Citrus Sinensis ID: 027629

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-

MYQVPTGWKFFGNLMDAGLCSICGEESFGTGSDHIREKDGIWAVLAWLSILAHKNKENLDGGKLVTVEDIVRKHWATYGRHYYTRYDYENVDAGAAKELMANLVKMQSSLPEVNDIVKGICSDVSKVVNADEFEYKDPVDGSISKHQGIRYLFEDGSRLVFRLSGTGSEGATIRLYIEQYEKDPSKTGRDSQEALAPLVEVALKLSKMEQFTGRSAPTVIT

ccccccccHHHHHHHHcccCEEEEccccccccccccccHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHcccccccccccccccccEEEEEcccccccccccccccccccEEEEEEcccEEEEEEccccccccEEEEEEEEcccccccccccHHHHHHHHHHHHHHHHccHHHHccccccccc

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Probable phosphoglucomutase, cytoplasmic 1	This enzyme participates in both the breakdown and synthesis of glucose.	probable	O49299
Phosphoglucomutase, cytoplasmic	This enzyme participates in both the breakdown and synthesis of glucose.	probable	Q9ZSQ4

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3PMG, chain A
Confidence level:very confident
Coverage over the Query: 1-221
View the alignment between query and template
View the model in PyMOL