Citrus Sinensis ID: 027549


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220--
MANLPSAADGENLEKGTSAFSCIYCRKSFANHRSLRGHLRSHNVQLKAAWRRNCPSNSCASIGSASTIVDPLSSNQPGNSCEVVGNNLAFHKRSSPNLTFSMNATFAGSGSTPSAGFPLDVSLSLGLNGVQKLRNDEIQTCQDGLAEGCVSKMVGFLNFGQGERIYPIDSLANIDVMKISKRAKIVPRWPVEIQKPQIKESSLVKTMEKPGPALLNRRSQQI
ccccccccccccccccccEEEEEEEccccccccccccccccccHHHHHHHHHHcccccccccccccEEEccccccccccccEEEcccEEEEccccccEEEEEcEEEccccccccccccEEEEEEccccccHHccccHHHHHHHHHHHHHHHHHHccEEcccccEEEEccccccccEEEcccccccccccccccccccccccHHHHHcccccccccccccccc
cccccccccccccccccccEEEEEEEHHHHccccHccccccccHHHHHHHHHccccccccEEccccEEEccccccccccccEEEcccccEEcccccccEEEEEcEEccccccccccccccEEEEccccHHHHHccHHHHHcccccccccHHHEEEEEccccccEEEccccHcccEHHHHHHccEEcccccEEEEccccccccHHHccccccccHHccccccc
manlpsaadgenlekgtsaFSCIYCRKSFANHRSLRGHLRSHNVQLKaawrrncpsnscasigsastivdplssnqpgnscevvgnnlafhkrsspnltfsmnatfagsgstpsagfpldvslslglngvqklrNDEIQTCQDGLAEGCVSKMVGFLnfgqgeriypidslanidVMKIskrakivprwpveiqkpqikeSSLVKtmekpgpallnrrsqqi
manlpsaadgenlekgTSAFSCIYCRKSFANHRSLRGHLRSHNVQLKAAWRRNCPSNSCASIGSASTIVDPLSSNQPGNSCEVVGNNLAFHKRSSPNLTFSMNATFAGSGSTPSAGFPLDVSLSLGLNGVQKLRNDEIQTCQDGLAEGCVSKMVGFLNFGQGERIYPIDSLANIDVMKISkrakivprwpveiqkpqikesslvktmekpgpallnrrsqqi
MANLPSAADGENLEKGTSAFSCIYCRKSFANHRSLRGHLRSHNVQLKAAWRRNCPSNSCASIGSASTIVDPLSSNQPGNSCEVVGNNLAFHKRSSPNLTFSMNATFAGSGSTPSAGFPLDVSLSLGLNGVQKLRNDEIQTCQDGLAEGCVSKMVGFLNFGQGERIYPIDSLANIDVMKISKRAKIVPRWPVEIQKPQIKESSLVKTMEKPGPALLNRRSQQI
******************AFSCIYCRKSFANHRSLRGHLRSHNVQLKAAWRRNCPSNSCA**********************VVGNNLAF**************************FPLDVSLSLGLNGVQKLRNDEIQTCQDGLAEGCVSKMVGFLNFGQGERIYPIDSLANIDVMKISKRAKIVPRWPVEI*****************************
**************KGTSAFSCIYCRKSFANHRSLRGHLRSHNVQLKAAWRRNCPSNSCASIGSASTIVDP*********CEVVGNNLAFHKRSSPNLTFSMNATFAGSGSTPSAGFPLDVSLSLGLNGVQKLRNDEIQTCQDGLAEGCVSKMVGFLNFGQGERIYPIDSLANIDVMKISKRAKIVPRWPVEIQKP*******************N******
**********ENLEKGTSAFSCIYCRKSFANHRSLRGHLRSHNVQLKAAWRRNCPSNSCASIGSASTIVDPLSSNQPGNSCEVVGNNLAFHKRSSPNLTFSMNATFAGSGSTPSAGFPLDVSLSLGLNGVQKLRNDEIQTCQDGLAEGCVSKMVGFLNFGQGERIYPIDSLANIDVMKISKRAKIVPRWPVEIQKPQIKESSLVKTMEKPGPALLNRRSQQI
****************TSAFSCIYCRKSFANHRSLRGHLRSHNVQLKAAWRRNCPSNSCASIGSASTIVDPLSSNQPGNSCEVVGNNLAFHKRSSPNLTFSMNATFAGSGSTPSAGFPLDVSLSLGLNGVQKLRNDEIQTCQDGLAEGCVSKMVGFLNFGQGERIYPIDSLANIDVMKISKRAKIVPRWPVEIQKPQIKESSLVKTMEKPGP**********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MANLPSAADGENLEKGTSAFSCIYCRKSFANHRSLRGHLRSHNVQLKAAWRRNCPSNSCASIGSASTIVDPLSSNQPGNSCEVVGNNLAFHKRSSPNLTFSMNATFAGSGSTPSAGFPLDVSLSLGLNGVQKLRNDEIQTCQDGLAEGCVSKMVGFLNFGQGERIYPIDSLANIDVMKISKRAKIVPRWPVEIQKPQIKESSLVKTMEKPGPALLNRRSQQI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST


Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

No hits with e-value below 0.001 by BLAST


Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query222
smart0035523 smart00355, ZnF_C2H2, zinc finger 9e-04
pfam1389424 pfam13894, zf-C2H2_4, C2H2-type zinc finger 0.001
pfam1217127 pfam12171, zf-C2H2_jaz, Zinc-finger double-strande 0.004
>gnl|CDD|197676 smart00355, ZnF_C2H2, zinc finger Back     alignment and domain information
 Score = 35.5 bits (82), Expect = 9e-04
 Identities = 9/23 (39%), Positives = 14/23 (60%)

Query: 20 FSCIYCRKSFANHRSLRGHLRSH 42
          + C  C K F +  +LR H+R+H
Sbjct: 1  YRCPECGKVFKSKSALREHMRTH 23


Length = 23

>gnl|CDD|206065 pfam13894, zf-C2H2_4, C2H2-type zinc finger Back     alignment and domain information
>gnl|CDD|204841 pfam12171, zf-C2H2_jaz, Zinc-finger double-stranded RNA-binding Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 222
KOG2462279 consensus C2H2-type Zn-finger protein [Transcripti 99.59
KOG2462279 consensus C2H2-type Zn-finger protein [Transcripti 99.49
KOG36231007 consensus Homeobox transcription factor SIP1 [Tran 99.28
KOG3623 1007 consensus Homeobox transcription factor SIP1 [Tran 99.12
KOG3576267 consensus Ovo and related transcription factors [T 98.98
KOG1074 958 consensus Transcriptional repressor SALM [Transcri 98.7
PHA0276855 hypothetical protein; Provisional 98.64
PHA00733128 hypothetical protein 98.55
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.47
KOG3608467 consensus Zn finger proteins [General function pre 98.42
KOG1074 958 consensus Transcriptional repressor SALM [Transcri 98.41
KOG3576267 consensus Ovo and related transcription factors [T 98.3
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.29
KOG3608467 consensus Zn finger proteins [General function pre 98.14
PLN03086567 PRLI-interacting factor K; Provisional 97.86
PHA0061644 hypothetical protein 97.82
PHA0073279 hypothetical protein 97.68
PHA00733128 hypothetical protein 97.54
COG5189423 SFP1 Putative transcriptional repressor regulating 97.29
PHA0276855 hypothetical protein; Provisional 97.21
PLN03086567 PRLI-interacting factor K; Provisional 96.92
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 96.77
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 96.31
PRK04860160 hypothetical protein; Provisional 96.12
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 95.95
COG5189423 SFP1 Putative transcriptional repressor regulating 95.83
KOG3993500 consensus Transcription factor (contains Zn finger 95.73
PHA0073279 hypothetical protein 95.32
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 95.2
smart0035526 ZnF_C2H2 zinc finger. 94.99
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 94.84
PHA0061644 hypothetical protein 94.34
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 93.27
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 92.58
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 91.98
COG5048467 FOG: Zn-finger [General function prediction only] 90.94
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 90.23
COG5048467 FOG: Zn-finger [General function prediction only] 90.19
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 90.11
KOG3993500 consensus Transcription factor (contains Zn finger 89.15
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 88.34
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 87.2
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 86.53
KOG1146 1406 consensus Homeobox protein [General function predi 82.82
>KOG2462 consensus C2H2-type Zn-finger protein [Transcription] Back     alignment and domain information
Probab=99.59  E-value=2e-16  Score=140.93  Aligned_cols=81  Identities=19%  Similarity=0.331  Sum_probs=73.2

Q ss_pred             ChhhHhhhhhhcCCCceecCccCcccCCchhhhhhhhhcCCCcccccCCCCCccccCCCCCccccccCCCCCCCCCcccc
Q 027549            4 LPSAADGENLEKGTSAFSCIYCRKSFANHRSLRGHLRSHNVQLKAAWRRNCPSNSCASIGSASTIVDPLSSNQPGNSCEV   83 (222)
Q Consensus         4 ~S~Lk~H~rtHTgEKPf~C~~CgKsF~~ks~Lk~H~r~HtgeKPf~C~~~CGKsFs~s~~L~sh~~~p~~~~~~~~sC~~   83 (222)
                      ...|+.|+|+|+  -|++|.+|||.|.+.+-|+.|.|+|||||||.|+. |+|+|+++++|..|+.+  +.+...|.|..
T Consensus       174 mpALkMHirTH~--l~c~C~iCGKaFSRPWLLQGHiRTHTGEKPF~C~h-C~kAFADRSNLRAHmQT--HS~~K~~qC~~  248 (279)
T KOG2462|consen  174 MPALKMHIRTHT--LPCECGICGKAFSRPWLLQGHIRTHTGEKPFSCPH-CGKAFADRSNLRAHMQT--HSDVKKHQCPR  248 (279)
T ss_pred             hHHHhhHhhccC--CCcccccccccccchHHhhcccccccCCCCccCCc-ccchhcchHHHHHHHHh--hcCCccccCcc
Confidence            356899999998  68999999999999999999999999999999999 99999999999999987  45666899999


Q ss_pred             cccccc
Q 027549           84 VGNNLA   89 (222)
Q Consensus        84 cG~~l~   89 (222)
                      |++.++
T Consensus       249 C~KsFs  254 (279)
T KOG2462|consen  249 CGKSFA  254 (279)
T ss_pred             hhhHHH
Confidence            997654



>KOG2462 consensus C2H2-type Zn-finger protein [Transcription] Back     alignment and domain information
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] Back     alignment and domain information
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] Back     alignment and domain information
>KOG3576 consensus Ovo and related transcription factors [Transcription] Back     alignment and domain information
>KOG1074 consensus Transcriptional repressor SALM [Transcription] Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>KOG3608 consensus Zn finger proteins [General function prediction only] Back     alignment and domain information
>KOG1074 consensus Transcriptional repressor SALM [Transcription] Back     alignment and domain information
>KOG3576 consensus Ovo and related transcription factors [Transcription] Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>KOG3608 consensus Zn finger proteins [General function prediction only] Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG3993 consensus Transcription factor (contains Zn finger) [Transcription] Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>KOG3993 consensus Transcription factor (contains Zn finger) [Transcription] Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>KOG1146 consensus Homeobox protein [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query222
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 3e-04
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Length = 39 Back     alignment and structure
 Score = 36.3 bits (84), Expect = 3e-04
 Identities = 7/23 (30%), Positives = 16/23 (69%)

Query: 20 FSCIYCRKSFANHRSLRGHLRSH 42
          ++C +C++ F + ++L GH+  H
Sbjct: 7  YTCSFCKREFRSAQALGGHMNVH 29


Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query222
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.59
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.47
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.45
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.44
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.43
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.43
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.42
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.42
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.41
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.4
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.4
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.38
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.38
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.38
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.38
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.37
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.36
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.35
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.34
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.34
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.32
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.32
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.32
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.32
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.31
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.3
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.3
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.29
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.29
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.29
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.29
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.28
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.28
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.28
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.28
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.28
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.28
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.28
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.28
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.28
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.28
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.28
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.27
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.27
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.27
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.27
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.27
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.27
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.27
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.27
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.27
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.27
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.27
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.27
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.27
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.27
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.26
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.26
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.26
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.26
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.26
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.26
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.26
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.26
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.26
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.26
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.26
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.26
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.26
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.26
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.26
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.26
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.26
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.26
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.26
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.26
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.25
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.25
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.25
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.24
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.23
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.23
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.23
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.23
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.23
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.23
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.22
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.22
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.21
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.21
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.21
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.21
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.2
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.2
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.2
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.2
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.19
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.19
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.18
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.18
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.18
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.18
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.18
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.17
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.17
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.17
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.17
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.17
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.17
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.17
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.17
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.17
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.17
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.16
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.16
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.16
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.16
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.16
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.16
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.16
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.16
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.16
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.16
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.15
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.15
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.15
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.15
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.15
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.15
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.15
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.15
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.14
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.14
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.14
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.14
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.13
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.12
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.12
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.12
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.12
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.12
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.11
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.11
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.11
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.11
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.11
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.1
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.1
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.1
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.09
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.08
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 99.08
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.08
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.07
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.07
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 99.07
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.06
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 99.05
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.04
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.03
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.03
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 99.0
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 99.0
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 98.97
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 98.95
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 98.94
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 98.93
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 98.92
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 98.92
2epa_A72 Krueppel-like factor 10; transforming growth facto 98.86
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 98.85
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 98.82
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.8
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.79
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 98.79
2lv2_A85 Insulinoma-associated protein 1; structural genomi 98.75
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.75
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.74
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.73
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 98.72
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 98.69
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 98.69
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.67
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.67
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 98.67
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 98.63
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.59
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 98.58
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 98.56
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.53
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.52
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 98.52
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.52
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.51
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.51
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.5
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.5
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.46
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 98.45
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.44
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 98.43
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 98.42
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.41
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 98.41
2epa_A72 Krueppel-like factor 10; transforming growth facto 98.41
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.4
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.39
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.36
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.32
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.31
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.31
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.3
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 98.29
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.28
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.27
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.27
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.27
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 98.26
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.26
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.26
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.26
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.26
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 98.26
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 98.25
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.25
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.25
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.25
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.25
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.25
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.25
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.24
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.24
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.24
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.24
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.24
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.23
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.22
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.22
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.21
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.21
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.21
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 98.21
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.21
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.21
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 98.2
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.2
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.19
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.18
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.17
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.17
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.17
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.16
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 98.16
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.16
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.16
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.16
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.14
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.13
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.12
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.11
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.11
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.1
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.1
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.09
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.08
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.08
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.08
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.08
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.08
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.07
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.06
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.06
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.06
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.05
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.05
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.05
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.04
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.04
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.04
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.04
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.03
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.29
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.02
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 98.02
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.02
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.02
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.01
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.01
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.01
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.01
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.01
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.0
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.0
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 97.99
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 97.99
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.24
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 97.99
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 97.99
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 97.97
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 97.97
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 97.97
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 97.96
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 97.96
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 97.96
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.95
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 97.95
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 97.95
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 97.95
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 97.94
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 97.93
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 97.92
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 97.92
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 97.91
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 97.91
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 97.89
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 97.87
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 97.86
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 97.85
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 97.85
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 97.84
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 97.83
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 97.8
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 97.8
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 97.8
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 97.76
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 97.76
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 97.72
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 96.89
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 97.7
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 97.61
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 97.57
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 97.57
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.55
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.44
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.4
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 97.26
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.23
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 97.22
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.22
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 97.16
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.08
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 97.01
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.01
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 97.0
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 96.96
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 96.93
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 96.86
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 96.85
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 96.84
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 96.65
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 95.56
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 96.41
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 96.35
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 96.33
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 95.3
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 96.26
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 96.25
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 96.11
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 95.1
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 96.04
1paa_A30 Yeast transcription factor ADR1; transcription reg 95.97
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 95.82
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 95.79
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 95.75
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 95.74
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 95.52
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 95.39
1ard_A29 Yeast transcription factor ADR1; transcription reg 95.38
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 95.08
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 95.0
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 94.88
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 94.81
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 94.77
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 93.57
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 92.99
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 91.85
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 90.66
2e72_A49 POGO transposable element with ZNF domain; zinc fi 88.67
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
Probab=99.59  E-value=7.7e-17  Score=127.57  Aligned_cols=85  Identities=16%  Similarity=0.113  Sum_probs=70.7

Q ss_pred             CCCChhhHhhhhhhcCCCceecCccCcccCCchhhhhhhhhcCCCcccccCCCCCccccCCCCCccccccCCC----CCC
Q 027549            1 MANLPSAADGENLEKGTSAFSCIYCRKSFANHRSLRGHLRSHNVQLKAAWRRNCPSNSCASIGSASTIVDPLS----SNQ   76 (222)
Q Consensus         1 Fan~S~Lk~H~rtHTgEKPf~C~~CgKsF~~ks~Lk~H~r~HtgeKPf~C~~~CGKsFs~s~~L~sh~~~p~~----~~~   76 (222)
                      |...+.|..|+++|++++||.|++|++.|.+...|..|+++|++++||.|+. |++.|.+...|..|+...+.    ...
T Consensus        32 F~~~~~L~~H~~~H~~~k~~~C~~C~k~F~~~~~L~~H~~~H~~~k~~~C~~-C~k~F~~~~~L~~H~~~hh~~~p~~~~  110 (133)
T 2lt7_A           32 YVCLTSLRRHFNIHSWEKKYPCRYCEKVFPLAEYRTKHEIHHTGERRYQCLA-CGKSFINYQFMSSHIKSVHSQDPSGDS  110 (133)
T ss_dssp             ESCHHHHHHHHHHHHCCSCEECSSSSCEESSHHHHHHHHHHHHTCCCEEESS-SCCEESSHHHHHHHHHHHTCCCTTSSS
T ss_pred             cCCHHHHHHHHHHcCCCCCeeCCccCeecccccchhhhccccCCCccccCCC-CCCCcCCHHHHHHHhHHhcCCCCCCCC
Confidence            5667889999999999999999999999999999999999999999999999 99999999998888754332    223


Q ss_pred             CCCccccccc
Q 027549           77 PGNSCEVVGN   86 (222)
Q Consensus        77 ~~~sC~~cG~   86 (222)
                      ..+.|++|+.
T Consensus       111 k~~~C~~C~k  120 (133)
T 2lt7_A          111 KLYRLHPCRS  120 (133)
T ss_dssp             CCEEECCCCS
T ss_pred             CCeecCCCCc
Confidence            4578888874



>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 222
d1njqa_37 g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale c 4e-04
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 0.001
d1zr9a167 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 0.003
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 37 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Plant C2H2 finger (QALGGH zinc finger)
domain: SUPERMAN zinc finger domain
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
 Score = 34.7 bits (80), Expect = 4e-04
 Identities = 7/24 (29%), Positives = 16/24 (66%)

Query: 20 FSCIYCRKSFANHRSLRGHLRSHN 43
          ++C +C++ F + ++L GH+  H 
Sbjct: 6  YTCSFCKREFRSAQALGGHMNVHR 29


>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Length = 67 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query222
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.39
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.2
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.09
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.08
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.04
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.01
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.0
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.89
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.88
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.81
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.77
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.73
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.72
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.6
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.54
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 98.49
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.44
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.41
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.36
d2cota238 Zinc finger and SCAN domain-containing protein 16, 98.36
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.34
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 98.32
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.16
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.11
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.03
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.03
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.02
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.9
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.81
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.78
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 97.74
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.74
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 97.72
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.52
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.44
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.41
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.28
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.22
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 97.21
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 97.13
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 97.04
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 96.94
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 96.67
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.65
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.6
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 96.59
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.56
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 96.55
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 96.44
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 96.32
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.11
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.01
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 95.94
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 95.9
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 95.73
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 95.69
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 95.21
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 94.94
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 94.79
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 94.53
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 93.78
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 93.49
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 93.44
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 93.01
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 92.95
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 92.94
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 92.62
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 92.11
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 91.77
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 91.66
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 91.4
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 91.3
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 91.09
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 90.94
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 89.5
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 88.0
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 83.4
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 83.2
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 83.08
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 82.6
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 81.56
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 81.49
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 81.42
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 80.65
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.39  E-value=2.4e-14  Score=95.42  Aligned_cols=51  Identities=16%  Similarity=0.214  Sum_probs=47.6

Q ss_pred             CCceecCccCcccCCchhhhhhhhhcCCCcccccCCCCCccccCCCCCccccc
Q 027549           17 TSAFSCIYCRKSFANHRSLRGHLRSHNVQLKAAWRRNCPSNSCASIGSASTIV   69 (222)
Q Consensus        17 EKPf~C~~CgKsF~~ks~Lk~H~r~HtgeKPf~C~~~CGKsFs~s~~L~sh~~   69 (222)
                      ||||.|+ ||++|.....|..|+++|++++||.|+. ||+.|.+.+.|..|+.
T Consensus         1 EK~y~C~-Cgk~F~~~~~l~~H~~~Ht~ekpy~C~~-C~k~F~~~~~L~~H~r   51 (53)
T d2csha1           1 DKLYPCQ-CGKSFTHKSQRDRHMSMHLGLRPYGCGV-CGKKFKMKHHLVGHMK   51 (53)
T ss_dssp             CCCEECT-TSCEESSHHHHHHHHHHHSCCCSEECTT-TSCEESSSHHHHHHHT
T ss_pred             CcCCCCC-CCCeECCHHHhHHHhhccccccCCcCCC-cCCEecCHHHHHHHHh
Confidence            7899995 9999999999999999999999999999 9999999988877753



>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure