Citrus Sinensis ID: 027585

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-

MILSTISHFQLLCCLVLLLILPLPLYSADPDPLQDFCVADLKASASLNGFPCKLAAEVTSGDFFFDGLSKEGNTTIFGSAVTPANVLAFPGVNTLGISMNRVDFAPGGLNPPHSHPRASESGIVIKGKLLVGFFTTNNVFYSKVLSAGEMFVIPRGLIHFQQNVGEGKALAFTAFNSHLPGAVIVPTTLFASTPSVPNQVLTKTFQVDDDLISTIKSKFGS

ccccccHHHHHHHHHHHHHHHHHHcccccccccccEEEcccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccCEEEEEEEccccccccccccccccEEEEEEEEEEEEEEEcccEEEEEEEccccEEEEccccCEEEEEcccccEEEEEEEcccccccEEcccccccccccccHHHHHHHccccHHHHHHHHHHHcc

****TISHFQLLCCLVLLLILPLPLYSADPDPLQDFCVADLKASASLNGFPCKLAAEVTSGDFFFDGLSKEGNTTIFGSAVTPANVLAFPGVNTLGISMNRVDFAPGGLNPPHSHPRASESGIVIKGKLLVGFFTTNNVFYSKVLSAGEMFVIPRGLIHFQQNVGEGKALAFTAFNSHLPGAVIVPTTLFASTPSVPNQVLTKTFQVDDDLISTIKSKF**

xxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

SSSSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Germin-like protein subfamily T member 2	May play a role in plant defense. Probably has no oxalate oxidase activity even if the active site is conserved.	probable	Q9LMC9
Germin-like protein 5-1	May play a role in plant defense. Probably has no oxalate oxidase activity even if the active site is conserved.	probable	Q6I544
Nectarin-1	May interact with bacterial adhesins thereby protecting the reproductive tissues from microbial attack. Has no oxalate oxidase activity.	probable	Q9SPV5

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1FI2, chain A
Confidence level:very confident
Coverage over the Query: 28-220
View the alignment between query and template
View the model in PyMOL