Citrus Sinensis ID: 027536


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220--
MKISSKTIQLFLYSLALLLSLAKTDPPPLQDFCIADTASPSSFYNNGVPCLNPNSAVSSHFVTSALAKPGKTSGNIFGFNATLTNTKNLPGVNTMGLTMARIDIAANGIVPPHTHPRASEVTICLKGALLVGFVDTLGRLFTQQLRPGDSFVFPKGLIHFLYNMDSSKPALALSGLSSQNPGLQMTSMATFASKPPIPDEVLKKAFQITRQDVSIIRKNLGG
ccccHHHHHHHHHHHHHHHHHHHccccccccEEEccccccccccccccccccccccccccccccccccccccccccccEEEEEEccccccccccccEEEEEEEEccccccccccccccccEEEEEEcEEEEEEEcccccEEEEEEccccEEEEEcccEEEEEcccccccEEEEEEcccccccccHHHHHHHcccccccHHHHHHHccccHHHHHHHHHHccc
ccHHHHHHHHHHHHHHHHHHHHHcccccccccccEcccccccEEEccccccccHHHccccccccccccccccccccccEEEEEEcccccHHHcccccEEEEEEEccccEEEEEEcccccEEEEEEEcEEEEEEEccHcEEEEEEEccccEEEEcccEEEEEEcccccccEEEEEEcccccccHHEHHHHHHcccccccHHHHHHHHHccHHHHHHHHHHHcc
MKISSKTIQLFLYSLALLLSlaktdppplqdfciadtaspssfynngvpclnpnsavssHFVTSalakpgktsgnifgfnatltntknlpgvntmglTMARIDIaangivpphthpraseVTICLKGALLVGFVDTLGRLftqqlrpgdsfvfpkgLIHFLYnmdsskpalalsglssqnpglqmtsmatfaskppipdevLKKAFQITRQDVSIIRKNLGG
MKISSKTIQLFLYSLALLLSLAKTDPPPLQDFCIADTASPSSFYNNGVPCLNPNSAVSSHFVTSALAKPGKTSGNIFGFNatltntknlpGVNTMGLTMARIDIAANGIVPPHTHPRASEVTICLKGALLVGFVDTLGRLFTQQLRPGDSFVFPKGLIHFLYNMDSSKPALALSGLSSQNPGLQMTSMATFASKPPIPDEVLKKAFQITRQDVSIIRKNLGG
MKISSKTIQlflyslalllslaKTDPPPLQDFCIADTASPSSFYNNGVPCLNPNSAVSSHFVTSALAKPGKTSGNIFGFNATLTNTKNLPGVNTMGLTMARIDIAANGIVPPHTHPRASEVTICLKGALLVGFVDTLGRLFTQQLRPGDSFVFPKGLIHFLYNMDSSKPALALSGLSSQNPGLQMTSMATFASKPPIPDEVLKKAFQITRQDVSIIRKNLGG
******TIQLFLYSLALLLSLAKTDPPPLQDFCIADTASPSSFYNNGVPCLNPNSAVSSHFVTSALAKPGKTSGNIFGFNATLTNTKNLPGVNTMGLTMARIDIAANGIVPPHTHPRASEVTICLKGALLVGFVDTLGRLFTQQLRPGDSFVFPKGLIHFLYNM****************************************AFQIT*************
*****KT*QLFLYSLALLLSLAKTDPPPLQDFCIADTASPSSFYNNGVPCLNPNSAVSSHFVTSALAKPGKTSGNIFGFNATLTNTKNLPGVNTMGLTMARIDIAANGIVPPHTHPRASEVTICLKGALLVGFVDTLGRLFTQQLRPGDSFVFPKGLIHFLYNMDSSKPALALSGLSSQNPGLQMTSMATFASKPPIPDEVLKKAFQITRQDVSIIRKNLG*
MKISSKTIQLFLYSLALLLSLAKTDPPPLQDFCIADTASPSSFYNNGVPCLNPNSAVSSHFVTSALAKPGKTSGNIFGFNATLTNTKNLPGVNTMGLTMARIDIAANGIVPPHTHPRASEVTICLKGALLVGFVDTLGRLFTQQLRPGDSFVFPKGLIHFLYNMDSSKPALALSGLSSQNPGLQMTSMATFASKPPIPDEVLKKAFQITRQDVSIIRKNLGG
*KISSKTIQLFLYSLALLLSLAKTDPPPLQDFCIADTASPSSFYNNGVPCLNPNSAVSSHFVTSALAKPGKTSGNIFGFNATLTNTKNLPGVNTMGLTMARIDIAANGIVPPHTHPRASEVTICLKGALLVGFVDTLGRLFTQQLRPGDSFVFPKGLIHFLYNMDSSKPALALSGLSSQNPGLQMTSMATFASKPPIPDEVLKKAFQITRQDVSIIRKNLG*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKISSKTIQLFLYSLALLLSLAKTDPPPLQDFCIADTASPSSFYNNGVPCLNPNSAVSSHFVTSALAKPGKTSGNIFGFNATLTNTKNLPGVNTMGLTMARIDIAANGIVPPHTHPRASEVTICLKGALLVGFVDTLGRLFTQQLRPGDSFVFPKGLIHFLYNMDSSKPALALSGLSSQNPGLQMTSMATFASKPPIPDEVLKKAFQITRQDVSIIRKNLGG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query222 2.2.26 [Sep-21-2011]
P92998217 Germin-like protein subfa yes no 0.905 0.926 0.594 1e-64
Q8H021225 Germin-like protein 3-1 O yes no 0.950 0.937 0.530 3e-59
Q6YZZ7225 Germin-like protein 8-3 O yes no 0.860 0.848 0.484 2e-46
Q6YZZ6224 Germin-like protein 8-4 O no no 0.860 0.852 0.479 3e-46
Q6YZB2219 Putative germin-like prot no no 0.905 0.917 0.454 9e-46
Q6YZA6224 Germin-like protein 8-5 O no no 0.855 0.848 0.497 1e-45
Q6YZ99224 Germin-like protein 8-9 O no no 0.950 0.941 0.474 2e-45
Q6YZA9221 Germin-like protein 8-2 O no no 0.864 0.868 0.464 2e-45
Q6YZY5224 Germin-like protein 8-11 no no 0.855 0.848 0.492 4e-45
Q6YZA4225 Germin-like protein 8-6 O no no 0.855 0.844 0.492 4e-45
>sp|P92998|GL11_ARATH Germin-like protein subfamily 1 member 1 OS=Arabidopsis thaliana GN=GLP7 PE=2 SV=2 Back     alignment and function desciption
 Score =  246 bits (627), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 120/202 (59%), Positives = 150/202 (74%), Gaps = 1/202 (0%)

Query: 22  AKTDPPPLQDFCIADT-ASPSSFYNNGVPCLNPNSAVSSHFVTSALAKPGKTSGNIFGFN 80
            K+DP PLQD+C++   +S    + NG  C +P  A  S F TSAL++PG T    F  N
Sbjct: 16  VKSDPDPLQDYCVSPPPSSHQQIFLNGKLCKDPTQASVSDFSTSALSRPGNTKTKPFMIN 75

Query: 81  ATLTNTKNLPGVNTMGLTMARIDIAANGIVPPHTHPRASEVTICLKGALLVGFVDTLGRL 140
            T+T T NLPG+NT+GLTMAR+D   +G+VPPH HPRASEVT+CL G LLVGFVDT GR+
Sbjct: 76  VTVTTTANLPGLNTVGLTMARLDFGGSGVVPPHVHPRASEVTVCLDGVLLVGFVDTSGRV 135

Query: 141 FTQQLRPGDSFVFPKGLIHFLYNMDSSKPALALSGLSSQNPGLQMTSMATFASKPPIPDE 200
           FTQ+L PG++FVFPKGLIHFLYN+D+   ALA+SGLSSQNPG Q+ S+++F SKPP   E
Sbjct: 136 FTQELHPGETFVFPKGLIHFLYNIDTVSSALAVSGLSSQNPGTQIVSLSSFISKPPFLVE 195

Query: 201 VLKKAFQITRQDVSIIRKNLGG 222
           VLK A+ I  QDV+ IRK+L G
Sbjct: 196 VLKSAYDINGQDVARIRKSLEG 217




May play a role in plant defense. Probably has no oxalate oxidase activity even if the active site is conserved.
Arabidopsis thaliana (taxid: 3702)
>sp|Q8H021|GL31_ORYSJ Germin-like protein 3-1 OS=Oryza sativa subsp. japonica GN=Os03g0179000 PE=2 SV=1 Back     alignment and function description
>sp|Q6YZZ7|GL83_ORYSJ Germin-like protein 8-3 OS=Oryza sativa subsp. japonica GN=GER2 PE=2 SV=1 Back     alignment and function description
>sp|Q6YZZ6|GL84_ORYSJ Germin-like protein 8-4 OS=Oryza sativa subsp. japonica GN=GER1 PE=2 SV=1 Back     alignment and function description
>sp|Q6YZB2|GL81_ORYSJ Putative germin-like protein 8-1 OS=Oryza sativa subsp. japonica GN=Os08g0188900 PE=3 SV=1 Back     alignment and function description
>sp|Q6YZA6|GL85_ORYSJ Germin-like protein 8-5 OS=Oryza sativa subsp. japonica GN=Os08g0189400 PE=2 SV=1 Back     alignment and function description
>sp|Q6YZ99|GL89_ORYSJ Germin-like protein 8-9 OS=Oryza sativa subsp. japonica GN=Os08g0189850 PE=2 SV=1 Back     alignment and function description
>sp|Q6YZA9|GL82_ORYSJ Germin-like protein 8-2 OS=Oryza sativa subsp. japonica GN=GER3 PE=2 SV=1 Back     alignment and function description
>sp|Q6YZY5|GL811_ORYSJ Germin-like protein 8-11 OS=Oryza sativa subsp. japonica GN=Os08g0190100 PE=1 SV=1 Back     alignment and function description
>sp|Q6YZA4|GL86_ORYSJ Germin-like protein 8-6 OS=Oryza sativa subsp. japonica GN=Os08g0189500 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query222
225424801221 PREDICTED: germin-like protein 3-1 [Viti 0.995 1.0 0.680 7e-81
359806194220 germin-like protein subfamily 1 member 1 0.945 0.954 0.671 8e-80
351725953220 uncharacterized protein LOC100500154 pre 0.945 0.954 0.666 2e-79
357486287221 Germin-like protein subfamily 1 member [ 0.882 0.886 0.688 3e-75
255558354218 Nectarin-1 precursor, putative [Ricinus 0.896 0.912 0.691 5e-75
388517139221 unknown [Medicago truncatula] 0.882 0.886 0.683 9e-75
224102657220 predicted protein [Populus trichocarpa] 0.891 0.9 0.65 9e-73
449458015224 PREDICTED: germin-like protein subfamily 0.918 0.910 0.593 9e-69
388501126213 unknown [Lotus japonicus] 0.828 0.863 0.679 9e-69
449505687224 PREDICTED: germin-like protein subfamily 0.918 0.910 0.593 1e-68
>gi|225424801|ref|XP_002271090.1| PREDICTED: germin-like protein 3-1 [Vitis vinifera] gi|296086484|emb|CBI32073.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  305 bits (782), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 151/222 (68%), Positives = 179/222 (80%), Gaps = 1/222 (0%)

Query: 1   MKISSKTIQLFLYSLALLLSLAKTDPPPLQDFCIADTASPSSFYNNGVPCLNPNSAVSSH 60
           M+ +S   +LF+ ++ALL  L K DP PLQD+CIADT +  +F+ NGVPC++P  A  SH
Sbjct: 1   MRTASTLPKLFI-AIALLSGLVKPDPDPLQDYCIADTKASKAFFINGVPCIDPQLAQVSH 59

Query: 61  FVTSALAKPGKTSGNIFGFNATLTNTKNLPGVNTMGLTMARIDIAANGIVPPHTHPRASE 120
           F TSAL+KPG TS N FGF+ TLTNT NLPG NTMGLTMAR DIAANG+VP H+HPRASE
Sbjct: 60  FTTSALSKPGNTSANPFGFSITLTNTMNLPGFNTMGLTMARADIAANGLVPLHSHPRASE 119

Query: 121 VTICLKGALLVGFVDTLGRLFTQQLRPGDSFVFPKGLIHFLYNMDSSKPALALSGLSSQN 180
           V   LKGALLVGF+DT  RLFTQ LRPGDSFVFPKG+IHFLYN+DS  PA+ L+GL+SQN
Sbjct: 120 VATLLKGALLVGFIDTSNRLFTQLLRPGDSFVFPKGMIHFLYNLDSLAPAVVLAGLNSQN 179

Query: 181 PGLQMTSMATFASKPPIPDEVLKKAFQITRQDVSIIRKNLGG 222
           PG Q+TS A FA+ P +PDEVLKKAFQI+ QDV+ IR+NLGG
Sbjct: 180 PGTQLTSTAAFATNPRLPDEVLKKAFQISGQDVARIRRNLGG 221




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359806194|ref|NP_001241459.1| germin-like protein subfamily 1 member 1-like precursor [Glycine max] gi|196122014|gb|ACG69481.1| germin-like protein 5 [Glycine max] Back     alignment and taxonomy information
>gi|351725953|ref|NP_001237622.1| uncharacterized protein LOC100500154 precursor [Glycine max] gi|255629478|gb|ACU15085.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|357486287|ref|XP_003613431.1| Germin-like protein subfamily 1 member [Medicago truncatula] gi|355514766|gb|AES96389.1| Germin-like protein subfamily 1 member [Medicago truncatula] Back     alignment and taxonomy information
>gi|255558354|ref|XP_002520204.1| Nectarin-1 precursor, putative [Ricinus communis] gi|223540696|gb|EEF42259.1| Nectarin-1 precursor, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|388517139|gb|AFK46631.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|224102657|ref|XP_002312767.1| predicted protein [Populus trichocarpa] gi|222852587|gb|EEE90134.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449458015|ref|XP_004146743.1| PREDICTED: germin-like protein subfamily 1 member 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|388501126|gb|AFK38629.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|449505687|ref|XP_004162541.1| PREDICTED: germin-like protein subfamily 1 member 1-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query222
TAIR|locus:2194569217 GLP7 "germin-like protein 7" [ 0.900 0.921 0.597 2.1e-61
TAIR|locus:2012260219 GLP5 "germin-like protein 5" [ 0.851 0.863 0.450 1.2e-40
TAIR|locus:2130020222 GLP9 "germin-like protein 9" [ 0.860 0.860 0.445 8.7e-40
TAIR|locus:2074514229 AT3G05950 [Arabidopsis thalian 0.837 0.812 0.461 9.9e-39
TAIR|locus:2157200222 AT5G39160 [Arabidopsis thalian 0.846 0.846 0.446 2.1e-38
TAIR|locus:2157230222 GER2 "germin-like protein 2" [ 0.846 0.846 0.446 2.6e-38
TAIR|locus:2177167222 AT5G39130 [Arabidopsis thalian 0.873 0.873 0.44 3.4e-38
TAIR|locus:2177157221 AT5G39120 [Arabidopsis thalian 0.846 0.850 0.428 5.5e-38
TAIR|locus:2177187221 AT5G39150 [Arabidopsis thalian 0.846 0.850 0.428 5.5e-38
TAIR|locus:2157220221 AT5G39180 [Arabidopsis thalian 0.846 0.850 0.428 7e-38
TAIR|locus:2194569 GLP7 "germin-like protein 7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 628 (226.1 bits), Expect = 2.1e-61, P = 2.1e-61
 Identities = 120/201 (59%), Positives = 150/201 (74%)

Query:    23 KTDPPPLQDFCIADT-ASPSSFYNNGVPCLNPNSAVSSHFVTSALAKPGKTSGNIFGFNA 81
             K+DP PLQD+C++   +S    + NG  C +P  A  S F TSAL++PG T    F  N 
Sbjct:    17 KSDPDPLQDYCVSPPPSSHQQIFLNGKLCKDPTQASVSDFSTSALSRPGNTKTKPFMINV 76

Query:    82 TLTNTKNLPGVNTMGLTMARIDIAANGIVPPHTHPRASEVTICLKGALLVGFVDTLGRLF 141
             T+T T NLPG+NT+GLTMAR+D   +G+VPPH HPRASEVT+CL G LLVGFVDT GR+F
Sbjct:    77 TVTTTANLPGLNTVGLTMARLDFGGSGVVPPHVHPRASEVTVCLDGVLLVGFVDTSGRVF 136

Query:   142 TQQLRPGDSFVFPKGLIHFLYNMDSSKPALALSGLSSQNPGLQMTSMATFASKPPIPDEV 201
             TQ+L PG++FVFPKGLIHFLYN+D+   ALA+SGLSSQNPG Q+ S+++F SKPP   EV
Sbjct:   137 TQELHPGETFVFPKGLIHFLYNIDTVSSALAVSGLSSQNPGTQIVSLSSFISKPPFLVEV 196

Query:   202 LKKAFQITRQDVSIIRKNLGG 222
             LK A+ I  QDV+ IRK+L G
Sbjct:   197 LKSAYDINGQDVARIRKSLEG 217




GO:0005576 "extracellular region" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0030145 "manganese ion binding" evidence=IEA
GO:0045735 "nutrient reservoir activity" evidence=IEA
GO:0048046 "apoplast" evidence=IEA
TAIR|locus:2012260 GLP5 "germin-like protein 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2130020 GLP9 "germin-like protein 9" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2074514 AT3G05950 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2157200 AT5G39160 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2157230 GER2 "germin-like protein 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2177167 AT5G39130 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2177157 AT5G39120 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2177187 AT5G39150 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2157220 AT5G39180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6YZZ7GL83_ORYSJNo assigned EC number0.48450.86030.8488yesno
Q8H021GL31_ORYSJNo assigned EC number0.53020.95040.9377yesno
P92998GL11_ARATHNo assigned EC number0.59400.90540.9262yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.13.11.24LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query222
smart00835146 smart00835, Cupin_1, Cupin 5e-35
pfam00190139 pfam00190, Cupin_1, Cupin 8e-31
COG1917131 COG1917, COG1917, Uncharacterized conserved protei 5e-11
pfam0788370 pfam07883, Cupin_2, Cupin domain 8e-10
TIGR03404 367 TIGR03404, bicupin_oxalic, bicupin, oxalate decarb 2e-06
COG0662127 COG0662, {ManC}, Mannose-6-phosphate isomerase [Ca 4e-05
PLN00212493 PLN00212, PLN00212, glutelin; Provisional 6e-05
>gnl|CDD|214845 smart00835, Cupin_1, Cupin Back     alignment and domain information
 Score =  121 bits (305), Expect = 5e-35
 Identities = 45/147 (30%), Positives = 75/147 (51%), Gaps = 4/147 (2%)

Query: 68  KPGKTSGNIFGFNATLTNTKNLPGVNTMGLTMARIDIAANGIVPPHTHPRASEVTICLKG 127
           +P     N  G      +  N P +N +G++ AR+++   G++PPH HPRA+E+   ++G
Sbjct: 2   EPRPDFSNEGGR-LREADPTNFPALNGLGISAARVNLEPGGMLPPHYHPRATELLYVVRG 60

Query: 128 ALLVGFVDTLG-RLFTQQLRPGDSFVFPKGLIHFLYNMDSSKPALALSGLSSQNPGLQMT 186
              VG VD  G +++  +LR GD FV P+G  HF  N  S    L     ++ +P  +  
Sbjct: 61  EGRVGVVDPNGNKVYDARLREGDVFVVPQGHPHFQVN--SGDENLEFVAFNTNDPNRRFF 118

Query: 187 SMATFASKPPIPDEVLKKAFQITRQDV 213
                +    +P EVL  AF ++ ++V
Sbjct: 119 LAGRNSVLRGLPPEVLAAAFGVSAEEV 145


This family represents the conserved barrel domain of the 'cupin' superfamily ('cupa' is the Latin term for a small barrel). This family contains 11S and 7S plant seed storage proteins, and germins. Plant seed storage proteins provide the major nitrogen source for the developing plant. Length = 146

>gnl|CDD|215780 pfam00190, Cupin_1, Cupin Back     alignment and domain information
>gnl|CDD|224829 COG1917, COG1917, Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] Back     alignment and domain information
>gnl|CDD|219618 pfam07883, Cupin_2, Cupin domain Back     alignment and domain information
>gnl|CDD|132445 TIGR03404, bicupin_oxalic, bicupin, oxalate decarboxylase family Back     alignment and domain information
>gnl|CDD|223734 COG0662, {ManC}, Mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|215106 PLN00212, PLN00212, glutelin; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 222
TIGR03404367 bicupin_oxalic bicupin, oxalate decarboxylase fami 99.96
PLN00212493 glutelin; Provisional 99.95
PF00190144 Cupin_1: Cupin; InterPro: IPR006045 This family re 99.92
TIGR03404 367 bicupin_oxalic bicupin, oxalate decarboxylase fami 99.91
smart00835146 Cupin_1 Cupin. This family represents the conserve 99.87
PLN00212 493 glutelin; Provisional 99.85
COG2140209 Thermophilic glucose-6-phosphate isomerase and rel 99.79
PF0788371 Cupin_2: Cupin domain; InterPro: IPR013096 This fa 99.49
COG1917131 Uncharacterized conserved protein, contains double 99.42
COG0662127 {ManC} Mannose-6-phosphate isomerase [Carbohydrate 99.4
PRK04190191 glucose-6-phosphate isomerase; Provisional 99.34
PRK13290125 ectC L-ectoine synthase; Reviewed 99.34
COG3837161 Uncharacterized conserved protein, contains double 99.14
TIGR01479468 GMP_PMI mannose-1-phosphate guanylyltransferase/ma 99.14
PRK11171266 hypothetical protein; Provisional 99.14
PRK09943185 DNA-binding transcriptional repressor PuuR; Provis 99.12
COG4101142 Predicted mannose-6-phosphate isomerase [Carbohydr 99.11
PRK15460478 cpsB mannose-1-phosphate guanyltransferase; Provis 99.1
PF01050151 MannoseP_isomer: Mannose-6-phosphate isomerase; In 99.06
TIGR03214260 ura-cupin putative allantoin catabolism protein. T 99.02
PRK11171266 hypothetical protein; Provisional 98.91
TIGR03214260 ura-cupin putative allantoin catabolism protein. T 98.91
PF02041167 Auxin_BP: Auxin binding protein; InterPro: IPR0005 98.8
PF06560182 GPI: Glucose-6-phosphate isomerase (GPI); InterPro 98.74
PRK13264177 3-hydroxyanthranilate 3,4-dioxygenase; Provisional 98.72
TIGR03037159 anthran_nbaC 3-hydroxyanthranilate 3,4-dioxygenase 98.65
PF1169985 CENP-C_C: Mif2/CENP-C like; PDB: 2VPV_B. 98.53
PF02311136 AraC_binding: AraC-like ligand binding domain; Int 98.52
PF1297391 Cupin_7: ChrR Cupin-like domain; PDB: 3O14_B 2Z2S_ 98.43
PRK10371 302 DNA-binding transcriptional regulator MelR; Provis 98.38
PF03079157 ARD: ARD/ARD' family; InterPro: IPR004313 The two 98.38
TIGR02451215 anti_sig_ChrR anti-sigma factor, putative, ChrR fa 98.3
PRK15457233 ethanolamine utilization protein EutQ; Provisional 98.28
COG4297163 Uncharacterized protein containing double-stranded 98.28
COG1791181 Uncharacterized conserved protein, contains double 98.18
PRK10296 278 DNA-binding transcriptional regulator ChbR; Provis 98.16
TIGR02272 335 gentisate_1_2 gentisate 1,2-dioxygenase. This fami 98.11
PRK13501 290 transcriptional activator RhaR; Provisional 98.11
PF06339126 Ectoine_synth: Ectoine synthase; InterPro: IPR0104 98.05
PRK13500 312 transcriptional activator RhaR; Provisional 98.04
TIGR02297 287 HpaA 4-hydroxyphenylacetate catabolism regulatory 98.02
PF05523131 FdtA: WxcM-like, C-terminal ; InterPro: IPR008894 97.92
PF14499251 DUF4437: Domain of unknown function (DUF4437); PDB 97.9
PRK13503 278 transcriptional activator RhaS; Provisional 97.89
PRK13502 282 transcriptional activator RhaR; Provisional 97.89
KOG2107179 consensus Uncharacterized conserved protein, conta 97.86
PF06052151 3-HAO: 3-hydroxyanthranilic acid dioxygenase; Inte 97.82
PF0589974 Cupin_3: Protein of unknown function (DUF861); Int 97.78
COG3257264 GlxB Uncharacterized protein, possibly involved in 97.75
COG3435 351 Gentisate 1,2-dioxygenase [Secondary metabolites b 97.68
TIGR02272335 gentisate_1_2 gentisate 1,2-dioxygenase. This fami 97.55
PF06249152 EutQ: Ethanolamine utilisation protein EutQ; Inter 97.48
COG1898173 RfbC dTDP-4-dehydrorhamnose 3,5-epimerase and rela 97.21
COG4766176 EutQ Ethanolamine utilization protein [Amino acid 97.06
COG3450116 Predicted enzyme of the cupin superfamily [General 97.02
TIGR01221176 rmlC dTDP-4-dehydrorhamnose 3,5-epimerase. This en 96.83
PF05995175 CDO_I: Cysteine dioxygenase type I; InterPro: IPR0 96.74
PF00908176 dTDP_sugar_isom: dTDP-4-dehydrorhamnose 3,5-epimer 96.69
COG3435351 Gentisate 1,2-dioxygenase [Secondary metabolites b 96.66
PF13621251 Cupin_8: Cupin-like domain; PDB: 3AL6_C 3AL5_C 2XU 96.23
PRK10572 290 DNA-binding transcriptional regulator AraC; Provis 95.6
PF08007319 Cupin_4: Cupin superfamily protein; InterPro: IPR0 95.33
PF04209 424 HgmA: homogentisate 1,2-dioxygenase; InterPro: IPR 95.31
PF12852186 Cupin_6: Cupin 95.26
PF14499251 DUF4437: Domain of unknown function (DUF4437); PDB 95.14
PRK05341 438 homogentisate 1,2-dioxygenase; Provisional 95.05
PF02678107 Pirin: Pirin; InterPro: IPR003829 This entry repre 95.04
PLN02658 435 homogentisate 1,2-dioxygenase 94.58
PF05118163 Asp_Arg_Hydrox: Aspartyl/Asparaginyl beta-hydroxyl 94.51
PRK09685 302 DNA-binding transcriptional activator FeaR; Provis 94.43
TIGR01015 429 hmgA homogentisate 1,2-dioxygenase. Missing in hum 94.41
KOG3995 279 consensus 3-hydroxyanthranilate oxygenase HAAO [Am 94.38
COG3806216 ChrR Transcriptional activator [Transcription] 94.38
PF07385225 DUF1498: Protein of unknown function (DUF1498); In 94.13
COG1741 276 Pirin-related protein [General function prediction 94.06
PF0686594 DUF1255: Protein of unknown function (DUF1255); In 93.96
COG3257264 GlxB Uncharacterized protein, possibly involved in 93.94
PRK00924276 5-keto-4-deoxyuronate isomerase; Provisional 93.86
PF02373114 JmjC: JmjC domain, hydroxylase; InterPro: IPR01312 93.84
PF13759101 2OG-FeII_Oxy_5: Putative 2OG-Fe(II) oxygenase; PDB 93.81
PRK12335 287 tellurite resistance protein TehB; Provisional 93.74
PRK1057994 hypothetical protein; Provisional 93.61
KOG3706 629 consensus Uncharacterized conserved protein [Funct 93.49
PF07847200 DUF1637: Protein of unknown function (DUF1637); In 92.75
COG5553191 Predicted metal-dependent enzyme of the double-str 92.72
TIGR02466201 conserved hypothetical protein. This family consis 92.58
COG3508 427 HmgA Homogentisate 1,2-dioxygenase [Secondary meta 92.13
PRK15131389 mannose-6-phosphate isomerase; Provisional 91.48
PF14525172 AraC_binding_2: AraC-binding-like domain 90.76
COG3822225 ABC-type sugar transport system, auxiliary compone 90.62
TIGR00218302 manA mannose-6-phosphate isomerase, class I. The n 90.58
PF0931382 DUF1971: Domain of unknown function (DUF1971); Int 90.5
PLN02288394 mannose-6-phosphate isomerase 90.35
PF1114263 DUF2917: Protein of unknown function (DUF2917); In 90.29
KOG2757411 consensus Mannose-6-phosphate isomerase [Carbohydr 89.22
PF05726104 Pirin_C: Pirin C-terminal cupin domain; InterPro: 89.14
COG2850 383 Uncharacterized conserved protein [Function unknow 87.64
PRK09391230 fixK transcriptional regulator FixK; Provisional 87.55
PF0717295 GRP: Glycine rich protein family; InterPro: IPR010 87.46
PF0002791 cNMP_binding: Cyclic nucleotide-binding domain; In 86.21
PF06172139 Cupin_5: Cupin superfamily (DUF985); InterPro: IPR 85.76
PRK11753211 DNA-binding transcriptional dual regulator Crp; Pr 84.27
PRK13918202 CRP/FNR family transcriptional regulator; Provisio 84.22
PF04622216 ERG2_Sigma1R: ERG2 and Sigma1 receptor like protei 82.49
PRK00924 276 5-keto-4-deoxyuronate isomerase; Provisional 82.22
PF04962261 KduI: KduI/IolB family; InterPro: IPR021120 The Kd 81.35
>TIGR03404 bicupin_oxalic bicupin, oxalate decarboxylase family Back     alignment and domain information
Probab=99.96  E-value=1.4e-27  Score=217.46  Aligned_cols=159  Identities=16%  Similarity=0.238  Sum_probs=143.2

Q ss_pred             CCCCCCcCCCeEeeccCCCCCCcCCcCCcEEEEeccCCCCCccccceEEEEEEEcCCcccCCccCCCCcEEEEEEeCeEE
Q 027536           51 LNPNSAVSSHFVTSALAKPGKTSGNIFGFNATLTNTKNLPGVNTMGLTMARIDIAANGIVPPHTHPRASEVTICLKGALL  130 (222)
Q Consensus        51 k~~~~v~~~dF~f~~l~~~~~~~~~~~g~~v~~~~~~~fP~l~~lgis~~~v~l~pGg~~~pH~H~~a~Ei~yVl~G~~~  130 (222)
                      +.+..-.++.|.|+....++.   ...||+++.+++.+||+++  ++++++++++||++.++|||++++|++||++|+++
T Consensus       204 ~~~~~~~~~~~~~~~~~~~p~---~~~gG~~~~~~~~~~p~~~--~~s~~~~~l~PG~~~~~H~H~~~~E~~yvl~G~~~  278 (367)
T TIGR03404       204 TGPAGEVPGPFTYHLSEQKPK---QVPGGTVRIADSTNFPVSK--TIAAAIVTVEPGAMRELHWHPNADEWQYFIQGQAR  278 (367)
T ss_pred             cCCCCCCCccEEEEhhhCCce---ecCCceEEEEChhhccCcc--eEEEEEEEECCCCccCCeeCcCCCeEEEEEEEEEE
Confidence            344555566799998777764   4678999999999999988  49999999999999999999999999999999999


Q ss_pred             EEEEecCCcEEEEEECCCCEEEEcCCCeeEEEecCCCCCEEEEEEEeCCCCCcccchhhhhcCCCCCCHHHHHHHcCCCH
Q 027536          131 VGFVDTLGRLFTQQLRPGDSFVFPKGLIHFLYNMDSSKPALALSGLSSQNPGLQMTSMATFASKPPIPDEVLKKAFQITR  210 (222)
Q Consensus       131 ~~~v~~~~~~~~~~L~~GDv~viP~G~~H~~~N~g~~~~a~~i~~~~s~~pg~~~~~~~~f~~~~~ip~~vla~af~~~~  210 (222)
                      +++.+++++.....+++||+++||+|..|+++|.| +++++++++|++..++.+.++ +|++   .+|++||+++|+++.
T Consensus       279 ~~v~d~~g~~~~~~l~~GD~~~iP~g~~H~i~N~G-~e~l~fL~if~s~~~~~i~l~-~~l~---~~p~~vl~~~~~~~~  353 (367)
T TIGR03404       279 MTVFAAGGNARTFDYQAGDVGYVPRNMGHYVENTG-DETLVFLEVFKADRFADVSLN-QWLA---LTPPQLVAAHLNLDD  353 (367)
T ss_pred             EEEEecCCcEEEEEECCCCEEEECCCCeEEEEECC-CCCEEEEEEECCCCCceeEHH-HHHh---hCCHHHHHHHhCcCH
Confidence            99998877766789999999999999999999999 999999999999999999886 6777   699999999999999


Q ss_pred             HHHHHHHHh
Q 027536          211 QDVSIIRKN  219 (222)
Q Consensus       211 ~~v~~l~~~  219 (222)
                      +++++|++.
T Consensus       354 ~~~~~l~~~  362 (367)
T TIGR03404       354 EVIDSLKKE  362 (367)
T ss_pred             HHHHhcccc
Confidence            999999864



Members of this protein family are defined as bicupins as they have two copies of the cupin domain (pfam00190). Two different known activities for members of this family are oxalate decarboxylase (EC 4.1.1.2) and oxalate oxidase (EC 1.2.3.4), although the latter activity has more often been found in distantly related monocupin (germin) proteins.

>PLN00212 glutelin; Provisional Back     alignment and domain information
>PF00190 Cupin_1: Cupin; InterPro: IPR006045 This family represents the conserved barrel domain of the 'cupin' superfamily ('cupa' is the Latin term for a small barrel) Back     alignment and domain information
>TIGR03404 bicupin_oxalic bicupin, oxalate decarboxylase family Back     alignment and domain information
>smart00835 Cupin_1 Cupin Back     alignment and domain information
>PLN00212 glutelin; Provisional Back     alignment and domain information
>COG2140 Thermophilic glucose-6-phosphate isomerase and related metalloenzymes [Carbohydrate transport and metabolism / General function prediction only] Back     alignment and domain information
>PF07883 Cupin_2: Cupin domain; InterPro: IPR013096 This family represents the conserved barrel domain of the cupin superfamily [] (cupa is the Latin term for a small barrel) Back     alignment and domain information
>COG1917 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] Back     alignment and domain information
>COG0662 {ManC} Mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK04190 glucose-6-phosphate isomerase; Provisional Back     alignment and domain information
>PRK13290 ectC L-ectoine synthase; Reviewed Back     alignment and domain information
>COG3837 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] Back     alignment and domain information
>TIGR01479 GMP_PMI mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase Back     alignment and domain information
>PRK11171 hypothetical protein; Provisional Back     alignment and domain information
>PRK09943 DNA-binding transcriptional repressor PuuR; Provisional Back     alignment and domain information
>COG4101 Predicted mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK15460 cpsB mannose-1-phosphate guanyltransferase; Provisional Back     alignment and domain information
>PF01050 MannoseP_isomer: Mannose-6-phosphate isomerase; InterPro: IPR001538 Mannose-6-phosphate isomerase or phosphomannose isomerase (5 Back     alignment and domain information
>TIGR03214 ura-cupin putative allantoin catabolism protein Back     alignment and domain information
>PRK11171 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03214 ura-cupin putative allantoin catabolism protein Back     alignment and domain information
>PF02041 Auxin_BP: Auxin binding protein; InterPro: IPR000526 Auxin binding protein is located in the lumen of the endoplasmic reticulum (ER) Back     alignment and domain information
>PF06560 GPI: Glucose-6-phosphate isomerase (GPI); InterPro: IPR010551 This entry consists of several bacterial and archaeal glucose-6-phosphate isomerase (GPI) proteins (5 Back     alignment and domain information
>PRK13264 3-hydroxyanthranilate 3,4-dioxygenase; Provisional Back     alignment and domain information
>TIGR03037 anthran_nbaC 3-hydroxyanthranilate 3,4-dioxygenase Back     alignment and domain information
>PF11699 CENP-C_C: Mif2/CENP-C like; PDB: 2VPV_B Back     alignment and domain information
>PF02311 AraC_binding: AraC-like ligand binding domain; InterPro: IPR003313 This entry defines the arabinose-binding and dimerisation domain of the bacterial gene regulatory protein AraC Back     alignment and domain information
>PF12973 Cupin_7: ChrR Cupin-like domain; PDB: 3O14_B 2Z2S_F 2Q1Z_B 3EBR_A Back     alignment and domain information
>PRK10371 DNA-binding transcriptional regulator MelR; Provisional Back     alignment and domain information
>PF03079 ARD: ARD/ARD' family; InterPro: IPR004313 The two acireductone dioxygenase enzymes (ARD and ARD', previously known as E-2 and E-2') from Klebsiella pneumoniae share the same amino acid sequence Q9ZFE7 from SWISSPROT, but bind different metal ions: ARD binds Ni2+, ARD' binds Fe2+ [] Back     alignment and domain information
>TIGR02451 anti_sig_ChrR anti-sigma factor, putative, ChrR family Back     alignment and domain information
>PRK15457 ethanolamine utilization protein EutQ; Provisional Back     alignment and domain information
>COG4297 Uncharacterized protein containing double-stranded beta helix domain [Function unknown] Back     alignment and domain information
>COG1791 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] Back     alignment and domain information
>PRK10296 DNA-binding transcriptional regulator ChbR; Provisional Back     alignment and domain information
>TIGR02272 gentisate_1_2 gentisate 1,2-dioxygenase Back     alignment and domain information
>PRK13501 transcriptional activator RhaR; Provisional Back     alignment and domain information
>PF06339 Ectoine_synth: Ectoine synthase; InterPro: IPR010462 This family consists of several bacterial ectoine synthase proteins Back     alignment and domain information
>PRK13500 transcriptional activator RhaR; Provisional Back     alignment and domain information
>TIGR02297 HpaA 4-hydroxyphenylacetate catabolism regulatory protein HpaA Back     alignment and domain information
>PF05523 FdtA: WxcM-like, C-terminal ; InterPro: IPR008894 This entry includes FdtA (Q6T1W8 from SWISSPROT) from Aneurinibacillus thermoaerophilus, which has been characterised as a dTDP-6-deoxy-3,4-keto-hexulose isomerase [] Back     alignment and domain information
>PF14499 DUF4437: Domain of unknown function (DUF4437); PDB: 2QDR_A Back     alignment and domain information
>PRK13503 transcriptional activator RhaS; Provisional Back     alignment and domain information
>PRK13502 transcriptional activator RhaR; Provisional Back     alignment and domain information
>KOG2107 consensus Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] Back     alignment and domain information
>PF06052 3-HAO: 3-hydroxyanthranilic acid dioxygenase; InterPro: IPR010329 Members of this protein family, from both bacteria and eukaryotes, are the enzyme 3-hydroxyanthranilate 3,4-dioxygenase (1 Back     alignment and domain information
>PF05899 Cupin_3: Protein of unknown function (DUF861); InterPro: IPR008579 The function of the proteins in this entry are unknown Back     alignment and domain information
>COG3257 GlxB Uncharacterized protein, possibly involved in glyoxylate utilization [General function prediction only] Back     alignment and domain information
>COG3435 Gentisate 1,2-dioxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR02272 gentisate_1_2 gentisate 1,2-dioxygenase Back     alignment and domain information
>PF06249 EutQ: Ethanolamine utilisation protein EutQ; InterPro: IPR010424 The eut operon of Salmonella typhimurium encodes proteins involved in the cobalamin-dependent degradation of ethanolamine Back     alignment and domain information
>COG1898 RfbC dTDP-4-dehydrorhamnose 3,5-epimerase and related enzymes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG4766 EutQ Ethanolamine utilization protein [Amino acid transport and metabolism] Back     alignment and domain information
>COG3450 Predicted enzyme of the cupin superfamily [General function prediction only] Back     alignment and domain information
>TIGR01221 rmlC dTDP-4-dehydrorhamnose 3,5-epimerase Back     alignment and domain information
>PF05995 CDO_I: Cysteine dioxygenase type I; InterPro: IPR010300 Cysteine dioxygenase type I (1 Back     alignment and domain information
>PF00908 dTDP_sugar_isom: dTDP-4-dehydrorhamnose 3,5-epimerase; InterPro: IPR000888 Deoxythymidine diphosphate (dTDP)-4-keto-6-deoxy-d-hexulose 3, 5-epimerase (RmlC, 5 Back     alignment and domain information
>COG3435 Gentisate 1,2-dioxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF13621 Cupin_8: Cupin-like domain; PDB: 3AL6_C 3AL5_C 2XUM_A 2Y0I_A 1MZE_A 3KCY_A 1MZF_A 1YCI_A 2ILM_A 1H2L_A Back     alignment and domain information
>PRK10572 DNA-binding transcriptional regulator AraC; Provisional Back     alignment and domain information
>PF08007 Cupin_4: Cupin superfamily protein; InterPro: IPR022777 This signature represents primarily the cupin fold found in JmjC transcription factors Back     alignment and domain information
>PF04209 HgmA: homogentisate 1,2-dioxygenase; InterPro: IPR005708 Alkaptonuria (AKU), a rare hereditary disorder, was the first disease to be interpreted as an inborn error of metabolism Back     alignment and domain information
>PF12852 Cupin_6: Cupin Back     alignment and domain information
>PF14499 DUF4437: Domain of unknown function (DUF4437); PDB: 2QDR_A Back     alignment and domain information
>PRK05341 homogentisate 1,2-dioxygenase; Provisional Back     alignment and domain information
>PF02678 Pirin: Pirin; InterPro: IPR003829 This entry represents N-terminal domain of Pirin proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>PLN02658 homogentisate 1,2-dioxygenase Back     alignment and domain information
>PF05118 Asp_Arg_Hydrox: Aspartyl/Asparaginyl beta-hydroxylase; InterPro: IPR007803 The alpha-ketoglutarate-dependent dioxygenase aspartyl (asparaginyl) beta-hydroxylase (1 Back     alignment and domain information
>PRK09685 DNA-binding transcriptional activator FeaR; Provisional Back     alignment and domain information
>TIGR01015 hmgA homogentisate 1,2-dioxygenase Back     alignment and domain information
>KOG3995 consensus 3-hydroxyanthranilate oxygenase HAAO [Amino acid transport and metabolism] Back     alignment and domain information
>COG3806 ChrR Transcriptional activator [Transcription] Back     alignment and domain information
>PF07385 DUF1498: Protein of unknown function (DUF1498); InterPro: IPR010864 This family consists of several hypothetical bacterial proteins of around 225 residues in length Back     alignment and domain information
>COG1741 Pirin-related protein [General function prediction only] Back     alignment and domain information
>PF06865 DUF1255: Protein of unknown function (DUF1255); InterPro: IPR009664 This family consists of several conserved hypothetical bacterial proteins of around 95 residues in length Back     alignment and domain information
>COG3257 GlxB Uncharacterized protein, possibly involved in glyoxylate utilization [General function prediction only] Back     alignment and domain information
>PRK00924 5-keto-4-deoxyuronate isomerase; Provisional Back     alignment and domain information
>PF02373 JmjC: JmjC domain, hydroxylase; InterPro: IPR013129 Jumonji protein is required for neural tube formation in mice [] Back     alignment and domain information
>PF13759 2OG-FeII_Oxy_5: Putative 2OG-Fe(II) oxygenase; PDB: 3BVC_B 2RG4_A Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PRK10579 hypothetical protein; Provisional Back     alignment and domain information
>KOG3706 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07847 DUF1637: Protein of unknown function (DUF1637); InterPro: IPR012864 This entry represents cysteamine dioxygenase, which is a non-heme iron protein that is involved in the biosynthesis of taurine Back     alignment and domain information
>COG5553 Predicted metal-dependent enzyme of the double-stranded beta helix superfamily [General function prediction only] Back     alignment and domain information
>TIGR02466 conserved hypothetical protein Back     alignment and domain information
>COG3508 HmgA Homogentisate 1,2-dioxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK15131 mannose-6-phosphate isomerase; Provisional Back     alignment and domain information
>PF14525 AraC_binding_2: AraC-binding-like domain Back     alignment and domain information
>COG3822 ABC-type sugar transport system, auxiliary component [General function prediction only] Back     alignment and domain information
>TIGR00218 manA mannose-6-phosphate isomerase, class I Back     alignment and domain information
>PF09313 DUF1971: Domain of unknown function (DUF1971); InterPro: IPR015392 This uncharacterised domain is predominantly found in bacterial Tellurite resistance proteins Back     alignment and domain information
>PLN02288 mannose-6-phosphate isomerase Back     alignment and domain information
>PF11142 DUF2917: Protein of unknown function (DUF2917); InterPro: IPR021317 This bacterial family of proteins appears to be restricted to Proteobacteria Back     alignment and domain information
>KOG2757 consensus Mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF05726 Pirin_C: Pirin C-terminal cupin domain; InterPro: IPR008778 This entry represents C-terminal domain of Pirin proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>COG2850 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK09391 fixK transcriptional regulator FixK; Provisional Back     alignment and domain information
>PF07172 GRP: Glycine rich protein family; InterPro: IPR010800 This family consists of glycine rich proteins Back     alignment and domain information
>PF00027 cNMP_binding: Cyclic nucleotide-binding domain; InterPro: IPR000595 Proteins that bind cyclic nucleotides (cAMP or cGMP) share a structural domain of about 120 residues [, , ] Back     alignment and domain information
>PF06172 Cupin_5: Cupin superfamily (DUF985); InterPro: IPR009327 This is a family of uncharacterised proteins found in bacteria and eukaryotes Back     alignment and domain information
>PRK11753 DNA-binding transcriptional dual regulator Crp; Provisional Back     alignment and domain information
>PRK13918 CRP/FNR family transcriptional regulator; Provisional Back     alignment and domain information
>PF04622 ERG2_Sigma1R: ERG2 and Sigma1 receptor like protein; InterPro: IPR006716 This family consists of the fungal C-8 sterol isomerase and mammalian sigma1 receptor Back     alignment and domain information
>PRK00924 5-keto-4-deoxyuronate isomerase; Provisional Back     alignment and domain information
>PF04962 KduI: KduI/IolB family; InterPro: IPR021120 The KduI/IolB family of enzymes includes 5-keto 4-deoxyuronate isomerase (KduI) and 5-deoxy-glucuronate isomerase (IolB) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query222
2et7_A201 Structural And Spectroscopic Insights Into The Mech 9e-35
1fi2_A201 Crystal Structure Of Germin (Oxalate Oxidase) Lengt 2e-34
2ete_A201 Recombinant Oxalate Oxidase In Complex With Glycola 5e-34
3ehk_A531 Crystal Structure Of Pru Du Amandin, An Allergenic 1e-05
2uy8_A 385 R92a Mutant Of Bacillus Subtilis Oxalate Decarboxyl 2e-05
1l3j_A 385 Crystal Structure Of Oxalate Decarboxylase Formate 2e-05
1j58_A 385 Crystal Structure Of Oxalate Decarboxylase Length = 2e-05
3s0m_A 377 A Structural Element That Modulates Proton-Coupled 4e-05
2uyb_A 385 S161a Mutant Of Bacillus Subtilis Oxalate Decarboxy 5e-05
2uy9_A 385 E162a Mutant Of Bacillus Subtilis Oxalate Decarboxy 7e-05
2uya_A 383 Del162-163 Mutant Of Bacillus Subtilis Oxalate Deca 2e-04
>pdb|2ET7|A Chain A, Structural And Spectroscopic Insights Into The Mechanism Of Oxalate Oxidase Length = 201 Back     alignment and structure

Iteration: 1

Score = 143 bits (360), Expect = 9e-35, Method: Compositional matrix adjust. Identities = 77/202 (38%), Positives = 116/202 (57%), Gaps = 6/202 (2%) Query: 24 TDPPPLQDFCIADTASPSSFYNNGVPCLNPNSAVSSHFVTSALAKPGKTSGNIFGFNATL 83 +DP PLQDFC+AD + NG C + A +S L K G TS G T Sbjct: 1 SDPDPLQDFCVADLDG-KAVSVNGHTCKPMSEAGDDFLFSSKLTKAGNTS-TPNGSAVTE 58 Query: 84 TNTKNLPGVNTMGLTMARIDIAANGIVPPHTHPRASEVTICLKGALLVGFVDTL---GRL 140 + PG NT+G++MAR+D A G PPH HPRA+E+ + +KG LLVG + +L +L Sbjct: 59 LDVAEWPGTNTLGVSMARVDFAPGGTNPPHIHPRATEIGMVMKGELLVGILGSLDSGNKL 118 Query: 141 FTQQLRPGDSFVFPKGLIHFLYNMDSSKPALALSGLSSQNPGLQMTSMATFASKPPIPDE 200 +++ +R G++FV P+GL+HF +N+ ++ + +S +SQNPG+ + F S PPIP Sbjct: 119 YSRVVRAGETFVIPRGLMHFQFNVGKTEAYMVVS-FNSQNPGIVFVPLTLFGSDPPIPTP 177 Query: 201 VLKKAFQITRQDVSIIRKNLGG 222 VL KA ++ V +++ G Sbjct: 178 VLTKALRVEAGVVELLKSKFAG 199
>pdb|1FI2|A Chain A, Crystal Structure Of Germin (Oxalate Oxidase) Length = 201 Back     alignment and structure
>pdb|2ETE|A Chain A, Recombinant Oxalate Oxidase In Complex With Glycolate Length = 201 Back     alignment and structure
>pdb|3EHK|A Chain A, Crystal Structure Of Pru Du Amandin, An Allergenic Protein From Prunus Dulcis Length = 531 Back     alignment and structure
>pdb|2UY8|A Chain A, R92a Mutant Of Bacillus Subtilis Oxalate Decarboxylase Oxdc Length = 385 Back     alignment and structure
>pdb|1L3J|A Chain A, Crystal Structure Of Oxalate Decarboxylase Formate Complex Length = 385 Back     alignment and structure
>pdb|1J58|A Chain A, Crystal Structure Of Oxalate Decarboxylase Length = 385 Back     alignment and structure
>pdb|3S0M|A Chain A, A Structural Element That Modulates Proton-Coupled Electron Transfer In Oxalate Decarboxylase Length = 377 Back     alignment and structure
>pdb|2UYB|A Chain A, S161a Mutant Of Bacillus Subtilis Oxalate Decarboxylase Oxdc Length = 385 Back     alignment and structure
>pdb|2UY9|A Chain A, E162a Mutant Of Bacillus Subtilis Oxalate Decarboxylase Oxdc Length = 385 Back     alignment and structure
>pdb|2UYA|A Chain A, Del162-163 Mutant Of Bacillus Subtilis Oxalate Decarboxylase Oxdc Length = 383 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query222
1fi2_A201 Oxalate oxidase, germin; beta-jellyroll, oxidoredu 2e-57
2d5f_A493 Glycinin A3B4 subunit; soybean, globulin, 11S,SEED 4e-38
2d5f_A 493 Glycinin A3B4 subunit; soybean, globulin, 11S,SEED 2e-05
1fxz_A476 Glycinin G1; proglycinin, legumin, SEED storage pr 1e-35
1fxz_A 476 Glycinin G1; proglycinin, legumin, SEED storage pr 8e-05
3c3v_A510 Arachin ARAH3 isoform; peanut allergen, allergy, g 5e-34
2vqa_A361 SLL1358 protein, MNCA; periplasmic binding protein 3e-32
2vqa_A 361 SLL1358 protein, MNCA; periplasmic binding protein 2e-29
2ea7_A434 7S globulin-1; beta barrel, cupin superfamily, pla 3e-32
2ea7_A 434 7S globulin-1; beta barrel, cupin superfamily, pla 5e-15
1uij_A416 Beta subunit of beta conglycinin; double-stranded 2e-30
1uij_A 416 Beta subunit of beta conglycinin; double-stranded 8e-15
2cav_A445 Protein (canavalin); vicilin, 7S SEED protein, dom 9e-30
2cav_A 445 Protein (canavalin); vicilin, 7S SEED protein, dom 7e-14
2e9q_A459 11S globulin subunit beta; cucubitin, pumpkin SEED 1e-29
2e9q_A 459 11S globulin subunit beta; cucubitin, pumpkin SEED 5e-06
3ksc_A496 LEGA class, prolegumin; PEA prolegumin, 11S SEED s 6e-29
3kgl_A466 Cruciferin; 11S SEED globulin, rapeseed, SEED stor 7e-27
3qac_A465 11S globulin SEED storage protein; 11S SEED storag 2e-26
1j58_A385 YVRK protein; cupin, decarboxyklase, oxalate, mang 2e-25
1j58_A 385 YVRK protein; cupin, decarboxyklase, oxalate, mang 3e-23
1dgw_A178 Canavalin; duplicated swiss-roll beta barrels, loo 2e-17
3s7i_A 418 Allergen ARA H 1, clone P41B; bicupin, vicilin, st 5e-16
3s7i_A418 Allergen ARA H 1, clone P41B; bicupin, vicilin, st 8e-16
2phl_A397 Phaseolin; plant SEED storage protein(vicilin); HE 6e-15
2phl_A 397 Phaseolin; plant SEED storage protein(vicilin); HE 1e-09
3fz3_A531 Prunin; TREE NUT allergen, allergy, amandin, almon 7e-13
1y3t_A 337 Hypothetical protein YXAG; BI cupin, dioxygenase, 1e-10
1y3t_A337 Hypothetical protein YXAG; BI cupin, dioxygenase, 3e-09
1lr5_A163 Auxin binding protein 1; beta jellyroll, double st 1e-10
3ht1_A145 REMF protein; cupin fold, Zn-binding, antibiotic b 8e-10
1v70_A105 Probable antibiotics synthesis protein; structural 1e-09
1juh_A 350 Quercetin 2,3-dioxygenase; cupin, glycoprotein, be 2e-09
1juh_A350 Quercetin 2,3-dioxygenase; cupin, glycoprotein, be 4e-06
2i45_A107 Hypothetical protein; neisseria meningitidis cupin 3e-09
4e2g_A126 Cupin 2 conserved barrel domain protein; MCSG, PSI 3e-09
1o4t_A133 Putative oxalate decarboxylase; double-stranded be 5e-09
3ibm_A167 Cupin 2, conserved barrel domain protein; cupin 2 5e-09
3d82_A102 Cupin 2, conserved barrel domain protein; structur 2e-08
1yhf_A115 Hypothetical protein SPY1581; structural genomics, 3e-08
1vj2_A126 Novel manganese-containing cupin TM1459; structura 3e-08
3h7j_A243 Bacilysin biosynthesis protein BACB; YWFC, bacilys 4e-08
3h7j_A243 Bacilysin biosynthesis protein BACB; YWFC, bacilys 8e-05
2pfw_A116 Cupin 2, conserved barrel domain protein; cupin do 1e-07
2q30_A110 Uncharacterized protein; double-stranded beta-heli 1e-07
2ozj_A114 Cupin 2, conserved barrel; cupin superfamily prote 2e-07
3kgz_A156 Cupin 2 conserved barrel domain protein; metallopr 4e-07
3jzv_A166 Uncharacterized protein RRU_A2000; structural geno 6e-07
2d40_A 354 Z3393, putative gentisate 1,2-dioxygenase; gentisi 8e-07
3fjs_A114 Uncharacterized protein with RMLC-like cupin fold; 1e-06
3h8u_A125 Uncharacterized conserved protein with double-STR 1e-06
3cew_A125 Uncharacterized cupin protein; all beta-protein, j 3e-06
2gu9_A113 Tetracenomycin polyketide synthesis protein; X-RAY 4e-06
3rns_A227 Cupin 2 conserved barrel domain protein; structura 4e-06
3i7d_A163 Sugar phosphate isomerase; YP_168127.1, structural 5e-06
3bu7_A 394 Gentisate 1,2-dioxygenase; cupin domain, oxidoredu 6e-06
3bu7_A394 Gentisate 1,2-dioxygenase; cupin domain, oxidoredu 1e-05
3nw4_A 368 Gentisate 1,2-dioxygenase; beta-barrel, oxidoreduc 4e-05
1x82_A190 Glucose-6-phosphate isomerase; cupin superfamily, 2e-04
2o8q_A134 Hypothetical protein; cpuin-like fold, structural 2e-04
1vr3_A191 Acireductone dioxygenase; 13543033, structural gen 3e-04
2ozi_A98 Hypothetical protein RPA4178; APC6210, putative pr 5e-04
1sq4_A278 GLXB, glyoxylate-induced protein; structural genom 8e-04
>1fi2_A Oxalate oxidase, germin; beta-jellyroll, oxidoreductase; 1.60A {Hordeum vulgare} SCOP: b.82.1.2 PDB: 2et1_A 2ete_A* 2et7_A Length = 201 Back     alignment and structure
 Score =  179 bits (455), Expect = 2e-57
 Identities = 77/202 (38%), Positives = 112/202 (55%), Gaps = 6/202 (2%)

Query: 24  TDPPPLQDFCIADTASPSSFYNNGVPCLNPNSAVSSHFVTSALAKPGKTSGNIFGFNATL 83
           TDP PLQDFC+AD    +    NG  C   + A      +S L K G TS    G   T 
Sbjct: 1   TDPDPLQDFCVADLDGKAVS-VNGHTCKPMSEAGDDFLFSSKLTKAGNTS-TPNGSAVTE 58

Query: 84  TNTKNLPGVNTMGLTMARIDIAANGIVPPHTHPRASEVTICLKGALLVGFVDTLG---RL 140
            +    PG NT+G++M R+D A  G  PPH HPRA+E+ + +KG LLVG + +L    +L
Sbjct: 59  LDVAEWPGTNTLGVSMNRVDFAPGGTNPPHIHPRATEIGMVMKGELLVGILGSLDSGNKL 118

Query: 141 FTQQLRPGDSFVFPKGLIHFLYNMDSSKPALALSGLSSQNPGLQMTSMATFASKPPIPDE 200
           +++ +R G++FV P+GL+HF +N+     A  +   +SQNPG+    +  F S PPIP  
Sbjct: 119 YSRVVRAGETFVIPRGLMHFQFNVG-KTEAYMVVSFNSQNPGIVFVPLTLFGSDPPIPTP 177

Query: 201 VLKKAFQITRQDVSIIRKNLGG 222
           VL KA ++    V +++    G
Sbjct: 178 VLTKALRVEAGVVELLKSKFAG 199


>2d5f_A Glycinin A3B4 subunit; soybean, globulin, 11S,SEED storage protein, plant; 1.90A {Glycine max} PDB: 2d5h_A 1od5_A Length = 493 Back     alignment and structure
>1fxz_A Glycinin G1; proglycinin, legumin, SEED storage protein, plant protein; 2.80A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ud1_A 1ucx_A Length = 476 Back     alignment and structure
>1fxz_A Glycinin G1; proglycinin, legumin, SEED storage protein, plant protein; 2.80A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ud1_A 1ucx_A Length = 476 Back     alignment and structure
>3c3v_A Arachin ARAH3 isoform; peanut allergen, allergy, glycinin; 1.73A {Arachis hypogaea} Length = 510 Back     alignment and structure
>2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP} Length = 361 Back     alignment and structure
>2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP} Length = 361 Back     alignment and structure
>2ea7_A 7S globulin-1; beta barrel, cupin superfamily, plant protein; 1.80A {Vigna angularis} PDB: 2eaa_A* 2cv6_A 1uik_A Length = 434 Back     alignment and structure
>2ea7_A 7S globulin-1; beta barrel, cupin superfamily, plant protein; 1.80A {Vigna angularis} PDB: 2eaa_A* 2cv6_A 1uik_A Length = 434 Back     alignment and structure
>1uij_A Beta subunit of beta conglycinin; double-stranded beta helix, SEED storage protein, sugar binding protein; 2.50A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ipk_A 1ipj_A* Length = 416 Back     alignment and structure
>1uij_A Beta subunit of beta conglycinin; double-stranded beta helix, SEED storage protein, sugar binding protein; 2.50A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ipk_A 1ipj_A* Length = 416 Back     alignment and structure
>2cav_A Protein (canavalin); vicilin, 7S SEED protein, domain duplication, swiss roll, PL protein; 2.00A {Canavalia ensiformis} SCOP: b.82.1.2 b.82.1.2 PDB: 2cau_A 1cau_B 1cav_B 1caw_B 1cax_B Length = 445 Back     alignment and structure
>2cav_A Protein (canavalin); vicilin, 7S SEED protein, domain duplication, swiss roll, PL protein; 2.00A {Canavalia ensiformis} SCOP: b.82.1.2 b.82.1.2 PDB: 2cau_A 1cau_B 1cav_B 1caw_B 1cax_B Length = 445 Back     alignment and structure
>2e9q_A 11S globulin subunit beta; cucubitin, pumpkin SEED storage globulin, plant protein; 2.20A {Cucurbita maxima} PDB: 2evx_A Length = 459 Back     alignment and structure
>2e9q_A 11S globulin subunit beta; cucubitin, pumpkin SEED storage globulin, plant protein; 2.20A {Cucurbita maxima} PDB: 2evx_A Length = 459 Back     alignment and structure
>3ksc_A LEGA class, prolegumin; PEA prolegumin, 11S SEED storage protein, pisum sativum L., SEED storage protein, storage protein, plant protein; 2.61A {Pisum sativum} Length = 496 Back     alignment and structure
>3kgl_A Cruciferin; 11S SEED globulin, rapeseed, SEED storage protein, storage protein, plant protein; 2.98A {Brassica napus} Length = 466 Back     alignment and structure
>3qac_A 11S globulin SEED storage protein; 11S SEED storage protein (globulins) family, SEED storage PR plant protein; 2.27A {Amaranthus hypochondriacus} Length = 465 Back     alignment and structure
>1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A Length = 385 Back     alignment and structure
>1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A Length = 385 Back     alignment and structure
>1dgw_A Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_A 1cau_A 1cav_A 1caw_A 1cax_A Length = 178 Back     alignment and structure
>3s7i_A Allergen ARA H 1, clone P41B; bicupin, vicilin, storage SEED protein; 2.35A {Arachis hypogaea} PDB: 3s7e_A 3smh_A Length = 418 Back     alignment and structure
>3s7i_A Allergen ARA H 1, clone P41B; bicupin, vicilin, storage SEED protein; 2.35A {Arachis hypogaea} PDB: 3s7e_A 3smh_A Length = 418 Back     alignment and structure
>2phl_A Phaseolin; plant SEED storage protein(vicilin); HET: NAG; 2.20A {Phaseolus vulgaris} SCOP: b.82.1.2 b.82.1.2 PDB: 1phs_A* Length = 397 Back     alignment and structure
>2phl_A Phaseolin; plant SEED storage protein(vicilin); HET: NAG; 2.20A {Phaseolus vulgaris} SCOP: b.82.1.2 b.82.1.2 PDB: 1phs_A* Length = 397 Back     alignment and structure
>3fz3_A Prunin; TREE NUT allergen, allergy, amandin, almond, 11S SEED storage protein, allergen; 2.40A {Prunus dulcis} PDB: 3ehk_A Length = 531 Back     alignment and structure
>1y3t_A Hypothetical protein YXAG; BI cupin, dioxygenase, oxidoreductase; 2.40A {Bacillus subtilis} SCOP: b.82.1.5 PDB: 2h0v_A* Length = 337 Back     alignment and structure
>1y3t_A Hypothetical protein YXAG; BI cupin, dioxygenase, oxidoreductase; 2.40A {Bacillus subtilis} SCOP: b.82.1.5 PDB: 2h0v_A* Length = 337 Back     alignment and structure
>1lr5_A Auxin binding protein 1; beta jellyroll, double stranded beta helix, germin-like PROT protein binding; HET: NAG BMA MAN; 1.90A {Zea mays} SCOP: b.82.1.2 PDB: 1lrh_A* Length = 163 Back     alignment and structure
>3ht1_A REMF protein; cupin fold, Zn-binding, antibiotic biosynthesis, resistomycin, metalloprotein, cyclase, lyase; 1.20A {Streptomyces resistomycificus} PDB: 3ht2_A Length = 145 Back     alignment and structure
>1v70_A Probable antibiotics synthesis protein; structural genomics, thermus thermophilus HB8, riken structu genomics/proteomics initiative, RSGI; 1.30A {Thermus thermophilus} SCOP: b.82.1.9 PDB: 2dct_A Length = 105 Back     alignment and structure
>1juh_A Quercetin 2,3-dioxygenase; cupin, glycoprotein, beta sandwich, oxidoreduct; HET: NAG BMA MAN; 1.60A {Aspergillus japonicus} SCOP: b.82.1.5 PDB: 1gqh_A* 1h1i_A* 1h1m_A* 1gqg_A* Length = 350 Back     alignment and structure
>1juh_A Quercetin 2,3-dioxygenase; cupin, glycoprotein, beta sandwich, oxidoreduct; HET: NAG BMA MAN; 1.60A {Aspergillus japonicus} SCOP: b.82.1.5 PDB: 1gqh_A* 1h1i_A* 1h1m_A* 1gqg_A* Length = 350 Back     alignment and structure
>2i45_A Hypothetical protein; neisseria meningitidis cupin domain, structural genomics, PS protein structure initiative; 2.50A {Neisseria meningitidis} Length = 107 Back     alignment and structure
>4e2g_A Cupin 2 conserved barrel domain protein; MCSG, PSI-biology, structural genomics, GEBA, midwest center structural genomics; HET: MSE; 1.86A {Sphaerobacter thermophilus} Length = 126 Back     alignment and structure
>1o4t_A Putative oxalate decarboxylase; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; 1.95A {Thermotoga maritima} SCOP: b.82.1.9 Length = 133 Back     alignment and structure
>3ibm_A Cupin 2, conserved barrel domain protein; cupin 2 family, metal-binding site, beta barrel, PSI-2, NYSG structural genomics; 2.00A {Halorhodospira halophila SL1} Length = 167 Back     alignment and structure
>3d82_A Cupin 2, conserved barrel domain protein; structural genomics, joint center for structural genomics; 2.05A {Shewanella frigidimarina ncimb 400} Length = 102 Back     alignment and structure
>1yhf_A Hypothetical protein SPY1581; structural genomics, conserved hypothetical protein, PSI, PR structure initiative; 2.00A {Streptococcus pyogenes} SCOP: b.82.1.9 Length = 115 Back     alignment and structure
>1vj2_A Novel manganese-containing cupin TM1459; structural genomics, joint for structural genomics, JCSG; 1.65A {Thermotoga maritima} SCOP: b.82.1.10 Length = 126 Back     alignment and structure
>3h7j_A Bacilysin biosynthesis protein BACB; YWFC, bacilysin synthesis, anticapsin synthesis, BI-Cu double stranded beta helix, antibiotic biosynthesis; HET: PPY; 1.87A {Bacillus subtilis} PDB: 3h7y_A* 3h9a_A* Length = 243 Back     alignment and structure
>3h7j_A Bacilysin biosynthesis protein BACB; YWFC, bacilysin synthesis, anticapsin synthesis, BI-Cu double stranded beta helix, antibiotic biosynthesis; HET: PPY; 1.87A {Bacillus subtilis} PDB: 3h7y_A* 3h9a_A* Length = 243 Back     alignment and structure
>2pfw_A Cupin 2, conserved barrel domain protein; cupin domain, struc genomics, joint center for structural genomics, JCSG; 1.90A {Shewanella frigidimarina} Length = 116 Back     alignment and structure
>2q30_A Uncharacterized protein; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: MSE; 1.94A {Desulfovibrio desulfuricans subsp} Length = 110 Back     alignment and structure
>2ozj_A Cupin 2, conserved barrel; cupin superfamily protein, struct genomics, joint center for structural genomics, JCSG; HET: MSE; 1.60A {Desulfitobacterium hafniense} Length = 114 Back     alignment and structure
>3kgz_A Cupin 2 conserved barrel domain protein; metalloprotein, structural genomics, PSI-2, protein structur initiative; 1.85A {Rhodopseudomonas palustris} Length = 156 Back     alignment and structure
>3jzv_A Uncharacterized protein RRU_A2000; structural genomics, cupin-2 fold, unknown function, PSI-2, structure initiative; HET: MSE; 2.30A {Rhodospirillum rubrum} Length = 166 Back     alignment and structure
>2d40_A Z3393, putative gentisate 1,2-dioxygenase; gentisic acid, bicupin, tetramer, montreal- bacterial structural genomics initiative, BSGI; 2.41A {Escherichia coli} SCOP: b.82.1.23 Length = 354 Back     alignment and structure
>3fjs_A Uncharacterized protein with RMLC-like cupin fold; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.90A {Ralstonia eutropha JMP134} Length = 114 Back     alignment and structure
>3h8u_A Uncharacterized conserved protein with double-STR beta-helix domain; YP_001338853.1; HET: 2PE; 1.80A {Klebsiella pneumoniae subsp} Length = 125 Back     alignment and structure
>3cew_A Uncharacterized cupin protein; all beta-protein, jelly-roll (cupin-2), structural genomics, protein structure initiative; 2.31A {Bacteroides fragilis} Length = 125 Back     alignment and structure
>2gu9_A Tetracenomycin polyketide synthesis protein; X-RAY diffraction, cupin, immune system; 1.40A {Xanthomonas campestris} PDB: 2ilb_A 3h50_A Length = 113 Back     alignment and structure
>3rns_A Cupin 2 conserved barrel domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 2.07A {Leptotrichia buccalis} Length = 227 Back     alignment and structure
>3i7d_A Sugar phosphate isomerase; YP_168127.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.30A {Ruegeria pomeroyi dss-3} Length = 163 Back     alignment and structure
>3bu7_A Gentisate 1,2-dioxygenase; cupin domain, oxidoreductase, plasmid; 2.80A {Silicibacter pomeroyi} SCOP: b.82.1.23 Length = 394 Back     alignment and structure
>3bu7_A Gentisate 1,2-dioxygenase; cupin domain, oxidoreductase, plasmid; 2.80A {Silicibacter pomeroyi} SCOP: b.82.1.23 Length = 394 Back     alignment and structure
>3nw4_A Gentisate 1,2-dioxygenase; beta-barrel, oxidoreductase; HET: GTQ; 2.00A {Pseudaminobacter salicylatoxidans} PDB: 3nvc_A* 3nst_A* 3njz_A* 2phd_A* 3nkt_A* 3nl1_A* Length = 368 Back     alignment and structure
>1x82_A Glucose-6-phosphate isomerase; cupin superfamily, hyperthermophIle, phosphoglucose isomerase, extremeophIle; HET: PA5; 1.50A {Pyrococcus furiosus} SCOP: b.82.1.7 PDB: 1x7n_A* 1x8e_A 1qxr_A* 1qxj_A* 1qy4_A* 2gc1_A* 2gc0_A* 2gc2_A* 2gc3_A* 3sxw_A 1j3q_A 1j3p_A 1j3r_A* Length = 190 Back     alignment and structure
>2o8q_A Hypothetical protein; cpuin-like fold, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.55A {Burkholderia xenovorans} Length = 134 Back     alignment and structure
>1vr3_A Acireductone dioxygenase; 13543033, structural genomics, JOI for structural genomics, JCSG, protein structure initiative oxidoreductase; 2.06A {Mus musculus} SCOP: b.82.1.6 Length = 191 Back     alignment and structure
>1sq4_A GLXB, glyoxylate-induced protein; structural genomics, double beta barrel protein, PSI, protei structure initiative; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.11 Length = 278 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query222
1fi2_A201 Oxalate oxidase, germin; beta-jellyroll, oxidoredu 100.0
3kgl_A466 Cruciferin; 11S SEED globulin, rapeseed, SEED stor 100.0
3ksc_A496 LEGA class, prolegumin; PEA prolegumin, 11S SEED s 100.0
3qac_A465 11S globulin SEED storage protein; 11S SEED storag 100.0
2e9q_A459 11S globulin subunit beta; cucubitin, pumpkin SEED 99.97
3fz3_A531 Prunin; TREE NUT allergen, allergy, amandin, almon 99.97
2cav_A445 Protein (canavalin); vicilin, 7S SEED protein, dom 99.97
1uij_A416 Beta subunit of beta conglycinin; double-stranded 99.97
3c3v_A510 Arachin ARAH3 isoform; peanut allergen, allergy, g 99.97
1fxz_A476 Glycinin G1; proglycinin, legumin, SEED storage pr 99.97
2ea7_A434 7S globulin-1; beta barrel, cupin superfamily, pla 99.96
2d5f_A493 Glycinin A3B4 subunit; soybean, globulin, 11S,SEED 99.96
3s7i_A418 Allergen ARA H 1, clone P41B; bicupin, vicilin, st 99.96
1dgw_A178 Canavalin; duplicated swiss-roll beta barrels, loo 99.95
2phl_A397 Phaseolin; plant SEED storage protein(vicilin); HE 99.93
2vqa_A361 SLL1358 protein, MNCA; periplasmic binding protein 99.93
2e9q_A 459 11S globulin subunit beta; cucubitin, pumpkin SEED 99.91
2ea7_A 434 7S globulin-1; beta barrel, cupin superfamily, pla 99.91
2cav_A 445 Protein (canavalin); vicilin, 7S SEED protein, dom 99.91
1uij_A 416 Beta subunit of beta conglycinin; double-stranded 99.91
2phl_A 397 Phaseolin; plant SEED storage protein(vicilin); HE 99.9
3s7i_A 418 Allergen ARA H 1, clone P41B; bicupin, vicilin, st 99.9
1fxz_A 476 Glycinin G1; proglycinin, legumin, SEED storage pr 99.9
3qac_A 465 11S globulin SEED storage protein; 11S SEED storag 99.9
3ksc_A 496 LEGA class, prolegumin; PEA prolegumin, 11S SEED s 99.89
2d5f_A 493 Glycinin A3B4 subunit; soybean, globulin, 11S,SEED 99.87
3kgl_A 466 Cruciferin; 11S SEED globulin, rapeseed, SEED stor 99.87
2vqa_A 361 SLL1358 protein, MNCA; periplasmic binding protein 99.86
3c3v_A 510 Arachin ARAH3 isoform; peanut allergen, allergy, g 99.86
3fz3_A 531 Prunin; TREE NUT allergen, allergy, amandin, almon 99.84
1j58_A385 YVRK protein; cupin, decarboxyklase, oxalate, mang 99.83
1j58_A 385 YVRK protein; cupin, decarboxyklase, oxalate, mang 99.81
1dgw_X79 Canavalin; duplicated swiss-roll beta barrels, loo 99.8
3h8u_A125 Uncharacterized conserved protein with double-STR 99.54
2xlg_A239 SLL1785 protein, CUCA; metal binding protein, cupi 99.51
3l2h_A162 Putative sugar phosphate isomerase; AFE_0303, stru 99.5
1v70_A105 Probable antibiotics synthesis protein; structural 99.49
2fqp_A97 Hypothetical protein BP2299; double-stranded beta- 99.47
2gu9_A113 Tetracenomycin polyketide synthesis protein; X-RAY 99.43
1lr5_A163 Auxin binding protein 1; beta jellyroll, double st 99.43
1x82_A190 Glucose-6-phosphate isomerase; cupin superfamily, 99.43
2oa2_A148 BH2720 protein; 10175341, structural genomics, joi 99.43
3i7d_A163 Sugar phosphate isomerase; YP_168127.1, structural 99.43
3ht1_A145 REMF protein; cupin fold, Zn-binding, antibiotic b 99.42
3es1_A172 Cupin 2, conserved barrel domain protein; YP_00116 99.4
3lag_A98 Uncharacterized protein RPA4178; functionally unkn 99.39
4e2g_A126 Cupin 2 conserved barrel domain protein; MCSG, PSI 99.38
3fjs_A114 Uncharacterized protein with RMLC-like cupin fold; 99.38
2f4p_A147 Hypothetical protein TM1010; double-stranded beta- 99.38
3ibm_A167 Cupin 2, conserved barrel domain protein; cupin 2 99.37
3kgz_A156 Cupin 2 conserved barrel domain protein; metallopr 99.37
1o4t_A133 Putative oxalate decarboxylase; double-stranded be 99.37
3jzv_A166 Uncharacterized protein RRU_A2000; structural geno 99.36
2bnm_A198 Epoxidase; oxidoreductase, cupin, HTH, cation-depe 99.35
2b8m_A117 Hypothetical protein MJ0764; structural genomics, 99.35
4i4a_A128 Similar to unknown protein; structural genomics, P 99.33
3cew_A125 Uncharacterized cupin protein; all beta-protein, j 99.32
1vj2_A126 Novel manganese-containing cupin TM1459; structura 99.31
2ozi_A98 Hypothetical protein RPA4178; APC6210, putative pr 99.31
2o8q_A134 Hypothetical protein; cpuin-like fold, structural 99.3
2pfw_A116 Cupin 2, conserved barrel domain protein; cupin do 99.28
1yhf_A115 Hypothetical protein SPY1581; structural genomics, 99.27
2vpv_A166 Protein MIF2, MIF2P; nucleus, mitosis, centromere, 99.27
1y9q_A192 Transcriptional regulator, HTH_3 family; transcrip 99.26
1rc6_A261 Hypothetical protein YLBA; structural genomics, NY 99.25
3h7j_A243 Bacilysin biosynthesis protein BACB; YWFC, bacilys 99.24
2q30_A110 Uncharacterized protein; double-stranded beta-heli 99.22
1sef_A274 Conserved hypothetical protein; structural genomic 99.19
1y3t_A 337 Hypothetical protein YXAG; BI cupin, dioxygenase, 99.18
2ozj_A114 Cupin 2, conserved barrel; cupin superfamily prote 99.16
3lwc_A119 Uncharacterized protein; structural genomics, unkn 99.13
1y3t_A337 Hypothetical protein YXAG; BI cupin, dioxygenase, 99.12
3h7j_A243 Bacilysin biosynthesis protein BACB; YWFC, bacilys 99.12
2d40_A 354 Z3393, putative gentisate 1,2-dioxygenase; gentisi 99.12
1sfn_A246 Conserved hypothetical protein; structural genomic 99.11
1juh_A 350 Quercetin 2,3-dioxygenase; cupin, glycoprotein, be 99.11
2d40_A354 Z3393, putative gentisate 1,2-dioxygenase; gentisi 99.09
3d82_A102 Cupin 2, conserved barrel domain protein; structur 99.09
2opk_A112 Hypothetical protein; putative mannose-6-phosphate 99.08
2i45_A107 Hypothetical protein; neisseria meningitidis cupin 99.08
1sq4_A278 GLXB, glyoxylate-induced protein; structural genom 99.07
1rc6_A261 Hypothetical protein YLBA; structural genomics, NY 99.07
2pyt_A133 Ethanolamine utilization protein EUTQ; structural 99.05
3rns_A227 Cupin 2 conserved barrel domain protein; structura 99.03
3rns_A227 Cupin 2 conserved barrel domain protein; structura 99.02
1sef_A274 Conserved hypothetical protein; structural genomic 99.0
4e2q_A266 Ureidoglycine aminohydrolase; BI-cupin, manganese 98.99
3bu7_A 394 Gentisate 1,2-dioxygenase; cupin domain, oxidoredu 98.99
4b29_A217 Dimethylsulfoniopropionate lyase; hydrolase, dimet 98.99
1dgw_Y93 Canavalin; duplicated swiss-roll beta barrels, loo 98.99
1sq4_A278 GLXB, glyoxylate-induced protein; structural genom 98.99
3bu7_A394 Gentisate 1,2-dioxygenase; cupin domain, oxidoredu 98.99
4e2q_A266 Ureidoglycine aminohydrolase; BI-cupin, manganese 98.98
4h7l_A157 Uncharacterized protein; structural genomics, PSI- 98.98
3nw4_A 368 Gentisate 1,2-dioxygenase; beta-barrel, oxidoreduc 98.97
1vr3_A191 Acireductone dioxygenase; 13543033, structural gen 98.95
4axo_A151 EUTQ, ethanolamine utilization protein; structural 98.86
1o5u_A101 Novel thermotoga maritima enzyme TM1112; cupin, st 98.79
3ebr_A159 Uncharacterized RMLC-like cupin; structural genomi 98.78
1zrr_A179 E-2/E-2' protein; nickel, cupin, beta helix, methi 98.72
2q1z_B195 Anti-sigma factor CHRR, transcriptional activator; 98.71
3bcw_A123 Uncharacterized protein; structural genomics, join 98.66
1yfu_A174 3-hydroxyanthranilate-3,4-dioxygenase; cupin, oxid 98.66
1juh_A350 Quercetin 2,3-dioxygenase; cupin, glycoprotein, be 98.66
2o1q_A145 Putative acetyl/propionyl-COA carboxylase, alpha; 98.63
1sfn_A246 Conserved hypothetical protein; structural genomic 98.62
3eqe_A171 Putative cystein deoxygenase; YUBC, SR112, NESG, s 98.58
3cjx_A165 Protein of unknown function with A cupin-like FOL; 98.57
2y0o_A175 Probable D-lyxose ketol-isomerase; carbohydrate me 98.56
3st7_A369 Capsular polysaccharide synthesis enzyme CAP5F; ro 98.46
3nw4_A368 Gentisate 1,2-dioxygenase; beta-barrel, oxidoreduc 98.44
2gm6_A208 Cysteine dioxygenase type I; structural genomics, 98.44
2arc_A164 ARAC, arabinose operon regulatory protein; transcr 98.4
1zvf_A176 3-hydroxyanthranilate 3,4-dioxygenase; jellyroll b 98.39
3d0j_A140 Uncharacterized protein CA_C3497; beta-barrel, str 98.32
3bal_A153 Acetylacetone-cleaving enzyme; jelly roll, tetrame 98.32
2qnk_A 286 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fol 98.28
3o14_A223 Anti-ecfsigma factor, CHRR; cupin, structural geno 98.21
3eln_A200 Cysteine dioxygenase type 1; peroxysulfenate, non- 98.18
3myx_A238 Uncharacterized protein pspto_0244; protein of unk 97.92
2pa7_A141 DTDP-6-deoxy-3,4-keto-hexulose isomerase; deoxysug 97.83
3uss_A211 Putative uncharacterized protein; cupin, three his 97.82
3ejk_A174 DTDP sugar isomerase; YP_390184.1, structural geno 97.77
3es4_A116 Uncharacterized protein DUF861 with A RMLC-like C; 97.58
3gbg_A 276 TCP pilus virulence regulatory protein; cupin, hel 97.55
3myx_A238 Uncharacterized protein pspto_0244; protein of unk 97.44
1yud_A170 Hypothetical protein SO0799; SOR12, Q8E1N8, PSI, p 97.31
3o14_A223 Anti-ecfsigma factor, CHRR; cupin, structural geno 97.17
2vec_A256 YHAK, pirin-like protein YHAK; ROS, bicupin, sulfe 97.12
1vrb_A342 Putative asparaginyl hydroxylase; 2636534, structu 96.87
1ep0_A185 DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; race 96.86
1tq5_A242 Protein YHHW; bicupin, pirin, montreal-kingston ba 96.83
3ryk_A205 DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pat 96.81
2ixk_A184 DTDP-4-dehydrorhamnose 3,5-epimerase; isomerase, l 96.77
1nxm_A197 DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; jell 96.72
1wlt_A196 176AA long hypothetical DTDP-4-dehydrorhamnose 3, 96.68
1dzr_A183 DTDP-4-dehydrorhamnose 3\,5-epimerase; isomerase, 96.66
3bb6_A127 Uncharacterized protein YEAR; structural genomics, 96.65
1oi6_A205 PCZA361.16; epimerase, vancomycin group antibiotic 96.63
4gjz_A235 Lysine-specific demethylase 8; JMJC, beta barrel, 96.57
2c0z_A216 NOVW; isomerase, epimerase, antibiotic biosynthesi 96.55
1upi_A225 DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pat 96.49
4hn1_A201 Putative 3-epimerase in D-allose pathway; 3'-monoe 96.32
3kmh_A246 D-lyxose isomerase; cupin beta-barrel, structural 96.28
2xdv_A 442 MYC-induced nuclear antigen; ribosome biogenesis, 95.97
3d8c_A349 Hypoxia-inducible factor 1 alpha inhibitor; FIH, H 95.96
4diq_A 489 Lysine-specific demethylase NO66; structural genom 95.46
3al5_A338 HTYW5, JMJC domain-containing protein C2ORF60; tRN 95.13
2qdr_A303 Uncharacterized protein; double-stranded beta-heli 94.84
1e5r_A290 Proline oxidase; oxidoreductase, oxygenase, 2-oxog 94.61
3k2o_A336 Bifunctional arginine demethylase and lysyl-hydro 94.51
2qjv_A270 Uncharacterized IOLB-like protein; structural geno 94.47
2qnk_A286 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fol 94.19
2p17_A 277 Pirin-like protein; GK1651, structural genomics, s 94.04
1eyb_A 471 Homogentisate 1,2-dioxygenase; jelly roll, beta sa 93.88
2yu1_A 451 JMJC domain-containing histone demethylation PROT; 93.84
3rcq_A197 Aspartyl/asparaginyl beta-hydroxylase; structural 93.76
2oyz_A94 UPF0345 protein VPA0057; unknown function, structu 93.76
1xru_A282 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomer; 93.56
3kv5_D488 JMJC domain-containing histone demethylation prote 93.22
3kv4_A447 PHD finger protein 8; epigenetics, histone CODE, c 93.19
3hqx_A111 UPF0345 protein aciad0356; DUF1255,PF06865,PSI2,MC 92.48
3kv9_A397 JMJC domain-containing histone demethylation prote 92.44
3k3o_A371 PHF8, PHD finger protein 8; histone demethylase, c 92.27
1j1l_A 290 Pirin; beta sandwich, cupin, iron, metatl binding 92.09
1ywk_A289 4-deoxy-L-threo-5-hexosulose-uronate ketol- isomer 91.13
1qwr_A319 Mannose-6-phosphate isomerase; structural genomics 91.11
3pua_A392 GRC5, PHD finger protein 2; alpha-ketoglutarate-Fe 90.73
1pmi_A440 PMI, phosphomannose isomerase; aldose-ketose isome 90.33
3dl3_A119 Tellurite resistance protein B; X-RAY NESG VFR98 Q 90.27
2rg4_A216 Uncharacterized protein; rhodobacterales, oceanico 90.19
2wfp_A394 Mannose-6-phosphate isomerase; APO-structure, meta 89.58
3eo6_A106 Protein of unknown function (DUF1255); AFE_2634, s 88.59
3pur_A528 Lysine-specific demethylase 7 homolog; oxidoreduct 88.29
1tq5_A242 Protein YHHW; bicupin, pirin, montreal-kingston ba 87.93
1zx5_A300 Mannosephosphate isomerase, putative; STRU genomic 87.16
3m3i_A225 Putative uncharacterized protein; PFAM:PF06172, st 86.83
3loi_A172 Putative uncharacterized protein; beta barrel, unk 85.69
3mdp_A142 Cyclic nucleotide-binding domain (CNMP-BD) protei; 85.17
2qjv_A 270 Uncharacterized IOLB-like protein; structural geno 84.69
2pqq_A149 Putative transcriptional regulator; APC7345, strep 84.57
1j1l_A290 Pirin; beta sandwich, cupin, iron, metatl binding 83.71
2p17_A277 Pirin-like protein; GK1651, structural genomics, s 83.11
3dn7_A194 Cyclic nucleotide binding regulatory protein; stru 81.93
4ev0_A216 Transcription regulator, CRP family; CAMP binding, 81.65
2oz6_A207 Virulence factor regulator; winged helix, helix-tu 81.53
2ypd_A392 Probable JMJC domain-containing histone demethyla 80.92
1znp_A154 Hypothetical protein ATU3615; NESG, ATR55, Q8U9W0, 80.8
2vec_A256 YHAK, pirin-like protein YHAK; ROS, bicupin, sulfe 80.38
3iwz_A230 CAP-like, catabolite activation-like protein; XCC, 80.2
1qwr_A319 Mannose-6-phosphate isomerase; structural genomics 80.17
3fx3_A237 Cyclic nucleotide-binding protein; helix_TURN_heli 80.02
>1fi2_A Oxalate oxidase, germin; beta-jellyroll, oxidoreductase; 1.60A {Hordeum vulgare} SCOP: b.82.1.2 PDB: 2et1_A 2ete_A* 2et7_A Back     alignment and structure
Probab=100.00  E-value=1.6e-50  Score=338.06  Aligned_cols=195  Identities=41%  Similarity=0.779  Sum_probs=184.0

Q ss_pred             cCCCCCcceeeecCCCCCccccCCCCCCCCCCCcCCCeEeec-cCCCCCCcCCcCCcEEEEeccCCCCCccccceEEEEE
Q 027536           24 TDPPPLQDFCIADTASPSSFYNNGVPCLNPNSAVSSHFVTSA-LAKPGKTSGNIFGFNATLTNTKNLPGVNTMGLTMARI  102 (222)
Q Consensus        24 ~d~~~~~dfcva~~~~~~~~~~~g~~ck~~~~v~~~dF~f~~-l~~~~~~~~~~~g~~v~~~~~~~fP~l~~lgis~~~v  102 (222)
                      +||||||||||||++++. +++|||||| |+.++++||+|++ +.+++++. |..|+.++.++..++|+++++++++.++
T Consensus         1 ~~~~~~~d~c~~~~~~~~-~~~~g~~c~-~~~~~~~df~~~~~~~~~~~~~-~~~G~~v~~~~~~~~p~l~~~~~~~~~~   77 (201)
T 1fi2_A            1 TDPDPLQDFCVADLDGKA-VSVNGHTCK-PMSEAGDDFLFSSKLTKAGNTS-TPNGSAVTELDVAEWPGTNTLGVSMNRV   77 (201)
T ss_dssp             CCCCCSSSCCCBCCCTTS-CCCSSCCBC-CGGGCCSCTTCCCTTSSCCCCC-STTSEEEEEESTTTCGGGTTSSCEEEEE
T ss_pred             CCCcccceeEEecCCCCc-ccccCcccc-cCcccccceEEeeeecCCCCcc-CCCCcEEEEEecccCCCcccCceEEEEE
Confidence            699999999999997642 889999999 9999999999998 99999887 8999999999999999999999999999


Q ss_pred             EEcCCcccCCccCCCCcEEEEEEeCeEEEEEEecC---CcEEEEEECCCCEEEEcCCCeeEEEecCCCCCEEEEEEEeCC
Q 027536          103 DIAANGIVPPHTHPRASEVTICLKGALLVGFVDTL---GRLFTQQLRPGDSFVFPKGLIHFLYNMDSSKPALALSGLSSQ  179 (222)
Q Consensus       103 ~l~pGg~~~pH~H~~a~Ei~yVl~G~~~~~~v~~~---~~~~~~~L~~GDv~viP~G~~H~~~N~g~~~~a~~i~~~~s~  179 (222)
                      ++.||++.+||||+++.|++||++|++++++++.+   ++++.+.|++||+++||+|..|+++|.| +++++++++++++
T Consensus        78 ~l~pg~~~~~H~H~~~~E~~~Vl~G~~~v~~~~~~~~~~~~~~~~l~~GD~~~iP~g~~H~~~N~g-~~~~~~l~v~~~~  156 (201)
T 1fi2_A           78 DFAPGGTNPPHIHPRATEIGMVMKGELLVGILGSLDSGNKLYSRVVRAGETFVIPRGLMHFQFNVG-KTEAYMVVSFNSQ  156 (201)
T ss_dssp             EECTTCEEEEEECTTCCEEEEEEESEEEEEEECCGGGTTCEEEEEEETTCEEEECTTCCEEEEECS-SSCEEEEEEESSS
T ss_pred             EECCCCCCCCeECCCCCEEEEEEeCEEEEEEEcCCCCCCeEEEEEECCCCEEEECCCCeEEEEeCC-CCCEEEEEEECCC
Confidence            99999999999999989999999999999998765   6767899999999999999999999999 9999999999999


Q ss_pred             CCCcccchhhhhcCCCCCCHHHHHHHcCCCHHHHHHHHHhcCC
Q 027536          180 NPGLQMTSMATFASKPPIPDEVLKKAFQITRQDVSIIRKNLGG  222 (222)
Q Consensus       180 ~pg~~~~~~~~f~~~~~ip~~vla~af~~~~~~v~~l~~~~~~  222 (222)
                      +|+.+.++.++|+++|.+|+++|+++|+++.+++++|+++|++
T Consensus       157 ~p~~~~~~~~~~~~~~~~~~~vl~~af~~~~~~v~~l~~~~~~  199 (201)
T 1fi2_A          157 NPGIVFVPLTLFGSDPPIPTPVLTKALRVEAGVVELLKSKFAG  199 (201)
T ss_dssp             CCCCEEHHHHHHHCSSCCCHHHHHHHHTSCHHHHHHHHHHSTT
T ss_pred             CCCeEehhhHHhcCCCCCCHHHHHHHHCcCHHHHHHHHHhhcC
Confidence            9999999988999888899999999999999999999999864



>3kgl_A Cruciferin; 11S SEED globulin, rapeseed, SEED storage protein, storage protein, plant protein; 2.98A {Brassica napus} Back     alignment and structure
>3ksc_A LEGA class, prolegumin; PEA prolegumin, 11S SEED storage protein, pisum sativum L., SEED storage protein, storage protein, plant protein; 2.61A {Pisum sativum} Back     alignment and structure
>3qac_A 11S globulin SEED storage protein; 11S SEED storage protein (globulins) family, SEED storage PR plant protein; 2.27A {Amaranthus hypochondriacus} Back     alignment and structure
>2e9q_A 11S globulin subunit beta; cucubitin, pumpkin SEED storage globulin, plant protein; 2.20A {Cucurbita maxima} PDB: 2evx_A Back     alignment and structure
>3fz3_A Prunin; TREE NUT allergen, allergy, amandin, almond, 11S SEED storage protein, allergen; 2.40A {Prunus dulcis} PDB: 3ehk_A Back     alignment and structure
>2cav_A Protein (canavalin); vicilin, 7S SEED protein, domain duplication, swiss roll, PL protein; 2.00A {Canavalia ensiformis} SCOP: b.82.1.2 b.82.1.2 PDB: 2cau_A 1cau_B 1cav_B 1caw_B 1cax_B Back     alignment and structure
>1uij_A Beta subunit of beta conglycinin; double-stranded beta helix, SEED storage protein, sugar binding protein; 2.50A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ipk_A 1ipj_A* Back     alignment and structure
>3c3v_A Arachin ARAH3 isoform; peanut allergen, allergy, glycinin; 1.73A {Arachis hypogaea} Back     alignment and structure
>1fxz_A Glycinin G1; proglycinin, legumin, SEED storage protein, plant protein; 2.80A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ud1_A 1ucx_A Back     alignment and structure
>2ea7_A 7S globulin-1; beta barrel, cupin superfamily, plant protein; 1.80A {Vigna angularis} PDB: 2eaa_A* 2cv6_A 1uik_A Back     alignment and structure
>3s7i_A Allergen ARA H 1, clone P41B; bicupin, vicilin, storage SEED protein; 2.35A {Arachis hypogaea} PDB: 3s7e_A 3smh_A Back     alignment and structure
>1dgw_A Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_A 1cau_A 1cav_A 1caw_A 1cax_A Back     alignment and structure
>2phl_A Phaseolin; plant SEED storage protein(vicilin); HET: NAG; 2.20A {Phaseolus vulgaris} SCOP: b.82.1.2 b.82.1.2 PDB: 1phs_A* Back     alignment and structure
>2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP} Back     alignment and structure
>2e9q_A 11S globulin subunit beta; cucubitin, pumpkin SEED storage globulin, plant protein; 2.20A {Cucurbita maxima} PDB: 2evx_A Back     alignment and structure
>2ea7_A 7S globulin-1; beta barrel, cupin superfamily, plant protein; 1.80A {Vigna angularis} PDB: 2eaa_A* 2cv6_A 1uik_A Back     alignment and structure
>2cav_A Protein (canavalin); vicilin, 7S SEED protein, domain duplication, swiss roll, PL protein; 2.00A {Canavalia ensiformis} SCOP: b.82.1.2 b.82.1.2 PDB: 2cau_A 1cau_B 1cav_B 1caw_B 1cax_B Back     alignment and structure
>1uij_A Beta subunit of beta conglycinin; double-stranded beta helix, SEED storage protein, sugar binding protein; 2.50A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ipk_A 1ipj_A* Back     alignment and structure
>2phl_A Phaseolin; plant SEED storage protein(vicilin); HET: NAG; 2.20A {Phaseolus vulgaris} SCOP: b.82.1.2 b.82.1.2 PDB: 1phs_A* Back     alignment and structure
>3s7i_A Allergen ARA H 1, clone P41B; bicupin, vicilin, storage SEED protein; 2.35A {Arachis hypogaea} PDB: 3s7e_A 3smh_A Back     alignment and structure
>1fxz_A Glycinin G1; proglycinin, legumin, SEED storage protein, plant protein; 2.80A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ud1_A 1ucx_A Back     alignment and structure
>3qac_A 11S globulin SEED storage protein; 11S SEED storage protein (globulins) family, SEED storage PR plant protein; 2.27A {Amaranthus hypochondriacus} Back     alignment and structure
>3ksc_A LEGA class, prolegumin; PEA prolegumin, 11S SEED storage protein, pisum sativum L., SEED storage protein, storage protein, plant protein; 2.61A {Pisum sativum} Back     alignment and structure
>2d5f_A Glycinin A3B4 subunit; soybean, globulin, 11S,SEED storage protein, plant; 1.90A {Glycine max} PDB: 2d5h_A 1od5_A Back     alignment and structure
>3kgl_A Cruciferin; 11S SEED globulin, rapeseed, SEED storage protein, storage protein, plant protein; 2.98A {Brassica napus} Back     alignment and structure
>2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP} Back     alignment and structure
>3c3v_A Arachin ARAH3 isoform; peanut allergen, allergy, glycinin; 1.73A {Arachis hypogaea} Back     alignment and structure
>3fz3_A Prunin; TREE NUT allergen, allergy, amandin, almond, 11S SEED storage protein, allergen; 2.40A {Prunus dulcis} PDB: 3ehk_A Back     alignment and structure
>1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A Back     alignment and structure
>1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A Back     alignment and structure
>1dgw_X Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_X Back     alignment and structure
>3h8u_A Uncharacterized conserved protein with double-STR beta-helix domain; YP_001338853.1; HET: 2PE; 1.80A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2xlg_A SLL1785 protein, CUCA; metal binding protein, cupin; 1.80A {Synechocystis SP} PDB: 2xl7_A 2xl9_A 2xlf_A* 2xla_A Back     alignment and structure
>3l2h_A Putative sugar phosphate isomerase; AFE_0303, structural GEN joint center for structural genomics, JCSG; HET: MSE CXS; 1.85A {Acidithiobacillus ferrooxidans} Back     alignment and structure
>1v70_A Probable antibiotics synthesis protein; structural genomics, thermus thermophilus HB8, riken structu genomics/proteomics initiative, RSGI; 1.30A {Thermus thermophilus} SCOP: b.82.1.9 PDB: 2dct_A Back     alignment and structure
>2fqp_A Hypothetical protein BP2299; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: 1PE; 1.80A {Bordetella pertussis tohama I} Back     alignment and structure
>2gu9_A Tetracenomycin polyketide synthesis protein; X-RAY diffraction, cupin, immune system; 1.40A {Xanthomonas campestris} PDB: 2ilb_A 3h50_A Back     alignment and structure
>1lr5_A Auxin binding protein 1; beta jellyroll, double stranded beta helix, germin-like PROT protein binding; HET: NAG BMA MAN; 1.90A {Zea mays} SCOP: b.82.1.2 PDB: 1lrh_A* Back     alignment and structure
>1x82_A Glucose-6-phosphate isomerase; cupin superfamily, hyperthermophIle, phosphoglucose isomerase, extremeophIle; HET: PA5; 1.50A {Pyrococcus furiosus} SCOP: b.82.1.7 PDB: 1x7n_A* 1x8e_A 1qxr_A* 1qxj_A* 1qy4_A* 2gc1_A* 2gc0_A* 2gc2_A* 2gc3_A* 3sxw_A 1j3q_A 1j3p_A 1j3r_A* Back     alignment and structure
>2oa2_A BH2720 protein; 10175341, structural genomics, joint center for STRU genomics, JCSG, protein structure initiative, PSI-2, unknow function; HET: MSE; 1.41A {Bacillus halodurans} Back     alignment and structure
>3i7d_A Sugar phosphate isomerase; YP_168127.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.30A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>3ht1_A REMF protein; cupin fold, Zn-binding, antibiotic biosynthesis, resistomycin, metalloprotein, cyclase, lyase; 1.20A {Streptomyces resistomycificus} PDB: 3ht2_A Back     alignment and structure
>3es1_A Cupin 2, conserved barrel domain protein; YP_001165807.1; HET: MSE; 1.91A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} Back     alignment and structure
>3lag_A Uncharacterized protein RPA4178; functionally unknown protein, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.15A {Rhodopseudomonas palustris} Back     alignment and structure
>4e2g_A Cupin 2 conserved barrel domain protein; MCSG, PSI-biology, structural genomics, GEBA, midwest center structural genomics; HET: MSE; 1.86A {Sphaerobacter thermophilus} Back     alignment and structure
>3fjs_A Uncharacterized protein with RMLC-like cupin fold; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.90A {Ralstonia eutropha JMP134} Back     alignment and structure
>2f4p_A Hypothetical protein TM1010; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: UNL; 1.90A {Thermotoga maritima} SCOP: b.82.1.9 Back     alignment and structure
>3ibm_A Cupin 2, conserved barrel domain protein; cupin 2 family, metal-binding site, beta barrel, PSI-2, NYSG structural genomics; 2.00A {Halorhodospira halophila SL1} Back     alignment and structure
>3kgz_A Cupin 2 conserved barrel domain protein; metalloprotein, structural genomics, PSI-2, protein structur initiative; 1.85A {Rhodopseudomonas palustris} Back     alignment and structure
>1o4t_A Putative oxalate decarboxylase; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; 1.95A {Thermotoga maritima} SCOP: b.82.1.9 Back     alignment and structure
>3jzv_A Uncharacterized protein RRU_A2000; structural genomics, cupin-2 fold, unknown function, PSI-2, structure initiative; HET: MSE; 2.30A {Rhodospirillum rubrum} Back     alignment and structure
>2bnm_A Epoxidase; oxidoreductase, cupin, HTH, cation-dependant, zinc, fosfomycin; 1.7A {Streptomyces wedmorensis} SCOP: a.35.1.3 b.82.1.10 PDB: 1zz7_A 1zz8_A 1zz9_A 1zzb_A 1zz6_A 1zzc_A 2bnn_A 2bno_A 3scf_A 3scg_A 3sch_A Back     alignment and structure
>2b8m_A Hypothetical protein MJ0764; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.70A {Methanocaldococcus jannaschii} SCOP: b.82.1.18 Back     alignment and structure
>4i4a_A Similar to unknown protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 1.35A {Photorhabdus luminescens subsp} Back     alignment and structure
>3cew_A Uncharacterized cupin protein; all beta-protein, jelly-roll (cupin-2), structural genomics, protein structure initiative; 2.31A {Bacteroides fragilis} Back     alignment and structure
>1vj2_A Novel manganese-containing cupin TM1459; structural genomics, joint for structural genomics, JCSG; 1.65A {Thermotoga maritima} SCOP: b.82.1.10 Back     alignment and structure
>2o8q_A Hypothetical protein; cpuin-like fold, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.55A {Burkholderia xenovorans} Back     alignment and structure
>2pfw_A Cupin 2, conserved barrel domain protein; cupin domain, struc genomics, joint center for structural genomics, JCSG; 1.90A {Shewanella frigidimarina} Back     alignment and structure
>1yhf_A Hypothetical protein SPY1581; structural genomics, conserved hypothetical protein, PSI, PR structure initiative; 2.00A {Streptococcus pyogenes} SCOP: b.82.1.9 Back     alignment and structure
>2vpv_A Protein MIF2, MIF2P; nucleus, mitosis, centromere, cell cycle, DNA-binding, kinetochore, cell division, phosphoprotein, jelly-roll fold; 2.7A {Saccharomyces cerevisiae} Back     alignment and structure
>1y9q_A Transcriptional regulator, HTH_3 family; transcriptional regulaator, strucutral genomics, protein structure initiative, PSI; 1.90A {Vibrio cholerae} SCOP: a.35.1.8 b.82.1.15 Back     alignment and structure
>1rc6_A Hypothetical protein YLBA; structural genomics, NYSGXRC, SGX clone NAME 3174C1TCT3B1, T T1521, PSI, protein initiative; 2.60A {Escherichia coli} SCOP: b.82.1.11 Back     alignment and structure
>3h7j_A Bacilysin biosynthesis protein BACB; YWFC, bacilysin synthesis, anticapsin synthesis, BI-Cu double stranded beta helix, antibiotic biosynthesis; HET: PPY; 1.87A {Bacillus subtilis} PDB: 3h7y_A* 3h9a_A* Back     alignment and structure
>2q30_A Uncharacterized protein; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: MSE; 1.94A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>1sef_A Conserved hypothetical protein; structural genomics, nysgxrc target T1582, PSI, protein STRU initiative; 2.05A {Enterococcus faecalis} SCOP: b.82.1.11 Back     alignment and structure
>1y3t_A Hypothetical protein YXAG; BI cupin, dioxygenase, oxidoreductase; 2.40A {Bacillus subtilis} SCOP: b.82.1.5 PDB: 2h0v_A* Back     alignment and structure
>2ozj_A Cupin 2, conserved barrel; cupin superfamily protein, struct genomics, joint center for structural genomics, JCSG; HET: MSE; 1.60A {Desulfitobacterium hafniense} Back     alignment and structure
>3lwc_A Uncharacterized protein; structural genomics, unknown function, joint center for STRU genomics, JCSG, protein structure initiative; HET: MSE; 1.40A {Rhizobium leguminosarum} Back     alignment and structure
>1y3t_A Hypothetical protein YXAG; BI cupin, dioxygenase, oxidoreductase; 2.40A {Bacillus subtilis} SCOP: b.82.1.5 PDB: 2h0v_A* Back     alignment and structure
>3h7j_A Bacilysin biosynthesis protein BACB; YWFC, bacilysin synthesis, anticapsin synthesis, BI-Cu double stranded beta helix, antibiotic biosynthesis; HET: PPY; 1.87A {Bacillus subtilis} PDB: 3h7y_A* 3h9a_A* Back     alignment and structure
>2d40_A Z3393, putative gentisate 1,2-dioxygenase; gentisic acid, bicupin, tetramer, montreal- bacterial structural genomics initiative, BSGI; 2.41A {Escherichia coli} SCOP: b.82.1.23 Back     alignment and structure
>1sfn_A Conserved hypothetical protein; structural genomics, nysgxrc target T1583, PSI, protein STRU initiative; 2.46A {Deinococcus radiodurans} SCOP: b.82.1.11 Back     alignment and structure
>1juh_A Quercetin 2,3-dioxygenase; cupin, glycoprotein, beta sandwich, oxidoreduct; HET: NAG BMA MAN; 1.60A {Aspergillus japonicus} SCOP: b.82.1.5 PDB: 1gqh_A* 1h1i_A* 1h1m_A* 1gqg_A* Back     alignment and structure
>2d40_A Z3393, putative gentisate 1,2-dioxygenase; gentisic acid, bicupin, tetramer, montreal- bacterial structural genomics initiative, BSGI; 2.41A {Escherichia coli} SCOP: b.82.1.23 Back     alignment and structure
>3d82_A Cupin 2, conserved barrel domain protein; structural genomics, joint center for structural genomics; 2.05A {Shewanella frigidimarina ncimb 400} Back     alignment and structure
>2opk_A Hypothetical protein; putative mannose-6-phosphate isomerase, structural genomics, center for structural genomics, JCSG; 2.10A {Ralstonia eutropha} Back     alignment and structure
>2i45_A Hypothetical protein; neisseria meningitidis cupin domain, structural genomics, PS protein structure initiative; 2.50A {Neisseria meningitidis} Back     alignment and structure
>1sq4_A GLXB, glyoxylate-induced protein; structural genomics, double beta barrel protein, PSI, protei structure initiative; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.11 Back     alignment and structure
>1rc6_A Hypothetical protein YLBA; structural genomics, NYSGXRC, SGX clone NAME 3174C1TCT3B1, T T1521, PSI, protein initiative; 2.60A {Escherichia coli} SCOP: b.82.1.11 Back     alignment and structure
>2pyt_A Ethanolamine utilization protein EUTQ; structural genomics, joint center for structural genomics, J protein structure initiative; 1.90A {Salmonella typhimurium LT2} SCOP: b.82.1.24 Back     alignment and structure
>3rns_A Cupin 2 conserved barrel domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 2.07A {Leptotrichia buccalis} Back     alignment and structure
>3rns_A Cupin 2 conserved barrel domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 2.07A {Leptotrichia buccalis} Back     alignment and structure
>1sef_A Conserved hypothetical protein; structural genomics, nysgxrc target T1582, PSI, protein STRU initiative; 2.05A {Enterococcus faecalis} SCOP: b.82.1.11 Back     alignment and structure
>4e2q_A Ureidoglycine aminohydrolase; BI-cupin, manganese binding, endoplasmic RET hydrolase; 2.50A {Arabidopsis thaliana} PDB: 4e2s_A Back     alignment and structure
>3bu7_A Gentisate 1,2-dioxygenase; cupin domain, oxidoreductase, plasmid; 2.80A {Silicibacter pomeroyi} SCOP: b.82.1.23 Back     alignment and structure
>4b29_A Dimethylsulfoniopropionate lyase; hydrolase, dimethylsulfide, sulphur cycle; 1.72A {Roseovarius nubinhibens ism} Back     alignment and structure
>1dgw_Y Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_Y Back     alignment and structure
>1sq4_A GLXB, glyoxylate-induced protein; structural genomics, double beta barrel protein, PSI, protei structure initiative; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.11 Back     alignment and structure
>3bu7_A Gentisate 1,2-dioxygenase; cupin domain, oxidoreductase, plasmid; 2.80A {Silicibacter pomeroyi} SCOP: b.82.1.23 Back     alignment and structure
>4e2q_A Ureidoglycine aminohydrolase; BI-cupin, manganese binding, endoplasmic RET hydrolase; 2.50A {Arabidopsis thaliana} PDB: 4e2s_A Back     alignment and structure
>4h7l_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, cupin, unknown function; 2.45A {Planctomyces limnophilus} Back     alignment and structure
>3nw4_A Gentisate 1,2-dioxygenase; beta-barrel, oxidoreductase; HET: GTQ; 2.00A {Pseudaminobacter salicylatoxidans} PDB: 3nvc_A* 3nst_A* 3njz_A* 2phd_A* 3nkt_A* 3nl1_A* 4fag_A* 4fbf_A 4fah_A Back     alignment and structure
>1vr3_A Acireductone dioxygenase; 13543033, structural genomics, JOI for structural genomics, JCSG, protein structure initiative oxidoreductase; 2.06A {Mus musculus} SCOP: b.82.1.6 Back     alignment and structure
>4axo_A EUTQ, ethanolamine utilization protein; structural protein, bacterial microcompartment, BMC; 1.00A {Clostridium difficile} Back     alignment and structure
>1o5u_A Novel thermotoga maritima enzyme TM1112; cupin, structural genomics center for structural genomics, JCSG, protein structure INI PSI; 1.83A {Thermotoga maritima} SCOP: b.82.1.8 PDB: 1lkn_A 2k9z_A Back     alignment and structure
>3ebr_A Uncharacterized RMLC-like cupin; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.60A {Ralstonia eutropha JMP134} Back     alignment and structure
>1zrr_A E-2/E-2' protein; nickel, cupin, beta helix, methionine salvage, oxidoreductase; NMR {Klebsiella oxytoca} SCOP: b.82.1.6 PDB: 2hji_A Back     alignment and structure
>3bcw_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.60A {Bordetella bronchiseptica RB50} Back     alignment and structure
>1yfu_A 3-hydroxyanthranilate-3,4-dioxygenase; cupin, oxidoreductase; 1.90A {Cupriavidus metallidurans} SCOP: b.82.1.20 PDB: 1yfw_A* 1yfx_A* 1yfy_A* Back     alignment and structure
>1juh_A Quercetin 2,3-dioxygenase; cupin, glycoprotein, beta sandwich, oxidoreduct; HET: NAG BMA MAN; 1.60A {Aspergillus japonicus} SCOP: b.82.1.5 PDB: 1gqh_A* 1h1i_A* 1h1m_A* 1gqg_A* Back     alignment and structure
>2o1q_A Putative acetyl/propionyl-COA carboxylase, alpha; putative acetylacetone dioxygenase, structural genomics; HET: MSE PG4; 1.50A {Methylibium petroleiphilum} SCOP: b.82.1.21 Back     alignment and structure
>1sfn_A Conserved hypothetical protein; structural genomics, nysgxrc target T1583, PSI, protein STRU initiative; 2.46A {Deinococcus radiodurans} SCOP: b.82.1.11 Back     alignment and structure
>3eqe_A Putative cystein deoxygenase; YUBC, SR112, NESG, structural genomics, PSI-2, protein structure initiative; 2.82A {Bacillus subtilis} Back     alignment and structure
>3cjx_A Protein of unknown function with A cupin-like FOL; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.60A {Ralstonia eutropha} Back     alignment and structure
>2y0o_A Probable D-lyxose ketol-isomerase; carbohydrate metabolism, metal-binding, sugar ISO stress response; HET: MSE; 1.23A {Bacillus subtilis subsp} Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>3nw4_A Gentisate 1,2-dioxygenase; beta-barrel, oxidoreductase; HET: GTQ; 2.00A {Pseudaminobacter salicylatoxidans} PDB: 3nvc_A* 3nst_A* 3njz_A* 2phd_A* 3nkt_A* 3nl1_A* 4fag_A* 4fbf_A 4fah_A Back     alignment and structure
>2gm6_A Cysteine dioxygenase type I; structural genomics, J center for structural genomics, JCSG, protein structure INI PSI-2, oxidoreductase; 1.84A {Ralstonia eutropha} SCOP: b.82.1.19 Back     alignment and structure
>2arc_A ARAC, arabinose operon regulatory protein; transcription factor, carbohydrate binding, coiled-coil, jelly roll; HET: ARA; 1.50A {Escherichia coli} SCOP: b.82.4.1 PDB: 2aac_A* 1xja_A 2ara_A Back     alignment and structure
>1zvf_A 3-hydroxyanthranilate 3,4-dioxygenase; jellyroll beta-barrel, oxidoreductase; 2.41A {Saccharomyces cerevisiae} SCOP: b.82.1.20 Back     alignment and structure
>3d0j_A Uncharacterized protein CA_C3497; beta-barrel, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.53A {Clostridium acetobutylicum atcc 824} Back     alignment and structure
>3bal_A Acetylacetone-cleaving enzyme; jelly roll, tetramer, dioxygenase, iron, metal-binding, oxidoreductase; 1.95A {Acinetobacter johnsonii} Back     alignment and structure
>2qnk_A 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fold, cupin barrel, extradiol dioxygenase, metalloen trytophan catabolism, NAD+ synthesis; HET: MSE; 1.60A {Homo sapiens} PDB: 3fe5_A Back     alignment and structure
>3o14_A Anti-ecfsigma factor, CHRR; cupin, structural genomics, joint center for structura genomics, JCSG, protein structure initiative; HET: MSE; 1.70A {Marinobacter aquaeolei} Back     alignment and structure
>3eln_A Cysteine dioxygenase type 1; peroxysulfenate, non-heme dioxygenases, Fe2+ metalloenzyme, taurine, thioether, iron, metal- binding; 1.42A {Rattus norvegicus} SCOP: b.82.1.19 PDB: 2gh2_A 2b5h_A 2atf_A* 2q4s_A 2ic1_A Back     alignment and structure
>3myx_A Uncharacterized protein pspto_0244; protein of unknown function (DUF861), cupin_3 (PF05899), STR genomics; HET: MSE; 1.30A {Pseudomonas syringae PV} Back     alignment and structure
>2pa7_A DTDP-6-deoxy-3,4-keto-hexulose isomerase; deoxysugar biosynthesis, S-layer biosynthesis, ketoisomerase; HET: TYD; 1.50A {Aneurinibacillus thermoaerophilus} SCOP: b.82.1.1 PDB: 2pae_A* 2pak_A* 2pam_A* Back     alignment and structure
>3uss_A Putative uncharacterized protein; cupin, three histidine, non-heme iron, cysteine catabolism, oxidoreductase; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.19 Back     alignment and structure
>3ejk_A DTDP sugar isomerase; YP_390184.1, structural genomics, JOIN for structural genomics, JCSG; HET: CIT; 1.95A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>3es4_A Uncharacterized protein DUF861 with A RMLC-like C; 17741406, protein of unknown function (DUF861) with A RMLC-L fold; HET: MSE; 1.64A {Agrobacterium tumefaciens str} Back     alignment and structure
>3gbg_A TCP pilus virulence regulatory protein; cupin, helix-turn-helix, ARAC family, activator, DNA-binding transcription, transcription regulation; HET: PAM; 1.90A {Vibrio cholerae} Back     alignment and structure
>3myx_A Uncharacterized protein pspto_0244; protein of unknown function (DUF861), cupin_3 (PF05899), STR genomics; HET: MSE; 1.30A {Pseudomonas syringae PV} Back     alignment and structure
>1yud_A Hypothetical protein SO0799; SOR12, Q8E1N8, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.70A {Shewanella oneidensis} SCOP: b.82.1.16 Back     alignment and structure
>3o14_A Anti-ecfsigma factor, CHRR; cupin, structural genomics, joint center for structura genomics, JCSG, protein structure initiative; HET: MSE; 1.70A {Marinobacter aquaeolei} Back     alignment and structure
>2vec_A YHAK, pirin-like protein YHAK; ROS, bicupin, sulfenic acid, reactive cysteine, cytosolic protein; 1.85A {Escherichia coli} Back     alignment and structure
>1vrb_A Putative asparaginyl hydroxylase; 2636534, structural genomi center for structural genomics, JCSG, protein structure INI PSI, oxidoreductase; 2.60A {Bacillus subtilis} SCOP: b.82.2.11 Back     alignment and structure
>1ep0_A DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; racemase, DTDP-4-dehydrorhamnose epimerase, structural genomics, PSI; 1.50A {Methanothermobacterthermautotrophicus} SCOP: b.82.1.1 PDB: 1epz_A* Back     alignment and structure
>1tq5_A Protein YHHW; bicupin, pirin, montreal-kingston bacterial structural genomics initiative, BSGI, structural genomics, unknown function; 1.76A {Escherichia coli} SCOP: b.82.1.12 Back     alignment and structure
>3ryk_A DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pathway, STRU genomics, infectious diseases; HET: TYD; 1.63A {Bacillus anthracis str} Back     alignment and structure
>2ixk_A DTDP-4-dehydrorhamnose 3,5-epimerase; isomerase, lipopolysaccharide biosynthesis, epimerise, epimerize; HET: TDO; 1.7A {Pseudomonas aeruginosa} PDB: 2ixi_A* 2ixh_A* 1rtv_A* 2ixj_A* Back     alignment and structure
>1nxm_A DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; jelly roll-like structure, beta sheet, isomerase; 1.30A {Streptococcus suis} SCOP: b.82.1.1 PDB: 1nyw_A* 1nzc_A* 2ixl_A* Back     alignment and structure
>1wlt_A 176AA long hypothetical DTDP-4-dehydrorhamnose 3, 5-epimerase; jelly roll-like topology, flattened barrel, isomerase; 1.90A {Sulfolobus tokodaii} SCOP: b.82.1.1 PDB: 2b9u_A Back     alignment and structure
>1dzr_A DTDP-4-dehydrorhamnose 3\,5-epimerase; isomerase, 3\,5-hexulose epimerase; 2.17A {Salmonella typhimurium} SCOP: b.82.1.1 PDB: 1dzt_A* Back     alignment and structure
>3bb6_A Uncharacterized protein YEAR; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Escherichia coli} SCOP: b.82.2.13 Back     alignment and structure
>1oi6_A PCZA361.16; epimerase, vancomycin group antibiotic, EVAD, isomerase; HET: TMP; 1.4A {Amycolatopsis orientalis} SCOP: b.82.1.1 PDB: 1ofn_A* 1wa4_A Back     alignment and structure
>4gjz_A Lysine-specific demethylase 8; JMJC, beta barrel, Fe(II) and 2-oxoglutarate binding, oxidor; HET: AKG BME; 1.05A {Homo sapiens} PDB: 4gjy_A* 4aap_A* 3uyj_A* Back     alignment and structure
>2c0z_A NOVW; isomerase, epimerase, antibiotic biosynthesis, RMLC-like cupin; 1.60A {Streptomyces sphaeroides} SCOP: b.82.1.1 Back     alignment and structure
>1upi_A DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pathway, PSI, protein structure initiative, TB structural genomics consortium, TB; HET: CME; 1.7A {Mycobacterium tuberculosis} SCOP: b.82.1.1 PDB: 2ixc_A* 1pm7_A* Back     alignment and structure
>4hn1_A Putative 3-epimerase in D-allose pathway; 3'-monoepimerase, natural product, deoxysugar, chalcomycin, mycinose, cupin fold; HET: TYD THM; 1.60A {Streptomyces bikiniensis} PDB: 4hmz_A* 4hn0_A Back     alignment and structure
>3kmh_A D-lyxose isomerase; cupin beta-barrel, structural genomics, montreal-kingston BA structural genomics initiative, BSGI; 1.58A {Escherichia coli O157} PDB: 3mpb_A* Back     alignment and structure
>2xdv_A MYC-induced nuclear antigen; ribosome biogenesis, nuclear protein; HET: OGA; 2.57A {Homo sapiens} Back     alignment and structure
>3d8c_A Hypoxia-inducible factor 1 alpha inhibitor; FIH, HIF, DSBH, oxygenase, transcription, inhibitor oxoglutarate, asparaginyl hydroxylase; HET: AKG; 2.10A {Homo sapiens} PDB: 2ilm_A* 2w0x_A* 1h2l_A* 1h2m_A* 1h2n_A* 1yci_A* 2cgn_A 2cgo_A* 1h2k_A* 2wa3_A* 2wa4_A* 3od4_A* 3p3n_A* 3p3p_A* 2yc0_A* 2y0i_A* 2yde_A* 1mze_A* 1mzf_A* 2xum_A* ... Back     alignment and structure
>4diq_A Lysine-specific demethylase NO66; structural genomics, structural genomics consortium, SGC, HI demethylase, oxidoreductase; HET: PD2; 2.40A {Homo sapiens} Back     alignment and structure
>3al5_A HTYW5, JMJC domain-containing protein C2ORF60; tRNA modification enzyme, unknown function; 2.50A {Homo sapiens} PDB: 3al6_A* Back     alignment and structure
>2qdr_A Uncharacterized protein; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: MSE EPE; 2.60A {Nostoc punctiforme} Back     alignment and structure
>1e5r_A Proline oxidase; oxidoreductase, oxygenase, 2-oxoglutarate dependent oxygenase; 2.30A {Streptomyces SP} SCOP: b.82.2.4 PDB: 1e5s_A Back     alignment and structure
>3k2o_A Bifunctional arginine demethylase and lysyl-hydro JMJD6; structural genomics consortium, SGC, chromatin regulator, developmental protein; 1.75A {Homo sapiens} PDB: 3ld8_A 3ldb_A* Back     alignment and structure
>2qjv_A Uncharacterized IOLB-like protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MLY MSE; 1.90A {Salmonella typhimurium LT2} Back     alignment and structure
>2qnk_A 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fold, cupin barrel, extradiol dioxygenase, metalloen trytophan catabolism, NAD+ synthesis; HET: MSE; 1.60A {Homo sapiens} PDB: 3fe5_A Back     alignment and structure
>2p17_A Pirin-like protein; GK1651, structural genomics, south collaboratory for structural genomics, protein structure in secsg; 1.52A {Geobacillus kaustophilus} Back     alignment and structure
>1eyb_A Homogentisate 1,2-dioxygenase; jelly roll, beta sandwich, oxidoreductase; 1.90A {Homo sapiens} SCOP: b.82.1.4 PDB: 1ey2_A Back     alignment and structure
>2yu1_A JMJC domain-containing histone demethylation PROT; JMJC-domain-containing histone demethylases, oxidoreductase; HET: AKG; 2.70A {Homo sapiens} PDB: 2yu2_A Back     alignment and structure
>3rcq_A Aspartyl/asparaginyl beta-hydroxylase; structural genomics, structural genomics consortium, SGC, oxidoreductase, human; HET: OGA; 2.05A {Homo sapiens} Back     alignment and structure
>2oyz_A UPF0345 protein VPA0057; unknown function, structural genomi 2, protein structure initiative, midwest center for structu genomics, MCSG; 1.71A {Vibrio parahaemolyticus} SCOP: b.82.1.22 Back     alignment and structure
>1xru_A 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomer; beta barrel, cupin, isomerase; HET: 1PE; 1.94A {Escherichia coli} SCOP: b.82.1.13 PDB: 1x8m_A Back     alignment and structure
>3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* Back     alignment and structure
>3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} Back     alignment and structure
>3hqx_A UPF0345 protein aciad0356; DUF1255,PF06865,PSI2,MCSG, structural genomics, protein STRU initiative, midwest center for structural genomics; 1.66A {Acinetobacter SP} SCOP: b.82.1.0 Back     alignment and structure
>3kv9_A JMJC domain-containing histone demethylation protein 1D; jumonji domain lysine demethylase, metal-binding, zinc, zinc-finger; 2.29A {Homo sapiens} PDB: 3kva_A* 3kvb_A* 3u78_A* Back     alignment and structure
>3k3o_A PHF8, PHD finger protein 8; histone demethylase, chromatin modification, methylated H3K9, mental retardation, metal-BI phosphoprotein, zinc-finger; HET: AKG; 2.10A {Homo sapiens} PDB: 3k3n_A* 4do0_A* 2wwu_A* Back     alignment and structure
>1j1l_A Pirin; beta sandwich, cupin, iron, metatl binding protein; 2.10A {Homo sapiens} SCOP: b.82.1.12 PDB: 3acl_A* Back     alignment and structure
>1ywk_A 4-deoxy-L-threo-5-hexosulose-uronate ketol- isomerase 1; structural genomics, nysgxrc target T1814, PSI, protein structure initiative; 2.95A {Enterococcus faecalis} SCOP: b.82.1.13 Back     alignment and structure
>1qwr_A Mannose-6-phosphate isomerase; structural genomics, D-mannose 6-phosphate, PSI, protein structure initiative; 1.80A {Bacillus subtilis} SCOP: b.82.1.3 Back     alignment and structure
>3pua_A GRC5, PHD finger protein 2; alpha-ketoglutarate-Fe2+ dependent dioxygenases, histone TAI protein, protein binding; HET: OGA; 1.89A {Homo sapiens} PDB: 3pu3_A* 3ptr_B* 3pu8_B* 3pus_A* Back     alignment and structure
>1pmi_A PMI, phosphomannose isomerase; aldose-ketose isomerase; 1.70A {Candida albicans} SCOP: b.82.1.3 Back     alignment and structure
>3dl3_A Tellurite resistance protein B; X-RAY NESG VFR98 Q5E3X2_VIBF1, structural genomics, PSI-2, protein structure initiative; 2.30A {Vibrio fischeri ES114} SCOP: b.82.2.13 Back     alignment and structure
>2rg4_A Uncharacterized protein; rhodobacterales, oceanicola granulosus HTCC2516, Q2CBJ1_9RHO structural genomics, PSI-2; 1.90A {Oceanicola granulosus} PDB: 3bvc_A Back     alignment and structure
>2wfp_A Mannose-6-phosphate isomerase; APO-structure, metal-binding; 1.67A {Salmonella typhimurium} PDB: 3h1w_A 3h1m_A 3h1y_A* Back     alignment and structure
>3eo6_A Protein of unknown function (DUF1255); AFE_2634, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 0.97A {Acidithiobacillus ferrooxidans ATCC23270} Back     alignment and structure
>3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* Back     alignment and structure
>1tq5_A Protein YHHW; bicupin, pirin, montreal-kingston bacterial structural genomics initiative, BSGI, structural genomics, unknown function; 1.76A {Escherichia coli} SCOP: b.82.1.12 Back     alignment and structure
>1zx5_A Mannosephosphate isomerase, putative; STRU genomics, PSI, protein structure initiative, midwest center structural genomics, MCSG; HET: LFR; 2.30A {Archaeoglobus fulgidus} SCOP: b.82.1.3 Back     alignment and structure
>3m3i_A Putative uncharacterized protein; PFAM:PF06172, structural genomics, structural genomics of pathogenic protozoa consortium, SGPP; 2.35A {Leishmania major} Back     alignment and structure
>3loi_A Putative uncharacterized protein; beta barrel, unknown function; 2.10A {Branchiostoma belcheri tsingtauense} SCOP: b.82.1.0 PDB: 3lzz_A* Back     alignment and structure
>3mdp_A Cyclic nucleotide-binding domain (CNMP-BD) protei; structural genomics, joint center for structural genomics; HET: MSE; 1.90A {Geobacter metallireducens} Back     alignment and structure
>2qjv_A Uncharacterized IOLB-like protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MLY MSE; 1.90A {Salmonella typhimurium LT2} Back     alignment and structure
>2pqq_A Putative transcriptional regulator; APC7345, streptomyces coelicolor structural genomics, PSI-2, protein structure initiative; 2.00A {Streptomyces coelicolor A3} Back     alignment and structure
>1j1l_A Pirin; beta sandwich, cupin, iron, metatl binding protein; 2.10A {Homo sapiens} SCOP: b.82.1.12 PDB: 3acl_A* Back     alignment and structure
>2p17_A Pirin-like protein; GK1651, structural genomics, south collaboratory for structural genomics, protein structure in secsg; 1.52A {Geobacillus kaustophilus} Back     alignment and structure
>3dn7_A Cyclic nucleotide binding regulatory protein; structural genomics, APC88869, cyclic nucleotide binding REG protein, PSI-2; 1.80A {Cytophaga hutchinsonii} Back     alignment and structure
>4ev0_A Transcription regulator, CRP family; CAMP binding, winged helix-turn-helix motif, DNA binding, transcription activator; HET: CMP; 2.40A {Thermus thermophilus} Back     alignment and structure
>2oz6_A Virulence factor regulator; winged helix, helix-turn-helix, transcription factor, CAMP-B proteins, CAMP receptor protein; HET: CMP; 2.80A {Pseudomonas aeruginosa} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>2ypd_A Probable JMJC domain-containing histone demethyla PROT EIN 2C; oxidoreductase; 2.10A {Homo sapiens} Back     alignment and structure
>1znp_A Hypothetical protein ATU3615; NESG, ATR55, Q8U9W0, structural genomics, PSI, protein struc initiative; 2.50A {Agrobacterium tumefaciens str} SCOP: b.82.1.16 Back     alignment and structure
>2vec_A YHAK, pirin-like protein YHAK; ROS, bicupin, sulfenic acid, reactive cysteine, cytosolic protein; 1.85A {Escherichia coli} Back     alignment and structure
>3iwz_A CAP-like, catabolite activation-like protein; XCC, pathogenicity, CRP, CLP, C-DI-GMP receptor, quorum SENS binding, transcription; 2.30A {Xanthomonas campestris PV} Back     alignment and structure
>1qwr_A Mannose-6-phosphate isomerase; structural genomics, D-mannose 6-phosphate, PSI, protein structure initiative; 1.80A {Bacillus subtilis} SCOP: b.82.1.3 Back     alignment and structure
>3fx3_A Cyclic nucleotide-binding protein; helix_TURN_helix, CAMP regulatory protein, structural genomi 2, protein structure initiative; 2.20A {Ruegeria pomeroyi} PDB: 3h3z_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 222
d2et1a1201 b.82.1.2 (A:1-201) Germin {Barley (Hordeum vulgare 7e-64
d1fxza2174 b.82.1.2 (A:297-470) Seed storage 7S protein {Soyb 5e-34
d1j58a_372 b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {B 3e-30
d1j58a_ 372 b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {B 6e-25
g1dgw.1168 b.82.1.2 (X:,Y:) Seed storage 7S protein {Jack bea 6e-30
d1od5a2173 b.82.1.2 (A:321-493) Seed storage 7S protein {Soyb 1e-29
d2phla2162 b.82.1.2 (A:220-381) Seed storage 7S protein {Fren 4e-27
d1uika2185 b.82.1.2 (A:351-535) Seed storage 7S protein {Soyb 2e-26
d1uija1170 b.82.1.2 (A:6-175) Seed storage 7S protein {Soybea 6e-26
d1dgwa_178 b.82.1.2 (A:) Seed storage 7S protein {Jack bean ( 4e-24
d1uika1203 b.82.1.2 (A:148-350) Seed storage 7S protein {Soyb 7e-20
d2phla1200 b.82.1.2 (A:11-210) Seed storage 7S protein {Frenc 9e-20
d1juha_ 348 b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergill 1e-09
d1juha_348 b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergill 2e-08
d1y3ta1330 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Baci 2e-09
d1y3ta1 330 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Baci 3e-07
d2d40a1 308 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Es 1e-07
d2d40a1308 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Es 6e-04
d1o4ta_115 b.82.1.9 (A:) Hypothetical protein TM1287 {Thermot 4e-07
d1lr5a_160 b.82.1.2 (A:) Auxin binding protein {Maize (Zea ma 5e-07
d1yhfa1112 b.82.1.9 (A:1-112) Hypothetical protein SPy1581 {S 8e-06
d1v70a_105 b.82.1.9 (A:) Hypothetical protein TTHA0104 {Therm 3e-05
d2bnma2122 b.82.1.10 (A:77-198) Hydroxypropylphosphonic acid 4e-05
d3bu7a1355 b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Si 4e-05
d1od5a1245 b.82.1.2 (A:7-251) Seed storage 7S protein {Soybea 7e-05
d2o1qa1144 b.82.1.21 (A:1-144) Putative acetyl/propionyl-CoA 1e-04
d1sefa_250 b.82.1.11 (A:) Hypothetical protein EF2996 {Entero 1e-04
d1zrra1179 b.82.1.6 (A:1-179) Acireductone dioxygenase {Klebs 2e-04
d1vr3a1179 b.82.1.6 (A:1-179) Acireductone dioxygenase {Mouse 2e-04
d1fxza1239 b.82.1.2 (A:10-248) Seed storage 7S protein {Soybe 3e-04
d1vj2a_114 b.82.1.10 (A:) Hypothetical protein TM1459 {Thermo 3e-04
d1x82a_190 b.82.1.7 (A:) Glucose-6-phosphate isomerase, GPI { 7e-04
d2pyta1128 b.82.1.24 (A:100-227) Ethanolamine utilization pro 0.001
d1sq4a_273 b.82.1.11 (A:) Glyoxylate-induced protein PA1140 { 0.001
d1sfna_245 b.82.1.11 (A:) Hypothetical protein DR1152 {Deinoc 0.001
d2phda1351 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Ps 0.002
>d2et1a1 b.82.1.2 (A:1-201) Germin {Barley (Hordeum vulgare) [TaxId: 4513]} Length = 201 Back     information, alignment and structure

class: All beta proteins
fold: Double-stranded beta-helix
superfamily: RmlC-like cupins
family: Germin/Seed storage 7S protein
domain: Germin
species: Barley (Hordeum vulgare) [TaxId: 4513]
 Score =  194 bits (495), Expect = 7e-64
 Identities = 77/202 (38%), Positives = 111/202 (54%), Gaps = 6/202 (2%)

Query: 24  TDPPPLQDFCIADTASPSSFYNNGVPCLNPNSAVSSHFVTSALAKPGKTSGNIFGFNATL 83
           TDP PLQDFC+AD    +   N G  C   + A      +S L K G TS    G   T 
Sbjct: 1   TDPDPLQDFCVADLDGKAVSVN-GHTCKPMSEAGDDFLFSSKLTKAGNTS-TPNGSAVTE 58

Query: 84  TNTKNLPGVNTMGLTMARIDIAANGIVPPHTHPRASEVTICLKGALLVGFV---DTLGRL 140
            +    PG NT+G++M R+D A  G  PPH HPRA+E+ + +KG LLVG +   D+  +L
Sbjct: 59  LDVAEWPGTNTLGVSMNRVDFAPGGTNPPHIHPRATEIGMVMKGELLVGILGSLDSGNKL 118

Query: 141 FTQQLRPGDSFVFPKGLIHFLYNMDSSKPALALSGLSSQNPGLQMTSMATFASKPPIPDE 200
           +++ +R G++FV P+GL+HF +N      A  +   +SQNPG+    +  F S PPIP  
Sbjct: 119 YSRVVRAGETFVIPRGLMHFQFN-VGKTEAYMVVSFNSQNPGIVFVPLTLFGSDPPIPTP 177

Query: 201 VLKKAFQITRQDVSIIRKNLGG 222
           VL KA ++    V +++    G
Sbjct: 178 VLTKALRVEAGVVELLKSKFAG 199


>d1fxza2 b.82.1.2 (A:297-470) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} Length = 174 Back     information, alignment and structure
>d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} Length = 372 Back     information, alignment and structure
>d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} Length = 372 Back     information, alignment and structure
>d1od5a2 b.82.1.2 (A:321-493) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} Length = 173 Back     information, alignment and structure
>d2phla2 b.82.1.2 (A:220-381) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} Length = 162 Back     information, alignment and structure
>d1uika2 b.82.1.2 (A:351-535) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} Length = 185 Back     information, alignment and structure
>d1uija1 b.82.1.2 (A:6-175) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin beta subunit [TaxId: 3847]} Length = 170 Back     information, alignment and structure
>d1dgwa_ b.82.1.2 (A:) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId: 3823]} Length = 178 Back     information, alignment and structure
>d1uika1 b.82.1.2 (A:148-350) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} Length = 203 Back     information, alignment and structure
>d2phla1 b.82.1.2 (A:11-210) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} Length = 200 Back     information, alignment and structure
>d1juha_ b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId: 34381]} Length = 348 Back     information, alignment and structure
>d1juha_ b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId: 34381]} Length = 348 Back     information, alignment and structure
>d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]} Length = 330 Back     information, alignment and structure
>d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]} Length = 330 Back     information, alignment and structure
>d2d40a1 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]} Length = 308 Back     information, alignment and structure
>d2d40a1 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]} Length = 308 Back     information, alignment and structure
>d1o4ta_ b.82.1.9 (A:) Hypothetical protein TM1287 {Thermotoga maritima [TaxId: 2336]} Length = 115 Back     information, alignment and structure
>d1lr5a_ b.82.1.2 (A:) Auxin binding protein {Maize (Zea mays) [TaxId: 4577]} Length = 160 Back     information, alignment and structure
>d1yhfa1 b.82.1.9 (A:1-112) Hypothetical protein SPy1581 {Streptococcus pyogenes [TaxId: 1314]} Length = 112 Back     information, alignment and structure
>d1v70a_ b.82.1.9 (A:) Hypothetical protein TTHA0104 {Thermus thermophilus [TaxId: 274]} Length = 105 Back     information, alignment and structure
>d2bnma2 b.82.1.10 (A:77-198) Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain {Streptomyces wedmorensis [TaxId: 43759]} Length = 122 Back     information, alignment and structure
>d3bu7a1 b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [TaxId: 89184]} Length = 355 Back     information, alignment and structure
>d1od5a1 b.82.1.2 (A:7-251) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} Length = 245 Back     information, alignment and structure
>d2o1qa1 b.82.1.21 (A:1-144) Putative acetyl/propionyl-CoA carboxylase subunit alpha Mpe_A3659 {Rubrivivax gelatinosus [TaxId: 28068]} Length = 144 Back     information, alignment and structure
>d1sefa_ b.82.1.11 (A:) Hypothetical protein EF2996 {Enterococcus faecalis [TaxId: 1351]} Length = 250 Back     information, alignment and structure
>d1zrra1 b.82.1.6 (A:1-179) Acireductone dioxygenase {Klebsiella pneumoniae [TaxId: 573]} Length = 179 Back     information, alignment and structure
>d1vr3a1 b.82.1.6 (A:1-179) Acireductone dioxygenase {Mouse (Mus musculus) [TaxId: 10090]} Length = 179 Back     information, alignment and structure
>d1fxza1 b.82.1.2 (A:10-248) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} Length = 239 Back     information, alignment and structure
>d1vj2a_ b.82.1.10 (A:) Hypothetical protein TM1459 {Thermotoga maritima [TaxId: 2336]} Length = 114 Back     information, alignment and structure
>d1x82a_ b.82.1.7 (A:) Glucose-6-phosphate isomerase, GPI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 190 Back     information, alignment and structure
>d2pyta1 b.82.1.24 (A:100-227) Ethanolamine utilization protein EutQ {Salmonella typhimurium [TaxId: 90371]} Length = 128 Back     information, alignment and structure
>d1sq4a_ b.82.1.11 (A:) Glyoxylate-induced protein PA1140 {Pseudomonas aeruginosa [TaxId: 287]} Length = 273 Back     information, alignment and structure
>d1sfna_ b.82.1.11 (A:) Hypothetical protein DR1152 {Deinococcus radiodurans [TaxId: 1299]} Length = 245 Back     information, alignment and structure
>d2phda1 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Pseudaminobacter salicylatoxidans [TaxId: 93369]} Length = 351 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query222
d2et1a1201 Germin {Barley (Hordeum vulgare) [TaxId: 4513]} 100.0
d1fxza2174 Seed storage 7S protein {Soybean (Glycine max), pr 100.0
d1od5a2173 Seed storage 7S protein {Soybean (Glycine max), gl 100.0
d1uika2185 Seed storage 7S protein {Soybean (Glycine max), be 99.98
g1dgw.1168 Seed storage 7S protein {Jack bean (Canavalia ensi 99.97
d1j58a_372 Oxalate decarboxylase OxdC (YvrK) {Bacillus subtil 99.96
d2phla2162 Seed storage 7S protein {French bean (Phaseolus vu 99.94
d1uija1170 Seed storage 7S protein {Soybean (Glycine max), be 99.92
d1dgwa_178 Seed storage 7S protein {Jack bean (Canavalia ensi 99.92
d1j58a_ 372 Oxalate decarboxylase OxdC (YvrK) {Bacillus subtil 99.91
d1uika1203 Seed storage 7S protein {Soybean (Glycine max), be 99.89
d2phla1200 Seed storage 7S protein {French bean (Phaseolus vu 99.87
d1od5a1245 Seed storage 7S protein {Soybean (Glycine max), gl 99.81
d1fxza1239 Seed storage 7S protein {Soybean (Glycine max), pr 99.8
d1o4ta_115 Hypothetical protein TM1287 {Thermotoga maritima [ 99.63
d1v70a_105 Hypothetical protein TTHA0104 {Thermus thermophilu 99.6
d1lr5a_160 Auxin binding protein {Maize (Zea mays) [TaxId: 45 99.55
d2b8ma1108 Hypothetical protein MJ0764 {Archaeon Methanococcu 99.54
d1y9qa299 Probable transcriptional regulator VC1968, C-termi 99.51
d1vj2a_114 Hypothetical protein TM1459 {Thermotoga maritima [ 99.5
d2f4pa1134 Hypothetical protein TM1010 {Thermotoga maritima [ 99.42
d1x82a_190 Glucose-6-phosphate isomerase, GPI {Archaeon Pyroc 99.37
d1yhfa1112 Hypothetical protein SPy1581 {Streptococcus pyogen 99.3
d1sefa_250 Hypothetical protein EF2996 {Enterococcus faecalis 99.24
d2bnma2122 Hydroxypropylphosphonic acid epoxidase Fom4, C-ter 99.2
d1juha_ 348 Quercetin 2,3-dioxygenase {Aspergillus japonicus [ 99.2
d1sfna_245 Hypothetical protein DR1152 {Deinococcus radiodura 99.19
d2d40a1 308 Gentisate 1,2-dioxygenase {Escherichia coli [TaxId 99.18
d1y3ta1 330 Hypothetical protein YxaG {Bacillus subtilis [TaxI 99.17
d1y3ta1330 Hypothetical protein YxaG {Bacillus subtilis [TaxI 99.17
d1sq4a_273 Glyoxylate-induced protein PA1140 {Pseudomonas aer 99.16
d1rc6a_253 Hypothetical protein YlbA {Escherichia coli [TaxId 99.14
d1sq4a_273 Glyoxylate-induced protein PA1140 {Pseudomonas aer 99.06
d1sefa_250 Hypothetical protein EF2996 {Enterococcus faecalis 99.05
d1juha_348 Quercetin 2,3-dioxygenase {Aspergillus japonicus [ 99.04
d2pyta1128 Ethanolamine utilization protein EutQ {Salmonella 99.01
d2phda1 351 Gentisate 1,2-dioxygenase {Pseudaminobacter salicy 98.99
d1rc6a_253 Hypothetical protein YlbA {Escherichia coli [TaxId 98.98
d3bu7a1355 Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [ 98.97
d1sfna_245 Hypothetical protein DR1152 {Deinococcus radiodura 98.87
d3bu7a1 355 Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [ 98.79
d2d40a1308 Gentisate 1,2-dioxygenase {Escherichia coli [TaxId 98.77
d2phda1351 Gentisate 1,2-dioxygenase {Pseudaminobacter salicy 98.71
d1zrra1179 Acireductone dioxygenase {Klebsiella pneumoniae [T 98.63
d1vr3a1179 Acireductone dioxygenase {Mouse (Mus musculus) [Ta 98.58
d2o1qa1144 Putative acetyl/propionyl-CoA carboxylase subunit 98.42
d2pa7a1135 dTDP-6-deoxy-3,4-keto-hexulose isomerase FdtA {Ane 98.18
d2arca_161 Regulatory protein AraC {Escherichia coli [TaxId: 98.12
d1yfua1174 3-hydroxyanthranilate-3,4-dioxygenase {Ralstonia m 97.67
d1o5ua_88 Hypothetical protein TM1112 {Thermotoga maritima [ 97.66
d3elna1186 Cysteine dioxygenase type I {Rattus norvegicus [Ta 97.6
d1zvfa1175 3-hydroxyanthranilate-3,4-dioxygenase {Baker's yea 97.52
d2gm6a1192 Cysteine dioxygenase type I {Ralstonia eutropha [T 97.27
d1vrba1319 Putative asparaginyl hydroxylase YxbC {Bacillus su 96.95
d1dzra_183 dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Salmone 96.91
d2ixca1198 dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Mycobac 96.86
d1wlta1176 dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeo 96.85
d1oi6a_202 dTDP-4-keto-6-deoxy-glucose-5-epimerase EvaD {Amyc 96.61
d2ixha1184 dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Pseudom 96.55
d1ep0a_183 dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeo 96.53
d2c0za1190 Novobiocin biosynthesis protein NovW {Streptomyces 96.23
d1nxma_194 dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Strepto 95.87
d1eyba_ 439 Homogentisate dioxygenase {Human (Homo sapiens) [T 95.83
d1tq5a1231 Hypothetical protein YhhW {Escherichia coli [TaxId 95.8
d1h2ka_335 Hypoxia-inducible factor HIF ihhibitor (FIH1) {Hum 95.69
d1j1la_ 288 Pirin {Human (Homo sapiens) [TaxId: 9606]} 94.5
d1pmia_440 Phosphomannose isomerase {Yeast (Candida albicans) 93.65
d1qwra_315 Mannose-6-phosphate isomerase ManA {Bacillus subti 93.41
d1xrua1277 5-keto-4-deoxyuronate isomerase KduI {Escherichia 92.68
d1e5ra_290 Type II Proline 3-hydroxylase (proline oxidase) {S 91.46
d3bb6a1109 Uncharacterized protein YeaR {Escherichia coli [Ta 91.36
d3dl3a196 Tellurite resistance protein B, TehB {Vibrio fisch 91.31
d2oyza193 Uncharacterized protein VPA0057 {Vibrio parahaemol 91.0
d1znpa1140 Hypothetical protein Atu3615 {Agrobacterium tumefa 90.53
d1j1la_288 Pirin {Human (Homo sapiens) [TaxId: 9606]} 89.81
d1qwra_315 Mannose-6-phosphate isomerase ManA {Bacillus subti 89.12
d2oz6a2134 Cyclic AMP receptor-like protein Vfr {Pseudomonas 88.64
d1tq5a1231 Hypothetical protein YhhW {Escherichia coli [TaxId 88.31
d2zcwa2112 Transcriptional regulator TTHA1359, N-terminal dom 88.07
d1ywka1260 5-keto-4-deoxyuronate isomerase KduI {Enterococcus 87.93
d1yuda1158 Hypothetical protein SO0799 {Shewanella oneidensis 87.45
d1ft9a2132 CO-sensing protein CooA, N-terminal domain {Rhodos 86.29
d1ywka1260 5-keto-4-deoxyuronate isomerase KduI {Enterococcus 84.79
d1cx4a1136 Regulatory subunit of Protein kinase A {Rat (Rattu 83.71
d2gaua2142 Transcriptional regulator PG0396, N-terminal domai 82.72
d1zx5a1299 Putative mannosephosphate isomerase AF0035 {Archae 82.66
d1i5za2132 Catabolite gene activator protein, N-terminal doma 82.4
>d2et1a1 b.82.1.2 (A:1-201) Germin {Barley (Hordeum vulgare) [TaxId: 4513]} Back     information, alignment and structure
class: All beta proteins
fold: Double-stranded beta-helix
superfamily: RmlC-like cupins
family: Germin/Seed storage 7S protein
domain: Germin
species: Barley (Hordeum vulgare) [TaxId: 4513]
Probab=100.00  E-value=2.6e-62  Score=408.91  Aligned_cols=196  Identities=39%  Similarity=0.734  Sum_probs=188.2

Q ss_pred             cCCCCCcceeeecCCCCCccccCCCCCCCCCCCcCCCeEeeccCCCCCCcCCcCCcEEEEeccCCCCCccccceEEEEEE
Q 027536           24 TDPPPLQDFCIADTASPSSFYNNGVPCLNPNSAVSSHFVTSALAKPGKTSGNIFGFNATLTNTKNLPGVNTMGLTMARID  103 (222)
Q Consensus        24 ~d~~~~~dfcva~~~~~~~~~~~g~~ck~~~~v~~~dF~f~~l~~~~~~~~~~~g~~v~~~~~~~fP~l~~lgis~~~v~  103 (222)
                      |||||||||||||++++. +++||||||+++.++.+||+|+++.++++++ |+.|++++.+++.+||+||++|+|++|++
T Consensus         1 sdp~~lqdfcvad~~~~~-~~~~g~~ck~~~~~~~~~f~~~~l~~~~~~~-~~~g~~vt~~~~~~fP~Ln~lglS~~rv~   78 (201)
T d2et1a1           1 TDPDPLQDFCVADLDGKA-VSVNGHTCKPMSEAGDDFLFSSKLTKAGNTS-TPNGSAVTELDVAEWPGTNTLGVSMNRVD   78 (201)
T ss_dssp             CCCCCSSSCCCBCCCTTS-CCCSSCCBCCGGGCCSCTTCCCTTSSCCCCC-STTSEEEEEESTTTCGGGTTSSCEEEEEE
T ss_pred             CCCcccceeEeecCCCCc-cccCCcccCChhhccccceeecccccCCCcc-CCCCcEEEEeehhcCccccccceeEEEEE
Confidence            799999999999997642 8999999999999999999999999999998 99999999999999999999999999999


Q ss_pred             EcCCcccCCccCCCCcEEEEEEeCeEEEEEEec---CCcEEEEEECCCCEEEEcCCCeeEEEecCCCCCEEEEEEEeCCC
Q 027536          104 IAANGIVPPHTHPRASEVTICLKGALLVGFVDT---LGRLFTQQLRPGDSFVFPKGLIHFLYNMDSSKPALALSGLSSQN  180 (222)
Q Consensus       104 l~pGg~~~pH~H~~a~Ei~yVl~G~~~~~~v~~---~~~~~~~~L~~GDv~viP~G~~H~~~N~g~~~~a~~i~~~~s~~  180 (222)
                      ++||++++||||++|+|++||++|+++++++++   +++++.++|++||+++||+|.+||++|.| ++++.++++|++++
T Consensus        79 l~pgg~~~PH~Hp~A~Ei~yV~~G~~~v~~v~~~~~~~~~~~~~l~~GDv~vvP~G~~H~~~N~g-~~~a~~i~~f~s~~  157 (201)
T d2et1a1          79 FAPGGTNPPHIHPRATEIGMVMKGELLVGILGSLDSGNKLYSRVVRAGETFVIPRGLMHFQFNVG-KTEAYMVVSFNSQN  157 (201)
T ss_dssp             ECTTCEEEEEECTTCCEEEEEEESCEEEEEECCGGGTTCEEEEEECTTCEEEECTTCCEEEEECS-SSCEEEEEEESSSC
T ss_pred             ECCCCCcCCcccCCCCEEEEEEcceEEEEEEeccCCCceeEEEEecCCCEEEECCCCeEEEEEcC-CCCEEEEEEecCCC
Confidence            999999999999999999999999999999864   47889999999999999999999999999 99999999999999


Q ss_pred             CCcccchhhhhcCCCCCCHHHHHHHcCCCHHHHHHHHHhcCC
Q 027536          181 PGLQMTSMATFASKPPIPDEVLKKAFQITRQDVSIIRKNLGG  222 (222)
Q Consensus       181 pg~~~~~~~~f~~~~~ip~~vla~af~~~~~~v~~l~~~~~~  222 (222)
                      ||.+.++.++|+++|+||+|||+++|++|.+++++||++|+|
T Consensus       158 pg~~~~~~~~f~~~~~~p~eVLa~af~i~~~~v~kLks~f~g  199 (201)
T d2et1a1         158 PGIVFVPLTLFGSDPPIPTPVLTKALRVEAGVVELLKSKFAG  199 (201)
T ss_dssp             CCCEEHHHHHHHCSSCCCHHHHHHHHTSCHHHHHHHHHTTTT
T ss_pred             CcceehhhhhhccCCCCCHHHHHHHhCCCHHHHHHHHhhccC
Confidence            999999999999988999999999999999999999999986



>d1fxza2 b.82.1.2 (A:297-470) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} Back     information, alignment and structure
>d1od5a2 b.82.1.2 (A:321-493) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} Back     information, alignment and structure
>d1uika2 b.82.1.2 (A:351-535) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} Back     information, alignment and structure
>d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2phla2 b.82.1.2 (A:220-381) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} Back     information, alignment and structure
>d1uija1 b.82.1.2 (A:6-175) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin beta subunit [TaxId: 3847]} Back     information, alignment and structure
>d1dgwa_ b.82.1.2 (A:) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId: 3823]} Back     information, alignment and structure
>d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1uika1 b.82.1.2 (A:148-350) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} Back     information, alignment and structure
>d2phla1 b.82.1.2 (A:11-210) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} Back     information, alignment and structure
>d1od5a1 b.82.1.2 (A:7-251) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} Back     information, alignment and structure
>d1fxza1 b.82.1.2 (A:10-248) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} Back     information, alignment and structure
>d1o4ta_ b.82.1.9 (A:) Hypothetical protein TM1287 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1v70a_ b.82.1.9 (A:) Hypothetical protein TTHA0104 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lr5a_ b.82.1.2 (A:) Auxin binding protein {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2b8ma1 b.82.1.18 (A:1-108) Hypothetical protein MJ0764 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1y9qa2 b.82.1.15 (A:83-181) Probable transcriptional regulator VC1968, C-terminal domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1vj2a_ b.82.1.10 (A:) Hypothetical protein TM1459 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2f4pa1 b.82.1.9 (A:2-135) Hypothetical protein TM1010 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1x82a_ b.82.1.7 (A:) Glucose-6-phosphate isomerase, GPI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1yhfa1 b.82.1.9 (A:1-112) Hypothetical protein SPy1581 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1sefa_ b.82.1.11 (A:) Hypothetical protein EF2996 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2bnma2 b.82.1.10 (A:77-198) Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain {Streptomyces wedmorensis [TaxId: 43759]} Back     information, alignment and structure
>d1juha_ b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId: 34381]} Back     information, alignment and structure
>d1sfna_ b.82.1.11 (A:) Hypothetical protein DR1152 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2d40a1 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1sq4a_ b.82.1.11 (A:) Glyoxylate-induced protein PA1140 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1rc6a_ b.82.1.11 (A:) Hypothetical protein YlbA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sq4a_ b.82.1.11 (A:) Glyoxylate-induced protein PA1140 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1sefa_ b.82.1.11 (A:) Hypothetical protein EF2996 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1juha_ b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId: 34381]} Back     information, alignment and structure
>d2pyta1 b.82.1.24 (A:100-227) Ethanolamine utilization protein EutQ {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2phda1 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Pseudaminobacter salicylatoxidans [TaxId: 93369]} Back     information, alignment and structure
>d1rc6a_ b.82.1.11 (A:) Hypothetical protein YlbA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3bu7a1 b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [TaxId: 89184]} Back     information, alignment and structure
>d1sfna_ b.82.1.11 (A:) Hypothetical protein DR1152 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d3bu7a1 b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [TaxId: 89184]} Back     information, alignment and structure
>d2d40a1 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2phda1 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Pseudaminobacter salicylatoxidans [TaxId: 93369]} Back     information, alignment and structure
>d1zrra1 b.82.1.6 (A:1-179) Acireductone dioxygenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1vr3a1 b.82.1.6 (A:1-179) Acireductone dioxygenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2o1qa1 b.82.1.21 (A:1-144) Putative acetyl/propionyl-CoA carboxylase subunit alpha Mpe_A3659 {Rubrivivax gelatinosus [TaxId: 28068]} Back     information, alignment and structure
>d2pa7a1 b.82.1.1 (A:2-136) dTDP-6-deoxy-3,4-keto-hexulose isomerase FdtA {Aneurinibacillus thermoaerophilus [TaxId: 143495]} Back     information, alignment and structure
>d2arca_ b.82.4.1 (A:) Regulatory protein AraC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yfua1 b.82.1.20 (A:1-174) 3-hydroxyanthranilate-3,4-dioxygenase {Ralstonia metallidurans [TaxId: 119219]} Back     information, alignment and structure
>d1o5ua_ b.82.1.8 (A:) Hypothetical protein TM1112 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3elna1 b.82.1.19 (A:5-190) Cysteine dioxygenase type I {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1zvfa1 b.82.1.20 (A:1-175) 3-hydroxyanthranilate-3,4-dioxygenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gm6a1 b.82.1.19 (A:11-202) Cysteine dioxygenase type I {Ralstonia eutropha [TaxId: 106590]} Back     information, alignment and structure
>d1vrba1 b.82.2.11 (A:8-326) Putative asparaginyl hydroxylase YxbC {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1dzra_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2ixca1 b.82.1.1 (A:1-198) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1wlta1 b.82.1.1 (A:1-176) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1oi6a_ b.82.1.1 (A:) dTDP-4-keto-6-deoxy-glucose-5-epimerase EvaD {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d2ixha1 b.82.1.1 (A:1-184) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ep0a_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2c0za1 b.82.1.1 (A:1-190) Novobiocin biosynthesis protein NovW {Streptomyces caeruleus [TaxId: 195949]} Back     information, alignment and structure
>d1nxma_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Streptococcus suis [TaxId: 1307]} Back     information, alignment and structure
>d1eyba_ b.82.1.4 (A:) Homogentisate dioxygenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tq5a1 b.82.1.12 (A:1-231) Hypothetical protein YhhW {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h2ka_ b.82.2.6 (A:) Hypoxia-inducible factor HIF ihhibitor (FIH1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j1la_ b.82.1.12 (A:) Pirin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmia_ b.82.1.3 (A:) Phosphomannose isomerase {Yeast (Candida albicans) [TaxId: 5476]} Back     information, alignment and structure
>d1qwra_ b.82.1.3 (A:) Mannose-6-phosphate isomerase ManA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xrua1 b.82.1.13 (A:1-277) 5-keto-4-deoxyuronate isomerase KduI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e5ra_ b.82.2.4 (A:) Type II Proline 3-hydroxylase (proline oxidase) {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d3bb6a1 b.82.2.13 (A:1-109) Uncharacterized protein YeaR {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3dl3a1 b.82.2.13 (A:5-100) Tellurite resistance protein B, TehB {Vibrio fischeri [TaxId: 668]} Back     information, alignment and structure
>d2oyza1 b.82.1.22 (A:2-94) Uncharacterized protein VPA0057 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1znpa1 b.82.1.16 (A:4-143) Hypothetical protein Atu3615 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1j1la_ b.82.1.12 (A:) Pirin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qwra_ b.82.1.3 (A:) Mannose-6-phosphate isomerase ManA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2oz6a2 b.82.3.2 (A:9-142) Cyclic AMP receptor-like protein Vfr {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1tq5a1 b.82.1.12 (A:1-231) Hypothetical protein YhhW {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ywka1 b.82.1.13 (A:1001-1260) 5-keto-4-deoxyuronate isomerase KduI {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1yuda1 b.82.1.16 (A:1-158) Hypothetical protein SO0799 {Shewanella oneidensis [TaxId: 70863]} Back     information, alignment and structure
>d1ft9a2 b.82.3.1 (A:2-133) CO-sensing protein CooA, N-terminal domain {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1ywka1 b.82.1.13 (A:1001-1260) 5-keto-4-deoxyuronate isomerase KduI {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1cx4a1 b.82.3.2 (A:130-265) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2gaua2 b.82.3.2 (A:10-151) Transcriptional regulator PG0396, N-terminal domain {Porphyromonas gingivalis [TaxId: 837]} Back     information, alignment and structure
>d1zx5a1 b.82.1.3 (A:1-299) Putative mannosephosphate isomerase AF0035 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1i5za2 b.82.3.2 (A:6-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure