEHGLGHLPFTEKQVITPTGAVYTGVDFCKRLCGV  217 (222)
Q Consensus       138 ~~~~~~~v~vl~~~p~~~~~lt~lRd~~t~~~~Fr~~~~~i~~lL~~ea~~~l~~~~~~V~TP~~~~~~g~~~~~~i~~V  217 (222)
                      .+..+.||+++.+||+++|++|+|||++|++.+||++++||+++|+|||+++||+++++|+||+|..++|..+++++|+|
T Consensus        28 ~~~~~~~v~~~~~hp~i~~~lt~lRd~~t~~~~Fr~~~~rl~~ll~yEa~~~lp~~~~~v~TP~g~~~~g~~~~~~l~~V  107 (243)
T 1bd3_D           28 IITRFPNVVLMKQTAQLRAMMTIIRDKETPKEEFVFYADRLIRLLIEEALNELPFQKKEVTTPLDVSYHGVSFYSKICGV  107 (243)
T ss_dssp             HHHHCTTEEECCCCHHHHHHHHHHHCTTCCHHHHHHHHHHHHHHHHHHHHTTSCEEEEEEECTTSCEEEEEEECCCEEEE
T ss_pred             cccCCCcEEEecCCHHHHHHHHHHhcCCCCHHHHHHHHHHHHHHHHHHHHhcCCceeEEEECCCcceEeeeeccCcEEEE
Confidence            45677899999889999999999999999999999999999999999999999999999999999778999889999999


Q ss_pred             EeeCC
Q 027528          218 SVIRR  222 (222)
Q Consensus       218 ~IlRA  222 (222)
                      |||||
T Consensus       108 ~ILRa  112 (243)
T 1bd3_D          108 SIVRA  112 (243)
T ss_dssp             EEETT
T ss_pred             EEEcc
Confidence            99997
>3dmp_A Uracil phosphoribosyltransferase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.60A {Burkholderia pseudomallei} SCOP: c.61.1.1 Back     alignment and structure
>1xtt_A Probable uracil phosphoribosyltransferase; tetramer, type 1 phosphoribosyltransferase, UMP complex; HET: U5P; 1.80A {Sulfolobus solfataricus} SCOP: c.61.1.1 PDB: 1vst_A* 1xtu_A* 1xtv_A* 3g6w_A* Back     alignment and structure
>1v9s_A Uracil phosphoribosyltransferase; pyrimidine salvage, oligomerization, structural genomics, RI structural genomics/proteomics initiative; 2.10A {Thermus thermophilus} SCOP: c.61.1.1 Back     alignment and structure
>2ehj_A Uracil phosphoribosyltransferase; structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>1o5o_A Uracil phosphoribosyltransferase; TM0721, structural genomic PSI, protein structure initiative, joint center for structu genomics; HET: U5P; 2.30A {Thermotoga maritima} SCOP: c.61.1.1 Back     alignment and structure
>2e55_A Uracil phosphoribosyltransferase; structural genomics; 2.15A {Aquifex aeolicus} Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>1i5e_A Uracil phosphoribosyltransferase; salvage pathway; HET: U5P; 3.00A {Bacillus caldolyticus} SCOP: c.61.1.1 Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>4i1u_A Dephospho-COA kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.05A {Burkholderia vietnamiensis} PDB: 4i1v_A* Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>3fdi_A Uncharacterized protein; cytidylate kinase like protein, PSI, MCSG, PRK04182 class ME structural genomics, protein structure initiative; 2.20A {Eubacterium ventriosum} Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>3hdt_A Putative kinase; structura genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.79A {Clostridium symbiosum atcc 14940} Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* Back     alignment and structure
>4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 222
d1a7ja_288 c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sph 6e-34
d1uj2a_213 c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Ho 5e-29
d1bd3a_ 224 c.61.1.1 (A:) Uracil PRTase, Upp {Toxoplasma gondi 3e-24
d1sq5a_308 c.37.1.6 (A:) Pantothenate kinase PanK {Escherichi 2e-19
d1o5oa_ 210 c.61.1.1 (A:) Uracil PRTase, Upp {Thermotoga marit 2e-12
d1i5ea_ 208 c.61.1.1 (A:) Uracil PRTase, Upp {Bacillus caldoly 2e-12
d1xtta1 215 c.61.1.1 (A:2-216) Uracil PRTase, Upp {Sulfolobus 5e-12
d1v9sa1 208 c.61.1.1 (A:1-208) Uracil PRTase, Upp {Thermus the 1e-11
d1rz3a_198 c.37.1.6 (A:) Hypothetical protein rbstp0775 {Baci 1e-06
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Length = 288 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Phosphoribulokinase/pantothenate kinase
domain: Phosphoribulokinase
species: Rhodobacter sphaeroides [TaxId: 1063]

 Score =  120 bits (303), Expect = 6e-34
 Identities = 26/195 (13%), Positives = 51/195 (26%), Gaps = 34/195 (17%)

Query: 1   MEKLRHGQAVDIPNYDFKSYKNNVF---------PARRVNPSDVILLEGILVFH---DSR 48
             +           Y     +                  + S ++  EG+       +  
Sbjct: 83  FREYGETGQGRTRTYVHDDAEAARTGVAPGNFTDWRDFDSDSHLLFYEGLHGAVVNSEVN 142

Query: 49  VRELMNMKIFVDTDADVRLARRIRRDTVEKGRDIATVLDQYSKFVKPAFDDFILPTKKYA 108
           +  L ++KI V    ++   ++I RD   +G     V D   +    A+   I+P     
Sbjct: 143 IAGLADLKIGVVPVINLEWIQKIHRDRATRGYTTEAVTDVILR-RMHAYVHCIVPQFSQT 201

Query: 109 DIIIPRGGDNHVAIDLIVQHIRTKLGQHDLCKI---------------------YPNLYV 147
           DI   R      +   I + I T      + +                        N  V
Sbjct: 202 DINFQRVPVVDTSNPFIARWIPTADESVVVIRFRNPRGIDFPYLTSMIHGSWMSRANSIV 261

Query: 148 IHSTFQIRGMHTLIR 162
           +        M  ++ 
Sbjct: 262 VPGNKLDLAMQLILT 276
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 213 Back     information, alignment and structure
>d1bd3a_ c.61.1.1 (A:) Uracil PRTase, Upp {Toxoplasma gondii [TaxId: 5811]} Length = 224 Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Length = 308 Back     information, alignment and structure
>d1o5oa_ c.61.1.1 (A:) Uracil PRTase, Upp {Thermotoga maritima [TaxId: 2336]} Length = 210 Back     information, alignment and structure
>d1i5ea_ c.61.1.1 (A:) Uracil PRTase, Upp {Bacillus caldolyticus [TaxId: 1394]} Length = 208 Back     information, alignment and structure
>d1xtta1 c.61.1.1 (A:2-216) Uracil PRTase, Upp {Sulfolobus solfataricus [TaxId: 2287]} Length = 215 Back     information, alignment and structure
>d1v9sa1 c.61.1.1 (A:1-208) Uracil PRTase, Upp {Thermus thermophilus [TaxId: 274]} Length = 208 Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Length = 198 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query222
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 99.91
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 99.89
d1bd3a_ 224 Uracil PRTase, Upp {Toxoplasma gondii [TaxId: 5811 99.89
d1xtta1 215 Uracil PRTase, Upp {Sulfolobus solfataricus [TaxId 99.87
d1o5oa_ 210 Uracil PRTase, Upp {Thermotoga maritima [TaxId: 23 99.87
d1v9sa1 208 Uracil PRTase, Upp {Thermus thermophilus [TaxId: 2 99.87
d1i5ea_ 208 Uracil PRTase, Upp {Bacillus caldolyticus [TaxId: 99.86
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 99.86
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 99.4
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 98.53
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 98.46
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 98.05
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 98.0
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 96.5
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 96.14
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 94.79
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 94.36
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 93.9
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 93.31
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 92.98
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 92.67
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 90.42
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 90.34
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 90.22
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 89.51
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 89.43
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 89.26
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 88.7
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 84.82
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 82.49
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 80.8
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 80.41
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Phosphoribulokinase/pantothenate kinase
domain: Uridine-cytidine kinase 2
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.91  E-value=3.2e-25  Score=180.99  Aligned_cols=130  Identities=58%  Similarity=0.946  Sum_probs=122.2

Q ss_pred             cccCCCceeecccccccCccCCCCeeEeCCCcEEEEeccccCCChhhhccCCeEEEEECCHHHHHHHHHhhcccccCCCH
Q 027528            3 KLRHGQAVDIPNYDFKSYKNNVFPARRVNPSDVILLEGILVFHDSRVRELMNMKIFVDTDADVRLARRIRRDTVEKGRDI   82 (222)
Q Consensus         3 ~Lk~g~~v~~P~YD~~~~~r~~~~~~~v~~~~vvIvEGi~~l~~~~l~~~~D~~Ifvd~d~d~rl~Rri~RD~~~rg~~~   82 (222)
                      .+++|..+..|.||+..+++ ......+.+.+++|+||.++|+++.+++++|++|||++|.++++.|++.||..+||+++
T Consensus        82 ~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~iiveg~~~l~~~~l~~~~D~~i~v~~~~~~~~~R~~~Rd~~~rg~~~  160 (213)
T d1uj2a_          82 EITEGKTVQIPVYDFVSHSR-KEETVTVYPADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDL  160 (213)
T ss_dssp             HHHTTCCEEEEEEETTTTEE-EEEEEEECCCSEEEEECTTTTSSHHHHHHCSEEEEEECCHHHHHHHHHHHHHHHSCCCH
T ss_pred             hhhcCCcccccccccccccc-cCceEEecccceEEecchhhhccHHHHhhhheeeeecCCHHHHHHHHHHHHHHHcCCCH
Confidence            46689999999999999987 45567778999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHhccccchhhhccccCCCccEEEcCCCCchhhHHHHHHHHHHHh
Q 027528           83 ATVLDQYSKFVKPAFDDFILPTKKYADIIIPRGGDNHVAIDLIVQHIRTKL  133 (222)
Q Consensus        83 ~~~~~~~~~~~~p~~~~~i~p~~~~ADlvi~~~~~~~~~~~~~~~~i~~~l  133 (222)
                      ++++++|.+.++|+|++|+.|++++||+||+++.++.++++.++++|++.|
T Consensus       161 e~~~~~~~~~~~~~~~~~i~p~k~~ADlIi~~~~d~~~~i~~i~~~I~~ll  211 (213)
T d1uj2a_         161 EQILSQYITFVKPAFEEFCLPTKKYADVIIPRGADNLVAINLIVQHIQDIL  211 (213)
T ss_dssp             HHHHHHHHHTHHHHHHHHTGGGGGGCSEEEETGGGCHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHhHHHHHHHhhhhHhcCCEEEeCCCccHHHHHHHHHHHHHHh
Confidence            999999999999999999999999999999999888999999999999887
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1bd3a_ c.61.1.1 (A:) Uracil PRTase, Upp {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1xtta1 c.61.1.1 (A:2-216) Uracil PRTase, Upp {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1o5oa_ c.61.1.1 (A:) Uracil PRTase, Upp {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1v9sa1 c.61.1.1 (A:1-208) Uracil PRTase, Upp {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1i5ea_ c.61.1.1 (A:) Uracil PRTase, Upp {Bacillus caldolyticus [TaxId: 1394]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure