Citrus Sinensis ID: 027536

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220--

MKISSKTIQLFLYSLALLLSLAKTDPPPLQDFCIADTASPSSFYNNGVPCLNPNSAVSSHFVTSALAKPGKTSGNIFGFNATLTNTKNLPGVNTMGLTMARIDIAANGIVPPHTHPRASEVTICLKGALLVGFVDTLGRLFTQQLRPGDSFVFPKGLIHFLYNMDSSKPALALSGLSSQNPGLQMTSMATFASKPPIPDEVLKKAFQITRQDVSIIRKNLGG

ccccHHHHHHHHHHHHHHHHHHHccccccccCECccccccccccccccccccccccccccccccccccccccccccccEEEEEEccccccccccccCEEEEEEEccccccccccccccccEEEEEEcEEEEEEEcccccEEEEEEccccEEEECcccEEEEEcccccccEEEEEEcccccccccHHHHHHHcccccccHHHHHHHccccHHHHHHHHHHccc

*****KTIQLFLYSLALLLSLAKTDPPPLQDFCIADTASPSSFYNNGVPCLNPNSAVSSHFVTSALAKPGKTSGNIFGFNATLTNTKNLPGVNTMGLTMARIDIAANGIVPPHTHPRASEVTICLKGALLVGFVDTLGRLFTQQLRPGDSFVFPKGLIHFLYNMDSSKPALALSGLSSQNPGLQMTSMATFASKPPIPDEVLKKAFQITRQDVSIIRKNLG*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

SSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Germin-like protein subfamily 1 member 1	May play a role in plant defense. Probably has no oxalate oxidase activity even if the active site is conserved.	probable	P92998
Germin-like protein 3-1	May play a role in plant defense. Probably has no oxalate oxidase activity even if the active site is conserved.	probable	Q8H021
Germin-like protein 8-3	Plays role in broad-spectrum disease resistance. Probably has no oxalate oxidase activity even if the active site is conserved.	probable	Q6YZZ7

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1FI2, chain A
Confidence level:very confident
Coverage over the Query: 24-222
View the alignment between query and template
View the model in PyMOL