Citrus Sinensis ID: 027621

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-
MAGCLSLLRRLYLTAYNWTVFAGWAQVLYLALKTLNESGHENVYKAVERPLQLAQTAAVLEILHGLLGLVRSPITATLPQISSRLYVTWGILWSFPQTQNHILVSSLVISWSLTEIIRYSFFGMKEALGFAPSWLLWLRYSTFLLLYPSGITSEVGLIYTALPYIKESETYCLRMPNKWNFSFDYFYAAILVLGFYVPGSPHMYTYMLGQRKKALSKSKKE
ccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHccccEEEEEEEECcccccccHHHHHHHHHHHcccccccHHHHHHHHHcccccHHHHHHcccEEEEccccHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc
***CLSLLRRLYLTAYNWTVFAGWAQVLYLALKTLNESGHENVYKAVERPLQLAQTAAVLEILHGLLGLVRSPITATLPQISSRLYVTWGILWSFPQTQNHILVSSLVISWSLTEIIRYSFFGMKEALGFAPSWLLWLRYSTFLLLYPSGITSEVGLIYTALPYIKESETYCLRMPNKWNFSFDYFYAAILVLGFYVPGSPHMYTYMLGQ***********
xxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAGCLSLLRRLYLTAYNWTVFAGWAQVLYLALKTLNESGHENVYKAVERPLQLAQTAAVLEILHGLLGLVRSPITATLPQISSRLYVTWGILWSFPQTQNHILVSSLVISWSLTEIIRYSFFGMKEALGFAPSWLLWLRYSTFLLLYPSGITSEVGLIYTALPYIKESETYCLRMPNKWNFSFDYFYAAILVLGFYVPGSPHMYTYMLGQRKKALSKSKKE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Very-long-chain (3R)-3-hydroxyacyl-[acyl-carrier protein] dehydratase PASTICCINO 2 Responsible for the dehydration step in very long-chain fatty acids (VLCFAs) synthesis. May be an anti-phosphatase that prevents CDKA-1 dephosphorylation and activation. Involved in the hormonal control of cell division and differentiation. Required for proliferation control of meristematic and non-meristematic cells. Negative regulator of the cell cycle.confidentQ8VZB2
Very-long-chain (3R)-3-hydroxyacyl-[acyl-carrier protein] dehydratase PASTICCINO 2B Responsible for the dehydration step in very long-chain fatty acids (VLCFAs) synthesis. May be an anti-phosphatase that prevents CDKA-1 dephosphorylation and activation. Involved in the hormonal control of cell division and differentiation. Required for proliferation control of meristematic and non-meristematic cells. Negative regulator of the cell cycle.confidentQ5ZEJ0
Very-long-chain (3R)-3-hydroxyacyl-[acyl-carrier protein] dehydratase PASTICCINO 2A Responsible for the dehydration step in very long-chain fatty acids (VLCFAs) synthesis. May be an anti-phosphatase that prevents CDKA-1 dephosphorylation and activation. Involved in the hormonal control of cell division and differentiation. Required for proliferation control of meristematic and non-meristematic cells. Negative regulator of the cell cycle.confidentQ7XSZ4

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

No confident structure templates for the query are predicted