Citrus Sinensis ID: 027586

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-

MDTECWGDEVSKKVLWQYKSLPKKGKPQGREVTVLAAFLISSPSKDLEVVALGTGTKCIGRSLLSPHGDIVNDSHAEIVARRALLRFFYTEVLNKQKCSNGIEGLRDDVFNNFLFELGPTGKYRFREGWQLHLYISQLPCGDASLSSCHSAPRNFFSREGNSLSSVDELNGFKDGIYDSLQHIGRVQRKPGRGDTTLSVSCSDKIARWNAVGVQGLFNYNL

ccccHHHHHHHHHHHHHHHcccccccccccccEEEEEEEEEEccccEEEEEEccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccEEEEcccccEEEcccEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccECccccccccccEEccccHHHHHHHHHHHcHHcccc

****CWGDEVSKKVLWQYKSLPKKGKPQGREVTVLAAFLISSPSKDLEVVALGTGTKCIGRSLLSPHGDIVNDSHAEIVARRALLRFFYTEVLNKQKCS***********NNFLFELGPTGKYRFREGWQLHLYISQLPCGDASLSSCHSAPRNF***************GFKDGIYDSLQHIGRVQRKPGRGDTTLSVSCSDKIARWNAVGVQGLFNYN*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Templates for Structure Prediction

ID	Alignment Graph	Confidence Level	View Alignment and Template
Query
1zy7, chain A		very confident	Alignment \| Template Structure