Citrus Sinensis ID: 027560


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220--
MGETLISLDRATVLPLILLLCLACYICVVPVTEAIWLQIPSSGTKCVSEEINSNVVVLADYYVIDEAHPEHPPTVSAKVTSPYGNNLHHNENVTHGQFAFTTTEAGNYMACFWLGSNPQKVADATLGLDWRIGFSAKDWESVAKKDKIEGVELHLKRLEAQVQSIHENLLFLKHREAEMREVSEVTNSRVAWLSILSLGVCIAVSSLQLWYLTRYFQKKKLI
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEECccccccEEEEEcccccEEEEEEEEEcccccccccCEEEEEEcccccEEEEEEcccccEEEEEEcccccEEEEccccccccccccEEEEEEEECcccccccHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc
****LISLDRATVLPLILLLCLACYICVVPVTEAIWLQIPSSGTKCVSEEINSNVVVLADYYVIDEAHPEHPPTVSAKVTSPYGNNLHHNENVTHGQFAFTTTEAGNYMACFWLGSNPQKVADATLGLDWRIGFSAKDWESVAKKDKIEGVELHLKRLEAQVQSIHENLLFLKHREAEMREVSEVTNSRVAWLSILSLGVCIAVSSLQLWYLTRYFQKKKLI
xxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGETLISLDRATVLPLILLLCLACYICVVPVTEAIWLQIPSSGTKCVSEEINSNVVVLADYYVIDEAHPEHPPTVSAKVTSPYGNNLHHNENVTHGQFAFTTTEAGNYMACFWLGSNPQKVADATLGLDWRIGFSAKDWESVAKKDKxxxxxxxxxxxxxxxxxxxxxxxxxxxxEAEMREVSEVTNSRVAWLSILSLGVCIAVSSLQLWYLTRYFQKKKLI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Transmembrane emp24 domain-containing protein p24delta5 Involved in vesicular protein trafficking. Mainly functions in the early secretory pathway. Thought to act as cargo receptor at the lumenal side for incorporation of secretory cargo molecules into transport vesicles and to be involved in vesicle coat formation at the cytoplasmic side (By similarity). Interacts with p24beta2 at endoplasmic reticulum export sites for endoplasmic reticulum exit and coupled transport to the Golgi apparatus. Once in the Golgi, interacts very efficiently with the COPI machinery for retrograde transport back to the endoplasmic reticulum.probableQ8RWM6
Transmembrane emp24 domain-containing protein 10 Involved in vesicular protein trafficking. Mainly functions in the early secretory pathway. Thought to act as cargo receptor at the lumenal side for incorporation of secretory cargo molecules into transport vesicles and to be involved in vesicle coat formation at the cytoplasmic side. In COPII vesicle-mediated anterograde transport involved in the transport of GPI-anchored proteins and proposed to act togther with TMED2 as their cargo receptor; the function specifically implies SEC24C and SEC24D of the COPII vesicle coat and lipid raft-like microdomains of the ER. Recognizes GPI anchors structural remodeled in the ER by PGAP1 and MPPE1. In COPI vesicle-mediated retrograde transport involved in the biogenesis of COPI vesicles and vesicle coat recruitment. On Golgi membranes, acts as primary receptor for ARF1-GDP which is involved in COPI-vesicle formation. Increases coatomer-dependent GTPase-activating activity of ARFGAP2. Involved in trafficking of G protein-coupled receptors (GPCRs). Regulates F2LR1, OPRM1 and P2RY4 exocytic trafficking from the Golgi to the plasma membrane thus contributing to receptor resensitization. Involved in trafficking of amyloid beta A4 protein and soluble APP-beta release (independent of modulation of gamma-secretase activity). As part of the presenilin-dependent gamma-secretase complex regulates gamma-cleavages of the amyloid beta A4 protein to yield amyloid-beta 40 (Abeta40). Involved in organization of the Golgi apparatus.probableQ5RE32
Transmembrane emp24 domain-containing protein 10 Involved in vesicular protein trafficking. Mainly functions in the early secretory pathway. Thought to act as cargo receptor at the lumenal side for incorporation of secretory cargo molecules into transport vesicles and to be involved in vesicle coat formation at the cytoplasmic side. In COPII vesicle-mediated anterograde transport involved in the transport of GPI-anchored proteins and proposed to act togther with TMED2 as their cargo receptor; the function specifically implies SEC24C and SEC24D of the COPII vesicle coat and lipid raft-like microdomains of the ER. Recognizes GPI anchors structural remodeled in the ER by PGAP1 and MPPE1. In COPI vesicle-mediated retrograde transport involved in the biogenesis of COPI vesicles and vesicle coat recruitment. On Golgi membranes, acts as primary receptor for ARF1-GDP which is involved in COPI-vesicle formation. Increases coatomer-dependent GTPase-activating activity of ARFGAP2. Involved in trafficking of G protein-coupled receptors (GPCRs). Regulates F2LR1, OPRM1 and P2RY4 exocytic trafficking from the Golgi to the plasma membrane thus contributing to receptor resensitization. Involved in trafficking of amyloid beta A4 protein and soluble APP-beta release (independent of modulation of gamma-secretase activity). As part of the presenilin-dependent gamma-secretase complex regulates gamma-cleavages of the amyloid beta A4 protein to yield amyloid-beta 40 (Abeta40). Involved in organization of the Golgi apparatus.probableQ63584

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1OLM, chain A
Confidence level:probable
Coverage over the Query: 36-132
View the alignment between query and template
View the model in PyMOL