Citrus Sinensis ID: 027620


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-
MAPPILSLALPSETGRVLSIQSHTVQGYVGNKSAVFPLQLLGYDVDPIHSVQFSNHTGYPTFKGQVLNGQQLCDLIEGLEANNLLYYTHLLTGYIGSVSFLNTILQVVEKLRSINPNLIYVCDPVMGDEGKLYVPSELVSVYREKVVPVASMLTPNQFEAEQLTGFRIGSEADGREACKILHAAGPAKVVITSINIDGNLFLIGSHQKEKVGPLCVKGLWF
ccccccccccccccccEEEEccccccccccHHHcHHHHHHcccccEEEcEEEccccccccccCEEEccHHHHHHHHHHHHHcccccccEEEEEEcccHHHHHHHHHHHHHHHHcccccEEEEcccccccccccccHHHHHHHHHHcccccCEEcccHHHHHHHcccccccHHHHHHHHHHHHHccccEEEEccEEccccEEEEEECcccccccCEEccccc
**************GRVLSIQSHTVQGYVGNKSAVFPLQLLGYDVDPIHSVQFSNHTGYPTFKGQVLNGQQLCDLIEGLEANNLLYYTHLLTGYIGSVSFLNTILQVVEKLRSINPNLIYVCDPVMGDEGKLYVPSELVSVYREKVVPVASMLTPNQFEAEQLTGFRIGSEADGREACKILHAAGPAKVVITSINIDGNLFLIGSHQKEKVGPLCVKGLWF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAPPILSLALPSETGRVLSIQSHTVQGYVGNKSAVFPLQLLGYDVDPIHSVQFSNHTGYPTFKGQVLNGQQLCDLIEGLEANNLLYYTHLLTGYIGSVSFLNTILQVVEKLRSINPNLIYVCDPVMGDEGKLYVPSELVSVYREKVVPVASMLTPNQFEAEQLTGFRIGSEADGREACKILHAAGPAKVVITSINIDGNLFLIGSHQKEKVGPLCVKGLWF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Pyridoxal kinase Catalyzes the transfer of a phosphate group from ATP to the 5-hydroxylmethyl group of pyridoxal to form the biologically active pyridoxal phosphate.probableQ8W1X2
Pyridoxal kinase Required for synthesis of pyridoxal-5-phosphate from vitamin B6.probableO00764
Pyridoxal kinase Required for synthesis of pyridoxal-5-phosphate from vitamin B6.probableO35331

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.1.-Phosphotransferases with an alcohol group as acceptor.probable
2.7.1.35Pyridoxal kinase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2YXT, chain A
Confidence level:very confident
Coverage over the Query: 13-196
View the alignment between query and template
View the model in PyMOL