Citrus Sinensis ID: 027536


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220--
MKISSKTIQLFLYSLALLLSLAKTDPPPLQDFCIADTASPSSFYNNGVPCLNPNSAVSSHFVTSALAKPGKTSGNIFGFNATLTNTKNLPGVNTMGLTMARIDIAANGIVPPHTHPRASEVTICLKGALLVGFVDTLGRLFTQQLRPGDSFVFPKGLIHFLYNMDSSKPALALSGLSSQNPGLQMTSMATFASKPPIPDEVLKKAFQITRQDVSIIRKNLGG
ccccHHHHHHHHHHHHHHHHHHHccccccccCECccccccccccccccccccccccccccccccccccccccccccccEEEEEEccccccccccccCEEEEEEEccccccccccccccccEEEEEEcEEEEEEEcccccEEEEEEccccEEEECcccEEEEEcccccccEEEEEEcccccccccHHHHHHHcccccccHHHHHHHccccHHHHHHHHHHccc
*****KTIQLFLYSLALLLSLAKTDPPPLQDFCIADTASPSSFYNNGVPCLNPNSAVSSHFVTSALAKPGKTSGNIFGFNATLTNTKNLPGVNTMGLTMARIDIAANGIVPPHTHPRASEVTICLKGALLVGFVDTLGRLFTQQLRPGDSFVFPKGLIHFLYNMDSSKPALALSGLSSQNPGLQMTSMATFASKPPIPDEVLKKAFQITRQDVSIIRKNLG*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKISSKTIQLFLYSLALLLSLAKTDPPPLQDFCIADTASPSSFYNNGVPCLNPNSAVSSHFVTSALAKPGKTSGNIFGFNATLTNTKNLPGVNTMGLTMARIDIAANGIVPPHTHPRASEVTICLKGALLVGFVDTLGRLFTQQLRPGDSFVFPKGLIHFLYNMDSSKPALALSGLSSQNPGLQMTSMATFASKPPIPDEVLKKAFQITRQDVSIIRKNLGG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Germin-like protein subfamily 1 member 1 May play a role in plant defense. Probably has no oxalate oxidase activity even if the active site is conserved.probableP92998
Germin-like protein 3-1 May play a role in plant defense. Probably has no oxalate oxidase activity even if the active site is conserved.probableQ8H021
Germin-like protein 8-3 Plays role in broad-spectrum disease resistance. Probably has no oxalate oxidase activity even if the active site is conserved.probableQ6YZZ7

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1FI2, chain A
Confidence level:very confident
Coverage over the Query: 24-222
View the alignment between query and template
View the model in PyMOL