Citrus Sinensis ID: 027634

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-

MATPVKVYGPPLSTAVCRVVACLLEKDVEFQLISLNMAKGDHKKPDFLKIQPFGQVPAFQDEKISLLESRAICRYVCENYPEKGNKGLFGTNPLAKASIDQWLEAEGQSFNPPSSALVFQLALAPRMNIKQDEGVIKQNEEKLAKVLDVYEKRLGESRFLAGDEFSLADLSHLPNAHYLVNATDRGEILTSRDNVGRWWGEISNRDSWKKVVDMQKQQHSP

cccccEEEcccccHHHHHHHHHHHHHccccEEEEcccccccccccHHHHccccccccEEEcccEEEEccHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHcccHHHHHHHHHHccccccccccHHHHHHHHHHHccHHHHHHHHcHHccccc

ccccEEEEcccccHHHHHHHHHHHHccccEEEEcccccccccccccHHHccccccccEEEEccEEEEcHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHccHHHHHHHHHHHcHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHccEccEccccHHHHccHHHHHHHHcccccHcHHcccHHHHHHHHHHHccHHHHHHHHHHHHcccc

matpvkvygpplsTAVCRVVACLLEKDVEFQLISLNmakgdhkkpdflkiqpfgqvpafqdeKISLLESRAICRYVCenypekgnkglfgtnplakASIDQWLeaegqsfnppssALVFQLALaprmnikqdeGVIKQNEEKLAKVLDVYEKRLgesrflagdefsladlshlpnahylvnatdrgeiltsrdnvgrwwgeisnrdsWKKVVDMQKQQHSP

matpvkvygpplstAVCRVVACLLEKDVEFQLISLNMAKGDHKKPDFLKIQPFGQVPAFQDEKISLLESRAICRYVCENYPEKGNKGLFGTNPLAKASIDQWLEAEGQSFNPPSSALVFQLALAPRMNIKQDEGVIKQNEEKLAKVLDVYEKRLGESRFLAGDEFSLADLSHLPNAHYLVnatdrgeiltsrdnvgrwwgeisnrdswkkvvdmqkqqhsp

******VYGPPLSTAVCRVVACLLEKDVEFQLISLNMAKGDHKKPDFLKIQPFGQVPAFQDEKISLLESRAICRYVCENYPEKGNKGLFGTNPLAKASIDQWLEA**********ALVFQLALAPRMNIKQDEGVIKQNEEKLAKVLDVYEKRLGESRFLAGDEFSLADLSHLPNAHYLVNATDRGEILTSRDNVGRWWGEISNRDSWK************

**TPVKVYGPPLSTAVCRVVACLLEKDVEFQLISLNMAKGDHKKPDFLKIQPFGQVPAFQDEKISLLESRAICRYVCENYPEKGNKGLFGTNPLAKASIDQWLEAEGQSFNPPSSALVFQLALAPRMNIKQDEGVIKQNEEKLAKVLDVYEKRLGESRFLAGDEFSLADLSHLPNAHYLVNATDRGEILTSRDNVGRWWGEISNRDSWKKVVDMQKQQ***

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		221	2.2.26 [Sep-21-2011]
P46423		212	Glutathione S-transferase	N/A	no	0.950	0.990	0.438	4e-51
Q96266		263	Glutathione S-transferase	yes	no	0.950	0.798	0.469	5e-51
P30109		213	Glutathione S-transferase	N/A	no	0.923	0.957	0.427	5e-50
P46440		213	Glutathione S-transferase	N/A	no	0.923	0.957	0.436	3e-49
Q96324		214	Glutathione S-transferase	no	no	0.945	0.976	0.438	3e-47
P42761		215	Glutathione S-transferase	no	no	0.904	0.930	0.427	2e-46
O80852		215	Glutathione S-transferase	no	no	0.932	0.958	0.427	9e-46
Q9LZI9		219	Glutathione S-transferase	no	no	0.932	0.940	0.400	7e-45
Q9FE46		214	Glutathione S-transferase	no	no	0.936	0.967	0.418	3e-44
Q84TK0		245	Glutathione S-transferase	no	no	0.950	0.857	0.402	4e-44

>sp\|P46423\|GSTF_HYOMU Glutathione S-transferase OS=Hyoscyamus muticus PE=1 SV=1	Back alignment and function desciption

 Score =  201 bits (511), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 93/212 (43%), Positives = 138/212 (65%), Gaps = 2/212 (0%)

Query: 5   VKVYGPPLSTAVCRVVACLLEKDVEFQLISLNMAKGDHKKPDFLKIQPFGQVPAFQDEKI 64
           +K++GP +S AV RV+A L EKD++F+L+ +NM  GDHKK  F+ + PFGQVPAF+D  +
Sbjct: 3   MKLHGPAMSPAVMRVIATLKEKDLDFELVPVNMQAGDHKKEPFITLNPFGQVPAFEDGDL 62

Query: 65  SLLESRAICRYVCENYPEKGNKGLFGTNPLAKASIDQWLEAEGQSFNPPSSALVFQLALA 124
            L ESRAI +Y+   Y +KGN+ L   +P   A +  W+E E Q F+P +S L F++ + 
Sbjct: 63  KLFESRAITQYIAHTYADKGNQ-LLANDPKKMAIMSVWMEVESQKFDPVASKLTFEIVIK 121

Query: 125 PRMNIKQDEGVIKQNEEKLAKVLDVYEKRLGESRFLAGDEFSLADLSHLPNAHYLVNATD 184
           P + +  D+  + +NEEKL KVLDVYE RL +S++L GD F+LADL H P  +YL+  T 
Sbjct: 122 PMLGMVTDDAAVAENEEKLGKVLDVYESRLKDSKYLGGDSFTLADLHHAPAMNYLM-GTK 180

Query: 185 RGEILTSRDNVGRWWGEISNRDSWKKVVDMQK 216
              +  SR +V  W  +I  R +W K ++ ++
Sbjct: 181 VKSLFDSRPHVSAWCADILARPAWSKAIEYKQ 212

Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.
Hyoscyamus muticus (taxid: 35626)
EC: 2EC: .EC: 5EC: .EC: 1EC: .EC: 1EC: 8

>sp\|Q96266\|GSTF8_ARATH Glutathione S-transferase F8, chloroplastic OS=Arabidopsis thaliana GN=GSTF8 PE=2 SV=3	Back alignment and function description

>sp\|P30109\|GSTF1_TOBAC Glutathione S-transferase PARB OS=Nicotiana tabacum GN=PARB PE=2 SV=1	Back alignment and function description

>sp\|P46440\|GSTF2_TOBAC Glutathione S-transferase APIC OS=Nicotiana tabacum GN=APIC PE=2 SV=1	Back alignment and function description

>sp\|Q96324\|GSTFB_ARATH Glutathione S-transferase F11 OS=Arabidopsis thaliana GN=GSTF11 PE=2 SV=1	Back alignment and function description

>sp\|P42761\|GSTFA_ARATH Glutathione S-transferase F10 OS=Arabidopsis thaliana GN=GSTF10 PE=1 SV=3	Back alignment and function description

>sp\|O80852\|GSTF9_ARATH Glutathione S-transferase F9 OS=Arabidopsis thaliana GN=GSTF9 PE=1 SV=1	Back alignment and function description

>sp\|Q9LZI9\|GSTFD_ARATH Glutathione S-transferase F13 OS=Arabidopsis thaliana GN=GSTF13 PE=3 SV=1	Back alignment and function description

>sp\|Q9FE46\|GSTFC_ARATH Glutathione S-transferase F12 OS=Arabidopsis thaliana GN=GSTF12 PE=1 SV=1	Back alignment and function description

>sp\|Q84TK0\|GSTF4_ARATH Glutathione S-transferase F4 OS=Arabidopsis thaliana GN=GSTF4 PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		221
255539098		218	glutathione-s-transferase theta, gst, pu	0.986	1.0	0.825	1e-105
225459777		223	PREDICTED: glutathione S-transferase PAR	0.977	0.968	0.805	1e-101
224065729		218	predicted protein [Populus trichocarpa]	0.977	0.990	0.777	1e-99
386268021		221	putative glutathione S-transferase [Cycl	0.972	0.972	0.790	2e-98
449500337		220	PREDICTED: glutathione S-transferase F8,	0.995	1.0	0.759	4e-97
254798560		218	glutathione S-transferase [Arachis hypog	0.972	0.986	0.739	8e-95
217072420		222	unknown [Medicago truncatula] gi\|3884930	0.968	0.963	0.761	3e-94
357438581		222	Glutathione S-transferase [Medicago trun	0.968	0.963	0.756	1e-92
449450480		211	PREDICTED: LOW QUALITY PROTEIN: glutathi	0.954	1.0	0.713	9e-89
224065727		215	predicted protein [Populus trichocarpa]	0.963	0.990	0.638	2e-81

>gi\|255539098\|ref\|XP_002510614.1\| glutathione-s-transferase theta, gst, putative [Ricinus communis] gi\|223551315\|gb\|EEF52801.1\| glutathione-s-transferase theta, gst, putative [Ricinus communis]	Back alignment and taxonomy information

 Score =  387 bits (993), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 180/218 (82%), Positives = 199/218 (91%)

Query: 1   MATPVKVYGPPLSTAVCRVVACLLEKDVEFQLISLNMAKGDHKKPDFLKIQPFGQVPAFQ 60
           MATPVKVYGPPLSTAV RV+ACLLEKDV+FQLI +NM+KG+HKKPDFLKIQPFGQVPAFQ
Sbjct: 1   MATPVKVYGPPLSTAVSRVLACLLEKDVDFQLIPVNMSKGEHKKPDFLKIQPFGQVPAFQ 60

Query: 61  DEKISLLESRAICRYVCENYPEKGNKGLFGTNPLAKASIDQWLEAEGQSFNPPSSALVFQ 120
           DE ISL ESRAICRY+CE + +KGNKGL+GTNPLAKASIDQWLEAEGQSFNPPS ALVFQ
Sbjct: 61  DESISLFESRAICRYICEKHADKGNKGLYGTNPLAKASIDQWLEAEGQSFNPPSGALVFQ 120

Query: 121 LALAPRMNIKQDEGVIKQNEEKLAKVLDVYEKRLGESRFLAGDEFSLADLSHLPNAHYLV 180
           LA APRM I QDEG+IKQNEEKL K+L++YEKRLGESRFLAGDEFSLADLSHLPN  Y+V
Sbjct: 121 LAFAPRMKIPQDEGLIKQNEEKLGKLLNIYEKRLGESRFLAGDEFSLADLSHLPNTQYVV 180

Query: 181 NATDRGEILTSRDNVGRWWGEISNRDSWKKVVDMQKQQ 218
            ATD+GE+ TSR NVGRWW EIS+R+SWKKVV MQK +
Sbjct: 181 AATDKGELFTSRKNVGRWWSEISSRESWKKVVQMQKSR 218

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|225459777\|ref\|XP_002285906.1\| PREDICTED: glutathione S-transferase PARB [Vitis vinifera] gi\|147780605\|emb\|CAN69111.1\| hypothetical protein VITISV_031837 [Vitis vinifera] gi\|302141701\|emb\|CBI18904.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|224065729\|ref\|XP_002301942.1\| predicted protein [Populus trichocarpa] gi\|222843668\|gb\|EEE81215.1\| predicted protein [Populus trichocarpa] gi\|283135880\|gb\|ADB11331.1\| phi class glutathione transferase GSTF2 [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|386268021\|dbj\|BAM14585.1\| putative glutathione S-transferase [Cyclamen persicum x Cyclamen purpurascens]	Back alignment and taxonomy information

>gi\|449500337\|ref\|XP_004161070.1\| PREDICTED: glutathione S-transferase F8, chloroplastic-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|254798560\|gb\|ACT82511.1\| glutathione S-transferase [Arachis hypogaea]	Back alignment and taxonomy information

>gi\|217072420\|gb\|ACJ84570.1\| unknown [Medicago truncatula] gi\|388493074\|gb\|AFK34603.1\| unknown [Medicago truncatula]	Back alignment and taxonomy information

>gi\|357438581\|ref\|XP_003589566.1\| Glutathione S-transferase [Medicago truncatula] gi\|355478614\|gb\|AES59817.1\| Glutathione S-transferase [Medicago truncatula]	Back alignment and taxonomy information

>gi\|449450480\|ref\|XP_004142990.1\| PREDICTED: LOW QUALITY PROTEIN: glutathione S-transferase-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|224065727\|ref\|XP_002301941.1\| predicted protein [Populus trichocarpa] gi\|118488016\|gb\|ABK95829.1\| unknown [Populus trichocarpa] gi\|222843667\|gb\|EEE81214.1\| predicted protein [Populus trichocarpa] gi\|283135878\|gb\|ADB11330.1\| phi class glutathione transferase GSTF1 [Populus trichocarpa]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		221
TAIR\|locus:2043298		263	GSTF8 "AT2G47730" [Arabidopsis	0.972	0.817	0.470	6e-48
TAIR\|locus:2097730		214	GSTF11 "AT3G03190" [Arabidopsi	0.945	0.976	0.438	7.1e-45
TAIR\|locus:2052826		215	GSTF10 "AT2G30870" [Arabidopsi	0.918	0.944	0.419	1.7e-43
TAIR\|locus:2052811		215	GSTF9 "AT2G30860" [Arabidopsis	0.932	0.958	0.427	9.3e-43
TAIR\|locus:2081695		219	ATGSTF13 "AT3G62760" [Arabidop	0.932	0.940	0.400	3.2e-42
TAIR\|locus:2167215		214	GSTF12 "AT5G17220" [Arabidopsi	0.927	0.957	0.428	4e-42
TAIR\|locus:2024765		245	GSTF4 "AT1G02950" [Arabidopsis	0.950	0.857	0.402	3.6e-41
TAIR\|locus:2024775		256	GSTF5 "AT1G02940" [Arabidopsis	0.963	0.832	0.401	4.8e-39
TAIR\|locus:2024700		209	GSTF7 "AT1G02920" [Arabidopsis	0.927	0.980	0.416	7.8e-39
TAIR\|locus:2024690		208	GSTF6 "AT1G02930" [Arabidopsis	0.927	0.985	0.413	3.4e-38

TAIR\|locus:2043298 GSTF8 "AT2G47730" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 501 (181.4 bits), Expect = 6.0e-48, P = 6.0e-48
 Identities = 102/217 (47%), Positives = 139/217 (64%)

Query:     1 MATPVKVYGPPLSTAVCRVVACLLEKDVEFQLISLNMAKGDHKKPDFLKIQPFGQVPAFQ 60
             MA+ +KV+G P+STA  RV+A L EKD++F+LI ++M  G HK+   L + PFGQ+PA +
Sbjct:    49 MAS-IKVHGVPMSTATMRVLATLYEKDLQFELIPVDMRAGAHKQEAHLALNPFGQIPALE 107

Query:    61 DEKISLLESRAICRYVCENYPEKGNKGLFGTNPLAKASIDQWLEAEGQSFNPPSSALVFQ 120
             D  ++L ESRAI +Y+ E Y EKG K +       KA+ + WL+ EGQ F+P +S L F+
Sbjct:   108 DGDLTLFESRAITQYLAEEYSEKGEKLISQDCKKVKATTNVWLQVEGQQFDPNASKLAFE 167

Query:   121 LALAPRMNIKQDEGVIKQNEEKLAKVLDVYEKRLGESRFLAGDEFSLADLSHLPNAHYLV 180
                     +  D   +++ E KL KVLDVYE RL +S FLAGD F+LADL HLP  HYL+
Sbjct:   168 RVFKGMFGMTTDPAAVQELEGKLQKVLDVYEARLAKSEFLAGDSFTLADLHHLPAIHYLL 227

Query:   181 NATDRGEILTSRDNVGRWWGEISNRDSWKKVVDMQKQ 217
               TD   +  SR  V  W  +IS R +W KV+D+QKQ
Sbjct:   228 G-TDSKVLFDSRPKVSEWIKKISARPAWAKVIDLQKQ 263

GO:0004364 "glutathione transferase activity" evidence=ISS;IDA

GO:0006952 "defense response" evidence=IEP

GO:0009407 "toxin catabolic process" evidence=RCA;TAS

GO:0009507 "chloroplast" evidence=ISS;IDA

GO:0009941 "chloroplast envelope" evidence=IDA

GO:0005634 "nucleus" evidence=IDA

GO:0043295 "glutathione binding" evidence=IDA

GO:0009579 "thylakoid" evidence=IDA

GO:0009409 "response to cold" evidence=IEP

GO:0010319 "stromule" evidence=IDA

GO:0042742 "defense response to bacterium" evidence=IEP

GO:0005774 "vacuolar membrane" evidence=IDA

GO:0009651 "response to salt stress" evidence=IEP

GO:0009570 "chloroplast stroma" evidence=IDA

GO:0080167 "response to karrikin" evidence=IEP

TAIR\|locus:2097730 GSTF11 "AT3G03190" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2052826 GSTF10 "AT2G30870" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2052811 GSTF9 "AT2G30860" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2081695 ATGSTF13 "AT3G62760" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2167215 GSTF12 "AT5G17220" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2024765 GSTF4 "AT1G02950" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2024775 GSTF5 "AT1G02940" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2024700 GSTF7 "AT1G02920" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2024690 GSTF6 "AT1G02930" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q52828	GSTA_RHILE	No assigned EC number	0.3147	0.8099	0.8817	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
4th Layer	2.5.1.18	0.914
3rd Layer	2.5.1	0.921

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	GSVIVG00015524001	SubName- Full=Putative uncharacterized protein (Chromosome chr18 scaffold_1, whole genome shotgun sequence); (223 aa)
		(Vitis vinifera)
Predicted Functional Partners:
	GSVIVG00032791001	RecName- Full=Glutathione peroxidase; (246 aa)		•	0.899
	GOR	SubName- Full=Chromosome chr7 scaffold_31, whole genome shotgun sequence; (559 aa)		•	0.899
	GSVIVG00023686001	RecName- Full=Glutathione peroxidase; (170 aa)		•	0.899
	GSVIVG00022884001	SubName- Full=Chromosome chr14 scaffold_27, whole genome shotgun sequence; (510 aa)		•	0.899
	GSVIVG00020491001	SubName- Full=Chromosome chr5 scaffold_2, whole genome shotgun sequence; (496 aa)		•	0.899
	GSVIVG00016630001	SubName- Full=Chromosome chr11 scaffold_13, whole genome shotgun sequence; (536 aa)		•	0.899
	GSVIVG00001920001	RecName- Full=Glutathione peroxidase; (167 aa)		•	0.899
	GSVIVG00000410001	RecName- Full=Glutathione peroxidase; (170 aa)		•	0.899
	GSVIVG00000409001	RecName- Full=Glutathione peroxidase; (168 aa)		•	0.899
	GSVIVG00028454001	SubName- Full=Chromosome chr7 scaffold_44, whole genome shotgun sequence; (227 aa)	•		0.461

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		221
PLN02395		215	PLN02395, PLN02395, glutathione S-transferase	3e-74
PLN02473		214	PLN02473, PLN02473, glutathione S-transferase	9e-64
cd03187		118	cd03187, GST_C_Phi, C-terminal, alpha helical doma	3e-59
cd03053		76	cd03053, GST_N_Phi, GST_N family, Class Phi subfam	2e-36
COG0625		211	COG0625, Gst, Glutathione S-transferase [Posttrans	5e-35
cd00570		71	cd00570, GST_N_family, Glutathione S-transferase (	2e-16
cd03046		76	cd03046, GST_N_GTT1_like, GST_N family, Saccharomy	4e-16
cd03050		76	cd03050, GST_N_Theta, GST_N family, Class Theta su	1e-14
cd03045		74	cd03045, GST_N_Delta_Epsilon, GST_N family, Class	8e-14
cd00299		100	cd00299, GST_C_family, C-terminal, alpha helical d	3e-12
pfam13417		75	pfam13417, GST_N_3, Glutathione S-transferase, N-t	4e-12
cd03048		81	cd03048, GST_N_Ure2p_like, GST_N family, Ure2p-lik	4e-12
cd03056		73	cd03056, GST_N_4, GST_N family, unknown subfamily	4e-12
cd03057		77	cd03057, GST_N_Beta, GST_N family, Class Beta subf	5e-12
pfam02798		74	pfam02798, GST_N, Glutathione S-transferase, N-ter	6e-12
cd03051		74	cd03051, GST_N_GTT2_like, GST_N family, Saccharomy	8e-11
pfam00043		92	pfam00043, GST_C, Glutathione S-transferase, C-ter	2e-10
TIGR01262		210	TIGR01262, maiA, maleylacetoacetate isomerase	6e-10
PRK13972		215	PRK13972, PRK13972, GSH-dependent disulfide bond o	9e-10
cd03178		110	cd03178, GST_C_Ure2p_like, C-terminal, alpha helic	2e-09
cd03047		73	cd03047, GST_N_2, GST_N family, unknown subfamily	4e-09
cd03042		73	cd03042, GST_N_Zeta, GST_N family, Class Zeta subf	8e-09
pfam13409		68	pfam13409, GST_N_2, Glutathione S-transferase, N-t	2e-08
cd03044		75	cd03044, GST_N_EF1Bgamma, GST_N family, Gamma subu	7e-08
cd03181		123	cd03181, GST_C_EF1Bgamma_like, Glutathione S-trans	9e-08
pfam13410		69	pfam13410, GST_C_2, Glutathione S-transferase, C-t	1e-07
cd03207		101	cd03207, GST_C_8, C-terminal, alpha helical domain	1e-07
PRK11752		264	PRK11752, PRK11752, putative S-transferase; Provis	3e-07
cd03182		116	cd03182, GST_C_GTT2_like, C-terminal, alpha helica	4e-07
PRK15113		214	PRK15113, PRK15113, glutathione S-transferase; Pro	2e-06
cd03059		73	cd03059, GST_N_SspA, GST_N family, Stringent starv	2e-06
cd03189		123	cd03189, GST_C_GTT1_like, C-terminal, alpha helica	3e-06
cd03180		110	cd03180, GST_C_2, C-terminal, alpha helical domain	7e-06
cd03183		126	cd03183, GST_C_Theta, C-terminal, alpha helical do	1e-05
cd03177		117	cd03177, GST_C_Delta_Epsilon, C-terminal, alpha he	4e-05
cd10292		118	cd10292, GST_C_YghU_like, C-terminal, alpha helica	5e-05
cd10291		110	cd10291, GST_C_YfcG_like, C-terminal, alpha helica	8e-05
PRK10542		201	PRK10542, PRK10542, glutathionine S-transferase; P	3e-04
cd03039		72	cd03039, GST_N_Sigma_like, GST_N family, Class Sig	3e-04
PRK10357		202	PRK10357, PRK10357, putative glutathione S-transfe	0.001
cd03190		142	cd03190, GST_C_Omega_like, C-terminal, alpha helic	0.002
cd03206		100	cd03206, GST_C_7, C-terminal, alpha helical domain	0.004

>gnl\|CDD\|166036 PLN02395, PLN02395, glutathione S-transferase	Back alignment and domain information

 Score =  223 bits (570), Expect = 3e-74
 Identities = 92/208 (44%), Positives = 132/208 (63%), Gaps = 2/208 (0%)

Query: 5   VKVYGPPLSTAVCRVVACLLEKDVEFQLISLNMAKGDHKKPDFLKIQPFGQVPAFQDEKI 64
           +KVYGP  ++   R +  L+EK VEF+ + +++ KG+HK+P++L +QPFG VP   D   
Sbjct: 3   LKVYGPAFASPK-RALVTLIEKGVEFETVPVDLMKGEHKQPEYLALQPFGVVPVIVDGDY 61

Query: 65  SLLESRAICRYVCENYPEKGNKGLFGTNPLAKASIDQWLEAEGQSFNPPSSALVFQLALA 124
            + ESRAI RY  E Y  +G   L G     +  ++QWL+ E  S++PP   L   +  A
Sbjct: 62  KIFESRAIMRYYAEKYRSQGPD-LLGKTIEERGQVEQWLDVEATSYHPPLLNLTLHILFA 120

Query: 125 PRMNIKQDEGVIKQNEEKLAKVLDVYEKRLGESRFLAGDEFSLADLSHLPNAHYLVNATD 184
            +M    DE VIK++EEKLAKVLDVYE RL +S++LAGD  SLADL+HLP   YLV    
Sbjct: 121 SKMGFPADEKVIKESEEKLAKVLDVYEARLSKSKYLAGDFVSLADLAHLPFTEYLVGPIG 180

Query: 185 RGEILTSRDNVGRWWGEISNRDSWKKVV 212
           +  ++  R +V  WW +IS+R +WK+V+
Sbjct: 181 KAYLIKDRKHVSAWWDDISSRPAWKEVL 208

Length = 215

>gnl\|CDD\|166114 PLN02473, PLN02473, glutathione S-transferase	Back alignment and domain information

>gnl\|CDD\|198296 cd03187, GST_C_Phi, C-terminal, alpha helical domain of Class Phi Glutathione S-transferases	Back alignment and domain information

>gnl\|CDD\|239351 cd03053, GST_N_Phi, GST_N family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins	Back alignment and domain information

>gnl\|CDD\|223698 COG0625, Gst, Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|238319 cd00570, GST_N_family, Glutathione S-transferase (GST) family, N-terminal domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress	Back alignment and domain information

>gnl\|CDD\|239344 cd03046, GST_N_GTT1_like, GST_N family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S	Back alignment and domain information

>gnl\|CDD\|239348 cd03050, GST_N_Theta, GST_N family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase	Back alignment and domain information

>gnl\|CDD\|239343 cd03045, GST_N_Delta_Epsilon, GST_N family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress	Back alignment and domain information

>gnl\|CDD\|198286 cd00299, GST_C_family, C-terminal, alpha helical domain of the Glutathione S-transferase family	Back alignment and domain information

>gnl\|CDD\|205595 pfam13417, GST_N_3, Glutathione S-transferase, N-terminal domain	Back alignment and domain information

>gnl\|CDD\|239346 cd03048, GST_N_Ure2p_like, GST_N family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs	Back alignment and domain information

>gnl\|CDD\|239354 cd03056, GST_N_4, GST_N family, unknown subfamily 4; composed of uncharacterized bacterial proteins with similarity to GSTs	Back alignment and domain information

>gnl\|CDD\|239355 cd03057, GST_N_Beta, GST_N family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress	Back alignment and domain information

>gnl\|CDD\|217234 pfam02798, GST_N, Glutathione S-transferase, N-terminal domain	Back alignment and domain information

>gnl\|CDD\|239349 cd03051, GST_N_GTT2_like, GST_N family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S	Back alignment and domain information

>gnl\|CDD\|215674 pfam00043, GST_C, Glutathione S-transferase, C-terminal domain	Back alignment and domain information

>gnl\|CDD\|233333 TIGR01262, maiA, maleylacetoacetate isomerase	Back alignment and domain information

>gnl\|CDD\|172475 PRK13972, PRK13972, GSH-dependent disulfide bond oxidoreductase; Provisional	Back alignment and domain information

>gnl\|CDD\|198288 cd03178, GST_C_Ure2p_like, C-terminal, alpha helical domain of Ure2p and related Glutathione S-transferase-like proteins	Back alignment and domain information

>gnl\|CDD\|239345 cd03047, GST_N_2, GST_N family, unknown subfamily 2; composed of uncharacterized bacterial proteins with similarity to GSTs	Back alignment and domain information

>gnl\|CDD\|239340 cd03042, GST_N_Zeta, GST_N family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress	Back alignment and domain information

>gnl\|CDD\|222110 pfam13409, GST_N_2, Glutathione S-transferase, N-terminal domain	Back alignment and domain information

>gnl\|CDD\|239342 cd03044, GST_N_EF1Bgamma, GST_N family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis	Back alignment and domain information

>gnl\|CDD\|198290 cd03181, GST_C_EF1Bgamma_like, Glutathione S-transferase C-terminal-like, alpha helical domain of the Gamma subunit of Elongation Factor 1B and similar proteins	Back alignment and domain information

>gnl\|CDD\|222111 pfam13410, GST_C_2, Glutathione S-transferase, C-terminal domain	Back alignment and domain information

>gnl\|CDD\|198316 cd03207, GST_C_8, C-terminal, alpha helical domain of an unknown subfamily 8 of Glutathione S-transferases	Back alignment and domain information

>gnl\|CDD\|183298 PRK11752, PRK11752, putative S-transferase; Provisional	Back alignment and domain information

>gnl\|CDD\|198291 cd03182, GST_C_GTT2_like, C-terminal, alpha helical domain of GTT2-like Glutathione S-transferases	Back alignment and domain information

>gnl\|CDD\|185068 PRK15113, PRK15113, glutathione S-transferase; Provisional	Back alignment and domain information

>gnl\|CDD\|239357 cd03059, GST_N_SspA, GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E	Back alignment and domain information

>gnl\|CDD\|198298 cd03189, GST_C_GTT1_like, C-terminal, alpha helical domain of GTT1-like Glutathione S-transferases	Back alignment and domain information

>gnl\|CDD\|198289 cd03180, GST_C_2, C-terminal, alpha helical domain of an unknown subfamily 2 of Glutathione S-transferases	Back alignment and domain information

>gnl\|CDD\|198292 cd03183, GST_C_Theta, C-terminal, alpha helical domain of Class Theta Glutathione S-transferases	Back alignment and domain information

>gnl\|CDD\|198287 cd03177, GST_C_Delta_Epsilon, C-terminal, alpha helical domain of Class Delta and Epsilon Glutathione S-transferases	Back alignment and domain information

>gnl\|CDD\|198325 cd10292, GST_C_YghU_like, C-terminal, alpha helical domain of Escherichia coli Yghu Glutathione S-transferases and related uncharacterized proteins	Back alignment and domain information

>gnl\|CDD\|198324 cd10291, GST_C_YfcG_like, C-terminal, alpha helical domain of Escherichia coli YfcG Glutathione S-transferases and related uncharacterized proteins	Back alignment and domain information

>gnl\|CDD\|182533 PRK10542, PRK10542, glutathionine S-transferase; Provisional	Back alignment and domain information

>gnl\|CDD\|239337 cd03039, GST_N_Sigma_like, GST_N family, Class Sigma_like; composed of GSTs belonging to class Sigma and similar proteins, including GSTs from class Mu, Pi and Alpha	Back alignment and domain information

>gnl\|CDD\|182405 PRK10357, PRK10357, putative glutathione S-transferase; Provisional	Back alignment and domain information

>gnl\|CDD\|198299 cd03190, GST_C_Omega_like, C-terminal, alpha helical domain of Class Omega-like Glutathione S-transferases	Back alignment and domain information

>gnl\|CDD\|198315 cd03206, GST_C_7, C-terminal, alpha helical domain of an unknown subfamily 7 of Glutathione S-transferases	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		221
PLN02473		214	glutathione S-transferase	100.0
PLN02395		215	glutathione S-transferase	100.0
PRK09481		211	sspA stringent starvation protein A; Provisional	100.0
PRK13972		215	GSH-dependent disulfide bond oxidoreductase; Provi	100.0
PRK15113		214	glutathione S-transferase; Provisional	100.0
KOG0868		217	consensus Glutathione S-transferase [Posttranslati	100.0
TIGR01262		210	maiA maleylacetoacetate isomerase. Maleylacetoacet	100.0
PRK10542		201	glutathionine S-transferase; Provisional	100.0
KOG0406		231	consensus Glutathione S-transferase [Posttranslati	100.0
PRK11752		264	putative S-transferase; Provisional	100.0
COG0625		211	Gst Glutathione S-transferase [Posttranslational m	100.0
KOG0867		226	consensus Glutathione S-transferase [Posttranslati	100.0
PRK10357		202	putative glutathione S-transferase; Provisional	100.0
PTZ00057		205	glutathione s-transferase; Provisional	100.0
TIGR00862		236	O-ClC intracellular chloride channel protein. Thes	100.0
KOG1695		206	consensus Glutathione S-transferase [Posttranslati	100.0
PLN02378		213	glutathione S-transferase DHAR1	100.0
PLN02817		265	glutathione dehydrogenase (ascorbate)	99.98
PRK10387		210	glutaredoxin 2; Provisional	99.98
TIGR02182		209	GRXB Glutaredoxin, GrxB family. This model include	99.96
KOG4420		325	consensus Uncharacterized conserved protein (Gangl	99.96
PLN02907		722	glutamate-tRNA ligase	99.92
KOG1422		221	consensus Intracellular Cl- channel CLIC, contains	99.88
cd03052		73	GST_N_GDAP1 GST_N family, Ganglioside-induced diff	99.86
cd03045		74	GST_N_Delta_Epsilon GST_N family, Class Delta and	99.85
cd03050		76	GST_N_Theta GST_N family, Class Theta subfamily; c	99.84
cd03053		76	GST_N_Phi GST_N family, Class Phi subfamily; compo	99.83
PF13417		75	GST_N_3: Glutathione S-transferase, N-terminal dom	99.83
cd03048		81	GST_N_Ure2p_like GST_N family, Ure2p-like subfamil	99.83
cd03056		73	GST_N_4 GST_N family, unknown subfamily 4; compose	99.82
cd03059		73	GST_N_SspA GST_N family, Stringent starvation prot	99.82
cd03047		73	GST_N_2 GST_N family, unknown subfamily 2; compose	99.81
cd03061		91	GST_N_CLIC GST_N family, Chloride Intracellular Ch	99.81
cd03057		77	GST_N_Beta GST_N family, Class Beta subfamily; GST	99.81
PF02798		76	GST_N: Glutathione S-transferase, N-terminal domai	99.81
cd03044		75	GST_N_EF1Bgamma GST_N family, Gamma subunit of Elo	99.8
cd03058		74	GST_N_Tau GST_N family, Class Tau subfamily; GSTs	99.8
cd03041		77	GST_N_2GST_N GST_N family, 2 repeats of the N-term	99.8
cd03042		73	GST_N_Zeta GST_N family, Class Zeta subfamily; GST	99.8
cd03051		74	GST_N_GTT2_like GST_N family, Saccharomyces cerevi	99.8
cd03046		76	GST_N_GTT1_like GST_N family, Saccharomyces cerevi	99.8
cd03076		73	GST_N_Pi GST_N family, Class Pi subfamily; GSTs ar	99.8
cd03039		72	GST_N_Sigma_like GST_N family, Class Sigma_like; c	99.78
cd03060		71	GST_N_Omega_like GST_N family, Omega-like subfamil	99.78
cd03075		82	GST_N_Mu GST_N family, Class Mu subfamily; GSTs ar	99.76
cd03037		71	GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) sub	99.76
KOG4244		281	consensus Failed axon connections (fax) protein/gl	99.75
cd03049		73	GST_N_3 GST_N family, unknown subfamily 3; compose	99.75
COG2999		215	GrxB Glutaredoxin 2 [Posttranslational modificatio	99.75
cd03077		79	GST_N_Alpha GST_N family, Class Alpha subfamily; G	99.75
cd03038		84	GST_N_etherase_LigE GST_N family, Beta etherase Li	99.75
cd03055		89	GST_N_Omega GST_N family, Class Omega subfamily; G	99.75
PF13409		70	GST_N_2: Glutathione S-transferase, N-terminal dom	99.74
cd03187		118	GST_C_Phi GST_C family, Class Phi subfamily; compo	99.74
cd03080		75	GST_N_Metaxin_like GST_N family, Metaxin subfamily	99.72
cd03040		77	GST_N_mPGES2 GST_N family; microsomal Prostaglandi	99.72
cd03043		73	GST_N_1 GST_N family, unknown subfamily 1; compose	99.71
cd03178		113	GST_C_Ure2p_like GST_C family, Ure2p-like subfamil	99.71
KOG3029		370	consensus Glutathione S-transferase-related protei	99.7
cd03188		114	GST_C_Beta GST_C family, Class Beta subfamily; GST	99.7
cd03196		115	GST_C_5 GST_C family, unknown subfamily 5; compose	99.7
COG0435		324	ECM4 Predicted glutathione S-transferase [Posttran	99.68
cd03180		110	GST_C_2 GST_C family, unknown subfamily 2; compose	99.67
cd03191		121	GST_C_Zeta GST_C family, Class Zeta subfamily; GST	99.67
cd03186		107	GST_C_SspA GST_N family, Stringent starvation prot	99.66
cd03181		123	GST_C_EFB1gamma GST_C family, Gamma subunit of Elo	99.66
cd00570		71	GST_N_family Glutathione S-transferase (GST) famil	99.66
cd03209		121	GST_C_Mu GST_C family, Class Mu subfamily; GSTs ar	99.66
cd03190		142	GST_C_ECM4_like GST_C family, ECM4-like subfamily;	99.66
cd03183		126	GST_C_Theta GST_C family, Class Theta subfamily; c	99.65
cd03185		126	GST_C_Tau GST_C family, Class Tau subfamily; GSTs	99.65
KOG2903		319	consensus Predicted glutathione S-transferase [Pos	99.64
cd03182		117	GST_C_GTT2_like GST_C family, Saccharomyces cerevi	99.64
cd03189		119	GST_C_GTT1_like GST_C family, Saccharomyces cerevi	99.63
cd03177		118	GST_C_Delta_Epsilon GST_C family, Class Delta and	99.61
cd03054		72	GST_N_Metaxin GST_N family, Metaxin subfamily; com	99.61
cd03208		137	GST_C_Alpha GST_C family, Class Alpha subfamily; G	99.6
cd03210		126	GST_C_Pi GST_C family, Class Pi subfamily; GSTs ar	99.6
cd03184		124	GST_C_Omega GST_C family, Class Omega subfamily; G	99.56
cd03207		103	GST_C_8 GST_C family, unknown subfamily 8; compose	99.55
cd03198		134	GST_C_CLIC GST_C family, Chloride Intracellular Ch	99.52
cd03200		96	GST_C_JTV1 GST_C family, JTV-1 subfamily; composed	99.51
cd03195		114	GST_C_4 GST_C family, unknown subfamily 4; compose	99.51
cd03179		105	GST_C_1 GST_C family, unknown subfamily 1; compose	99.51
PF13410		69	GST_C_2: Glutathione S-transferase, C-terminal dom	99.51
PF00043		95	GST_C: Glutathione S-transferase, C-terminal domai	99.5
KOG3027		257	consensus Mitochondrial outer membrane protein Met	99.49
cd03206		100	GST_C_7 GST_C family, unknown subfamily 7; compose	99.49
cd03203		120	GST_C_Lambda GST_C family, Class Lambda subfamily;	99.48
cd03204		111	GST_C_GDAP1 GST_C family, Ganglioside-induced diff	99.47
cd03194		114	GST_C_3 GST_C family, unknown subfamily 3; compose	99.42
cd03201		121	GST_C_DHAR GST_C family, Dehydroascorbate Reductas	99.41
cd03079		74	GST_N_Metaxin2 GST_N family, Metaxin subfamily, Me	99.38
cd00299		100	GST_C_family Glutathione S-transferase (GST) famil	99.33
PF14497		99	GST_C_3: Glutathione S-transferase, C-terminal dom	99.28
cd03192		104	GST_C_Sigma_like GST_C family, Class Sigma_like; c	99.25
TIGR02190		79	GlrX-dom Glutaredoxin-family domain. This C-termin	99.24
PRK10638		83	glutaredoxin 3; Provisional	99.23
cd03193		88	GST_C_Metaxin GST_C family, Metaxin subfamily; com	99.22
cd03202		124	GST_C_etherase_LigE GST_C family, Beta etherase Li	99.22
cd03205		98	GST_C_6 GST_C family, unknown subfamily 6; compose	99.15
KOG3028		313	consensus Translocase of outer mitochondrial membr	99.12
cd03029		72	GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hyb	99.07
cd03078		73	GST_N_Metaxin1_like GST_N family, Metaxin subfamil	99.06
cd03211		126	GST_C_Metaxin2 GST_C family, Metaxin subfamily, Me	99.02
PF14834		117	GST_C_4: Glutathione S-transferase, C-terminal dom	99.01
cd03212		137	GST_C_Metaxin1_3 GST_C family, Metaxin subfamily,	98.99
cd03027		73	GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Eg	98.96
cd02066		72	GRX_family Glutaredoxin (GRX) family; composed of	98.83
PRK10329		81	glutaredoxin-like protein; Provisional	98.82
cd02976		73	NrdH NrdH-redoxin (NrdH) family; NrdH is a small m	98.8
cd03418		75	GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX b	98.79
TIGR02196		74	GlrX_YruB Glutaredoxin-like protein, YruB-family.	98.79
cd03197		149	GST_C_mPGES2 GST_C family; microsomal Prostaglandi	98.78
COG0695		80	GrxC Glutaredoxin and related proteins [Posttransl	98.74
PRK11200		85	grxA glutaredoxin 1; Provisional	98.67
TIGR02181		79	GRX_bact Glutaredoxin, GrxC family. This family of	98.65
TIGR02200		77	GlrX_actino Glutaredoxin-like protein. This family	98.6
cd03419		82	GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX h	98.54
TIGR02189		99	GlrX-like_plant Glutaredoxin-like family. This fam	98.52
TIGR02194		72	GlrX_NrdH Glutaredoxin-like protein NrdH. NrdH-red	98.52
TIGR02183		86	GRXA Glutaredoxin, GrxA family. This model include	98.51
PHA03050		108	glutaredoxin; Provisional	98.46
PF00462		60	Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Gl	98.45
TIGR00365		97	monothiol glutaredoxin, Grx4 family. The gene for	98.27
TIGR02180		84	GRX_euk Glutaredoxin. This model represents eukary	98.22
cd03028		90	GRX_PICOT_like Glutaredoxin (GRX) family, PKC-inte	98.15
PF10568		72	Tom37: Outer mitochondrial membrane transport comp	97.94
PRK12759		410	bifunctional gluaredoxin/ribonucleoside-diphosphat	97.84
cd03031		147	GRX_GRX_like Glutaredoxin (GRX) family, GRX-like d	97.82
PRK10824		115	glutaredoxin-4; Provisional	97.64
PF04399		132	Glutaredoxin2_C: Glutaredoxin 2, C terminal domain	97.63
KOG1752		104	consensus Glutaredoxin and related proteins [Postt	97.37
PTZ00062		204	glutaredoxin; Provisional	97.31
cd02973		67	TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-	97.28
cd03199		128	GST_C_GRX2 GST_C family, Glutaredoxin 2 (GRX2) sub	97.2
KOG1147		712	consensus Glutamyl-tRNA synthetase [Translation, r	97.16
cd03036		111	ArsC_like Arsenate Reductase (ArsC) family, unknow	97.15
cd02977		105	ArsC_family Arsenate Reductase (ArsC) family; comp	97.06
COG1393		117	ArsC Arsenate reductase and related proteins, glut	97.05
PRK01655		131	spxA transcriptional regulator Spx; Reviewed	97.02
PRK10026		141	arsenate reductase; Provisional	97.02
cd03032		115	ArsC_Spx Arsenate Reductase (ArsC) family, Spx sub	96.96
TIGR01617		117	arsC_related transcriptional regulator, Spx/MgsR f	96.75
PRK13344		132	spxA transcriptional regulator Spx; Reviewed	96.73
cd03035		105	ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb s	96.72
cd03033		113	ArsC_15kD Arsenate Reductase (ArsC) family, 15kD p	96.7
PRK12559		131	transcriptional regulator Spx; Provisional	96.68
COG4545		85	Glutaredoxin-related protein [Posttranslational mo	96.62
PRK10853		118	putative reductase; Provisional	96.25
cd03030		92	GRX_SH3BGR Glutaredoxin (GRX) family, SH3BGR (SH3	96.17
TIGR01616		126	nitro_assoc nitrogenase-associated protein. This m	96.12
COG0278		105	Glutaredoxin-related protein [Posttranslational mo	96.03
TIGR00412		76	redox_disulf_2 small redox-active disulfide protei	95.77
cd03034		112	ArsC_ArsC Arsenate Reductase (ArsC) family, ArsC s	95.75
TIGR00014		114	arsC arsenate reductase (glutaredoxin). composed o	95.71
PF05768		81	DUF836: Glutaredoxin-like domain (DUF836); InterPr	95.49
cd03026		89	AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxid	95.23
TIGR00411		82	redox_disulf_1 small redox-active disulfide protei	95.1
PHA02125		75	thioredoxin-like protein	94.14
cd01659		69	TRX_superfamily Thioredoxin (TRX) superfamily; a l	93.39
PF11287		112	DUF3088: Protein of unknown function (DUF3088); In	93.22
PF13192		76	Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZY	93.05
PF03960		110	ArsC: ArsC family; InterPro: IPR006660 Several bac	90.97
PF11801		168	Tom37_C: Tom37 C-terminal domain; InterPro: IPR019	90.87
PF04908		99	SH3BGR: SH3-binding, glutamic acid-rich protein; I	90.6
KOG0911		227	consensus Glutaredoxin-related protein [Posttransl	85.39
TIGR03143		555	AhpF_homolog putative alkyl hydroperoxide reductas	84.55
TIGR01295		122	PedC_BrcD bacteriocin transport accessory protein,	83.94
cd02953		104	DsbDgamma DsbD gamma family; DsbD gamma is the C-t	82.34
TIGR03140		515	AhpF alkyl hydroperoxide reductase, F subunit. Thi	82.08
PRK15317		517	alkyl hydroperoxide reductase subunit F; Provision	82.0
KOG1668		231	consensus Elongation factor 1 beta/delta chain [Tr	80.11

>PLN02473 glutathione S-transferase	Back alignment and domain information

Probab=100.00  E-value=1.4e-41  Score=254.14  Aligned_cols=211  Identities=44%  Similarity=0.809  Sum_probs=177.3

Q ss_pred             ceEEecCCCChhhHHHHHHHHhcCCcceEEEeccCCCCCCChhhhhhCCCCCCCeEEcCCeeEeehHHHHHHHHHhCCCC
Q 027634            4 PVKVYGPPLSTAVCRVVACLLEKDVEFQLISLNMAKGDHKKPDFLKIQPFGQVPAFQDEKISLLESRAICRYVCENYPEK   83 (221)
Q Consensus         4 ~~~L~~~~~s~~~~~~~~~L~~~gi~~~~~~v~~~~~~~~~~~~~~~~p~~~vP~l~~~~~~l~es~aI~~yL~~~~~~~   83 (221)
                      .|+||+++.|++++|++++|+++||+|+.+.++..++++++++++++||.|+||+|+++|.+|+||.||++||+++++..
T Consensus         2 ~~kLy~~~~s~~~~rv~~~L~e~gi~ye~~~v~~~~~~~~~~~~~~~nP~g~vP~L~~~g~~l~ES~aI~~YL~~~~~~~   81 (214)
T PLN02473          2 VVKVYGQIKAANPQRVLLCFLEKGIEFEVIHVDLDKLEQKKPEHLLRQPFGQVPAIEDGDLKLFESRAIARYYATKYADQ   81 (214)
T ss_pred             ceEEecCCCCCchHHHHHHHHHcCCCceEEEecCcccccCCHHHHhhCCCCCCCeEEECCEEEEehHHHHHHHHHHcCCc
Confidence            48999999999999999999999999999999998888889999999999999999999999999999999999999754


Q ss_pred             CCCcccCCChhHHHHHHHHHHHHhccCCchhHHHHHHHhhcccCCCCCChHHHHHHHHHHHHHHHHHHHHhCCCCcccCC
Q 027634           84 GNKGLFGTNPLAKASIDQWLEAEGQSFNPPSSALVFQLALAPRMNIKQDEGVIKQNEEKLAKVLDVYEKRLGESRFLAGD  163 (221)
Q Consensus        84 ~~~~l~p~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~le~~L~~~~~l~G~  163 (221)
                      +.+ |+|.++.+++++++|+.+..+.+.......+....+.+..+...+....+....++.+.++.||++|++++|++|+
T Consensus        82 ~~~-l~p~~~~~ra~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~le~~L~~~~~l~Gd  160 (214)
T PLN02473         82 GTD-LLGKTLEHRAIVDQWVEVENNYFYAVALPLVINLVFKPRLGEPCDVALVEELKVKFDKVLDVYENRLATNRYLGGD  160 (214)
T ss_pred             CCC-CCCCCHHHHHHHHHHHHHHHhcccHHHHHHHHHHHhcccccCCCChHHHHHHHHHHHHHHHHHHHHhccCCcccCC
Confidence            334 9999999999999999998887765443333333343322334455667777888999999999999988999999


Q ss_pred             CcchhhhcchhhhhHHhhccccccccccCchHHHHHHHHhcchhHHHHHhhh
Q 027634          164 EFSLADLSHLPNAHYLVNATDRGEILTSRDNVGRWWGEISNRDSWKKVVDMQ  215 (221)
Q Consensus       164 ~~t~aD~~~~~~l~~~~~~~~~~~~~~~~p~l~~~~~~~~~~p~~~~~~~~~  215 (221)
                      ++|+|||++++.+.++..........+.+|+|.+|++++.+||+|+++++..
T Consensus       161 ~~t~ADi~~~~~~~~~~~~~~~~~~~~~~P~l~~w~~~~~~~p~~~~~~~~~  212 (214)
T PLN02473        161 EFTLADLTHMPGMRYIMNETSLSGLVTSRENLNRWWNEISARPAWKKLMELA  212 (214)
T ss_pred             CCCHHHHHHHHHHHHHHhccccHHHHhcCHHHHHHHHHHhcChhhHHHHHHh
Confidence            9999999999998876543221223678999999999999999999998753

>PLN02395 glutathione S-transferase	Back alignment and domain information

>PRK09481 sspA stringent starvation protein A; Provisional	Back alignment and domain information

>PRK13972 GSH-dependent disulfide bond oxidoreductase; Provisional	Back alignment and domain information

>PRK15113 glutathione S-transferase; Provisional	Back alignment and domain information

>KOG0868 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR01262 maiA maleylacetoacetate isomerase	Back alignment and domain information

>PRK10542 glutathionine S-transferase; Provisional	Back alignment and domain information

>KOG0406 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK11752 putative S-transferase; Provisional	Back alignment and domain information

>COG0625 Gst Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0867 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK10357 putative glutathione S-transferase; Provisional	Back alignment and domain information

>PTZ00057 glutathione s-transferase; Provisional	Back alignment and domain information

>TIGR00862 O-ClC intracellular chloride channel protein	Back alignment and domain information

>KOG1695 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PLN02378 glutathione S-transferase DHAR1	Back alignment and domain information

>PLN02817 glutathione dehydrogenase (ascorbate)	Back alignment and domain information

>PRK10387 glutaredoxin 2; Provisional	Back alignment and domain information

>TIGR02182 GRXB Glutaredoxin, GrxB family	Back alignment and domain information

>KOG4420 consensus Uncharacterized conserved protein (Ganglioside-induced differentiation associated protein 1, GDAP1) [Function unknown]	Back alignment and domain information

>PLN02907 glutamate-tRNA ligase	Back alignment and domain information

>KOG1422 consensus Intracellular Cl- channel CLIC, contains GST domain [Inorganic ion transport and metabolism]	Back alignment and domain information

>cd03052 GST_N_GDAP1 GST_N family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells	Back alignment and domain information

>cd03045 GST_N_Delta_Epsilon GST_N family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress	Back alignment and domain information

>cd03050 GST_N_Theta GST_N family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase	Back alignment and domain information

>cd03053 GST_N_Phi GST_N family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins	Back alignment and domain information

>PF13417 GST_N_3: Glutathione S-transferase, N-terminal domain; PDB: 3ERG_B 3IBH_A 3ERF_A 3UBL_A 3UBK_A 3IR4_A 3M8N_B 2R4V_A 2PER_A 2R5G_A	Back alignment and domain information

>cd03048 GST_N_Ure2p_like GST_N family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs	Back alignment and domain information

>cd03056 GST_N_4 GST_N family, unknown subfamily 4; composed of uncharacterized bacterial proteins with similarity to GSTs	Back alignment and domain information

>cd03059 GST_N_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E	Back alignment and domain information

>cd03047 GST_N_2 GST_N family, unknown subfamily 2; composed of uncharacterized bacterial proteins with similarity to GSTs	Back alignment and domain information

>cd03061 GST_N_CLIC GST_N family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin and similar proteins	Back alignment and domain information

>cd03057 GST_N_Beta GST_N family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress	Back alignment and domain information

>PF02798 GST_N: Glutathione S-transferase, N-terminal domain; InterPro: IPR004045 In eukaryotes, glutathione S-transferases (GSTs) participate in the detoxification of reactive electrophillic compounds by catalysing their conjugation to glutathione	Back alignment and domain information

>cd03044 GST_N_EF1Bgamma GST_N family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis	Back alignment and domain information

>cd03058 GST_N_Tau GST_N family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress	Back alignment and domain information

>cd03041 GST_N_2GST_N GST_N family, 2 repeats of the N-terminal domain of soluble GSTs (2 GST_N) subfamily; composed of uncharacterized proteins	Back alignment and domain information

>cd03042 GST_N_Zeta GST_N family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress	Back alignment and domain information

>cd03051 GST_N_GTT2_like GST_N family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S	Back alignment and domain information

>cd03046 GST_N_GTT1_like GST_N family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S	Back alignment and domain information

>cd03076 GST_N_Pi GST_N family, Class Pi subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress	Back alignment and domain information

>cd03039 GST_N_Sigma_like GST_N family, Class Sigma_like; composed of GSTs belonging to class Sigma and similar proteins, including GSTs from class Mu, Pi and Alpha	Back alignment and domain information

>cd03060 GST_N_Omega_like GST_N family, Omega-like subfamily; composed of uncharacterized proteins with similarity to class Omega GSTs	Back alignment and domain information

>cd03075 GST_N_Mu GST_N family, Class Mu subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress	Back alignment and domain information

>cd03037 GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E	Back alignment and domain information

>KOG4244 consensus Failed axon connections (fax) protein/glutathione S-transferase-like protein [Signal transduction mechanisms]	Back alignment and domain information

>cd03049 GST_N_3 GST_N family, unknown subfamily 3; composed of uncharacterized bacterial proteins with similarity to GSTs	Back alignment and domain information

>COG2999 GrxB Glutaredoxin 2 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd03077 GST_N_Alpha GST_N family, Class Alpha subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress	Back alignment and domain information

>cd03038 GST_N_etherase_LigE GST_N family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor	Back alignment and domain information

>cd03055 GST_N_Omega GST_N family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress	Back alignment and domain information

>PF13409 GST_N_2: Glutathione S-transferase, N-terminal domain; PDB: 3C8E_B 3M1G_A 3R3E_A 3O3T_A 1RK4_A 1K0O_B 1K0N_A 3QR6_A 3SWL_A 3TGZ_B	Back alignment and domain information

>cd03187 GST_C_Phi GST_C family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins	Back alignment and domain information

>cd03080 GST_N_Metaxin_like GST_N family, Metaxin subfamily, Metaxin-like proteins; a heterogenous group of proteins, predominantly uncharacterized, with similarity to metaxins and GSTs	Back alignment and domain information

>cd03040 GST_N_mPGES2 GST_N family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2	Back alignment and domain information

>cd03043 GST_N_1 GST_N family, unknown subfamily 1; composed of uncharacterized proteins, predominantly from bacteria, with similarity to GSTs	Back alignment and domain information

>cd03178 GST_C_Ure2p_like GST_C family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs	Back alignment and domain information

>KOG3029 consensus Glutathione S-transferase-related protein [General function prediction only]	Back alignment and domain information

>cd03188 GST_C_Beta GST_C family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress	Back alignment and domain information

>cd03196 GST_C_5 GST_C family, unknown subfamily 5; composed of uncharacterized bacterial proteins with similarity to GSTs	Back alignment and domain information

>COG0435 ECM4 Predicted glutathione S-transferase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd03180 GST_C_2 GST_C family, unknown subfamily 2; composed of uncharacterized bacterial proteins, with similarity to GSTs	Back alignment and domain information

>cd03191 GST_C_Zeta GST_C family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress	Back alignment and domain information

>cd03186 GST_C_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E	Back alignment and domain information

>cd03181 GST_C_EFB1gamma GST_C family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis	Back alignment and domain information

>cd00570 GST_N_family Glutathione S-transferase (GST) family, N-terminal domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress	Back alignment and domain information

>cd03209 GST_C_Mu GST_C family, Class Mu subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress	Back alignment and domain information

>cd03190 GST_C_ECM4_like GST_C family, ECM4-like subfamily; composed of predominantly uncharacterized and taxonomically diverse proteins with similarity to the translation product of the Saccharomyces cerevisiae gene ECM4	Back alignment and domain information

>cd03183 GST_C_Theta GST_C family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase	Back alignment and domain information

>cd03185 GST_C_Tau GST_C family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress	Back alignment and domain information

>KOG2903 consensus Predicted glutathione S-transferase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd03182 GST_C_GTT2_like GST_C family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S	Back alignment and domain information

>cd03189 GST_C_GTT1_like GST_C family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S	Back alignment and domain information

>cd03177 GST_C_Delta_Epsilon GST_C family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress	Back alignment and domain information

>cd03054 GST_N_Metaxin GST_N family, Metaxin subfamily; composed of metaxins and related proteins	Back alignment and domain information

>cd03208 GST_C_Alpha GST_C family, Class Alpha subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress	Back alignment and domain information

>cd03210 GST_C_Pi GST_C family, Class Pi subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress	Back alignment and domain information

>cd03184 GST_C_Omega GST_C family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress	Back alignment and domain information

>cd03207 GST_C_8 GST_C family, unknown subfamily 8; composed of uncharacterized bacterial proteins with similarity to GSTs	Back alignment and domain information

>cd03198 GST_C_CLIC GST_C family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin, and similar proteins	Back alignment and domain information

>cd03200 GST_C_JTV1 GST_C family, JTV-1 subfamily; composed of uncharacterized proteins with similarity to the translation product of the human JTV-1 gene	Back alignment and domain information

>cd03195 GST_C_4 GST_C family, unknown subfamily 4; composed of uncharacterized proteins with similarity to GSTs	Back alignment and domain information

>cd03179 GST_C_1 GST_C family, unknown subfamily 1; composed of uncharacterized bacterial proteins, with similarity to GSTs	Back alignment and domain information

>PF13410 GST_C_2: Glutathione S-transferase, C-terminal domain; PDB: 4DEJ_H 3IC8_A 2JL4_A 2V6K_B 3CBU_B 1JLW_B 3F6D_B 3G7I_A 3F63_A 3G7J_B	Back alignment and domain information

>PF00043 GST_C: Glutathione S-transferase, C-terminal domain; InterPro: IPR004046 In eukaryotes, glutathione S-transferases (GSTs) participate in the detoxification of reactive electrophillic compounds by catalysing their conjugation to glutathione	Back alignment and domain information

>KOG3027 consensus Mitochondrial outer membrane protein Metaxin 2, Metaxin 1-binding protein [Cell wall/membrane/envelope biogenesis; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>cd03206 GST_C_7 GST_C family, unknown subfamily 7; composed of uncharacterized proteins with similarity to GSTs	Back alignment and domain information

>cd03203 GST_C_Lambda GST_C family, Class Lambda subfamily; composed of plant-specific class Lambda GSTs	Back alignment and domain information

>cd03204 GST_C_GDAP1 GST_C family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells	Back alignment and domain information

>cd03194 GST_C_3 GST_C family, unknown subfamily 3; composed of uncharacterized proteins with similarity to GSTs	Back alignment and domain information

>cd03201 GST_C_DHAR GST_C family, Dehydroascorbate Reductase (DHAR) subfamily; composed of plant-specific DHARs, monomeric enzymes catalyzing the reduction of DHA into ascorbic acid (AsA) using glutathione as the reductant	Back alignment and domain information

>cd03079 GST_N_Metaxin2 GST_N family, Metaxin subfamily, Metaxin 2; a metaxin 1 binding protein identified through a yeast two-hybrid system using metaxin 1 as the bait	Back alignment and domain information

>cd00299 GST_C_family Glutathione S-transferase (GST) family, C-terminal alpha helical domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress	Back alignment and domain information

>PF14497 GST_C_3: Glutathione S-transferase, C-terminal domain; PDB: 3AY8_A 2UZ8_B 1V2A_C 2HNL_A 2YV9_B 3H1N_A 3FR6_A 1Q4J_B 1PA3_B 1OKT_B	Back alignment and domain information

>cd03192 GST_C_Sigma_like GST_C family, Class Sigma_like; composed of GSTs belonging to class Sigma and similar proteins, including GSTs from class Mu, Pi, and Alpha	Back alignment and domain information

>TIGR02190 GlrX-dom Glutaredoxin-family domain	Back alignment and domain information

>PRK10638 glutaredoxin 3; Provisional	Back alignment and domain information

>cd03193 GST_C_Metaxin GST_C family, Metaxin subfamily; composed of metaxins and related proteins	Back alignment and domain information

>cd03202 GST_C_etherase_LigE GST_C family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor	Back alignment and domain information

>cd03205 GST_C_6 GST_C family, unknown subfamily 6; composed of uncharacterized bacterial proteins with similarity to GSTs	Back alignment and domain information

>KOG3028 consensus Translocase of outer mitochondrial membrane complex, subunit TOM37/Metaxin 1 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>cd03029 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria	Back alignment and domain information

>cd03078 GST_N_Metaxin1_like GST_N family, Metaxin subfamily, Metaxin 1-like proteins; composed of metaxins 1 and 3, and similar proteins including Tom37 from fungi	Back alignment and domain information

>cd03211 GST_C_Metaxin2 GST_C family, Metaxin subfamily, Metaxin 2; a metaxin 1 binding protein identified through a yeast two-hybrid system using metaxin 1 as the bait	Back alignment and domain information

>PF14834 GST_C_4: Glutathione S-transferase, C-terminal domain; PDB: 3BBY_A	Back alignment and domain information

>cd03212 GST_C_Metaxin1_3 GST_C family, Metaxin subfamily, Metaxin 1-like proteins; composed of metaxins 1 and 3, and similar proteins	Back alignment and domain information

>cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions	Back alignment and domain information

>cd02066 GRX_family Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain	Back alignment and domain information

>PRK10329 glutaredoxin-like protein; Provisional	Back alignment and domain information

>cd02976 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile	Back alignment and domain information

>cd03418 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain	Back alignment and domain information

>TIGR02196 GlrX_YruB Glutaredoxin-like protein, YruB-family	Back alignment and domain information

>cd03197 GST_C_mPGES2 GST_C family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2	Back alignment and domain information

>COG0695 GrxC Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK11200 grxA glutaredoxin 1; Provisional	Back alignment and domain information

>TIGR02181 GRX_bact Glutaredoxin, GrxC family	Back alignment and domain information

>TIGR02200 GlrX_actino Glutaredoxin-like protein	Back alignment and domain information

>cd03419 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain	Back alignment and domain information

>TIGR02189 GlrX-like_plant Glutaredoxin-like family	Back alignment and domain information

>TIGR02194 GlrX_NrdH Glutaredoxin-like protein NrdH	Back alignment and domain information

>TIGR02183 GRXA Glutaredoxin, GrxA family	Back alignment and domain information

>PHA03050 glutaredoxin; Provisional	Back alignment and domain information

>PF00462 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors	Back alignment and domain information

>TIGR00365 monothiol glutaredoxin, Grx4 family	Back alignment and domain information

>TIGR02180 GRX_euk Glutaredoxin	Back alignment and domain information

>cd03028 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins	Back alignment and domain information

>PF10568 Tom37: Outer mitochondrial membrane transport complex protein; InterPro: IPR019564 Tom37 is one of the outer membrane proteins that make up the TOM complex for guiding cytosolic mitochondrial beta-barrel proteins from the cytosol across the outer mitochondrial membrane into the intramembrane space	Back alignment and domain information

>PRK12759 bifunctional gluaredoxin/ribonucleoside-diphosphate reductase subunit beta; Provisional	Back alignment and domain information

>cd03031 GRX_GRX_like Glutaredoxin (GRX) family, GRX-like domain containing protein subfamily; composed of uncharacterized eukaryotic proteins containing a GRX-like domain having only one conserved cysteine, aligning to the C-terminal cysteine of the CXXC motif of GRXs	Back alignment and domain information

>PRK10824 glutaredoxin-4; Provisional	Back alignment and domain information

>PF04399 Glutaredoxin2_C: Glutaredoxin 2, C terminal domain; InterPro: IPR007494 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors	Back alignment and domain information

>KOG1752 consensus Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PTZ00062 glutaredoxin; Provisional	Back alignment and domain information

>cd02973 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-like family; composed of archaeal and bacterial proteins that show similarity to both TRX and GRX, including the C-terminal TRX-fold subdomain of Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO)	Back alignment and domain information

>cd03199 GST_C_GRX2 GST_C family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E	Back alignment and domain information

>KOG1147 consensus Glutamyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>cd03036 ArsC_like Arsenate Reductase (ArsC) family, unknown subfamily; uncharacterized proteins containing a CXXC motif with similarity to thioredoxin (TRX)-fold arsenic reductases, ArsC	Back alignment and domain information

>cd02977 ArsC_family Arsenate Reductase (ArsC) family; composed of TRX-fold arsenic reductases and similar proteins including the transcriptional regulator, Spx	Back alignment and domain information

>COG1393 ArsC Arsenate reductase and related proteins, glutaredoxin family [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK01655 spxA transcriptional regulator Spx; Reviewed	Back alignment and domain information

>PRK10026 arsenate reductase; Provisional	Back alignment and domain information

>cd03032 ArsC_Spx Arsenate Reductase (ArsC) family, Spx subfamily; Spx is a unique RNA polymerase (RNAP)-binding protein present in bacilli and some mollicutes	Back alignment and domain information

>TIGR01617 arsC_related transcriptional regulator, Spx/MgsR family	Back alignment and domain information

>PRK13344 spxA transcriptional regulator Spx; Reviewed	Back alignment and domain information

>cd03035 ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb subfamily; Yffb is an uncharacterized bacterial protein encoded by the yffb gene, related to the thioredoxin-fold arsenic reductases, ArsC	Back alignment and domain information

>cd03033 ArsC_15kD Arsenate Reductase (ArsC) family, 15kD protein subfamily; composed of proteins of unknown function with similarity to thioredoxin-fold arsenic reductases, ArsC	Back alignment and domain information

>PRK12559 transcriptional regulator Spx; Provisional	Back alignment and domain information

>COG4545 Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK10853 putative reductase; Provisional	Back alignment and domain information

>cd03030 GRX_SH3BGR Glutaredoxin (GRX) family, SH3BGR (SH3 domain binding glutamic acid-rich protein) subfamily; a recently-identified subfamily composed of SH3BGR and similar proteins possessing significant sequence similarity to GRX, but without a redox active CXXC motif	Back alignment and domain information

>TIGR01616 nitro_assoc nitrogenase-associated protein	Back alignment and domain information

>COG0278 Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR00412 redox_disulf_2 small redox-active disulfide protein 2	Back alignment and domain information

>cd03034 ArsC_ArsC Arsenate Reductase (ArsC) family, ArsC subfamily; arsenic reductases similar to that encoded by arsC on the R733 plasmid of Escherichia coli	Back alignment and domain information

>TIGR00014 arsC arsenate reductase (glutaredoxin)	Back alignment and domain information

>PF05768 DUF836: Glutaredoxin-like domain (DUF836); InterPro: IPR008554 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors	Back alignment and domain information

>cd03026 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) subfamily, C-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which then reduces hydrogen peroxide and organic hydroperoxides	Back alignment and domain information

>TIGR00411 redox_disulf_1 small redox-active disulfide protein 1	Back alignment and domain information

>PHA02125 thioredoxin-like protein	Back alignment and domain information

>cd01659 TRX_superfamily Thioredoxin (TRX) superfamily; a large, diverse group of proteins containing a TRX-fold	Back alignment and domain information

>PF11287 DUF3088: Protein of unknown function (DUF3088); InterPro: IPR021439 This family of proteins with unknown function appears to be restricted to Proteobacteria	Back alignment and domain information

>PF13192 Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZYN_A 1HYU_A 1ILO_A 1J08_F 2YWM_B 2AYT_B 2HLS_B 1A8L_A 2K8S_B	Back alignment and domain information

>PF03960 ArsC: ArsC family; InterPro: IPR006660 Several bacterial taxon have a chromosomal resistance system, encoded by the ars operon, for the detoxification of arsenate, arsenite, and antimonite []	Back alignment and domain information

>PF11801 Tom37_C: Tom37 C-terminal domain; InterPro: IPR019564 Tom37 is one of the outer membrane proteins that make up the TOM complex for guiding cytosolic mitochondrial beta-barrel proteins from the cytosol across the outer mitochondrial membrane into the intramembrane space	Back alignment and domain information

>PF04908 SH3BGR: SH3-binding, glutamic acid-rich protein; InterPro: IPR006993 This family of proteins, which contains SH3BGRL3, is functionally uncharacterised	Back alignment and domain information

>KOG0911 consensus Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit	Back alignment and domain information

>TIGR01295 PedC_BrcD bacteriocin transport accessory protein, putative	Back alignment and domain information

>cd02953 DsbDgamma DsbD gamma family; DsbD gamma is the C-terminal periplasmic domain of the bacterial protein DsbD	Back alignment and domain information

>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit	Back alignment and domain information

>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional	Back alignment and domain information

>KOG1668 consensus Elongation factor 1 beta/delta chain [Transcription]	Back alignment and domain information

Homologous Structure Templates