Citrus Sinensis ID: 027649

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220
MAISGDLRVAATLASYHQHPLRSSLPSSKVDFAGFPSEITPKWPGMAIDNCSMRQSKLFSRISGDYKLSPNPISHEVESFLLNAINMSFFDRLNLAWKIVFPSPTTRRNSNARIAKQRLQMILFSDRCAVSDEAKRKIVNNIVHALSDFVEIESQDKVQLNVSTDTDLGTIYSVTVPVRRVKPEYLDSYDVGTIANVEYKDTGETSGSVDVRFDFFVPDE
ccccccccEEEEcccccccccccccccccCEEccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccHHHHHHHHHHHHcccccccccccHHHHHHHHHHEEEEccccccHHHHHHHHHHHHHHHcccEEECccccEEEEEECcccccEEEEEEEccccccccccccccccccccccccccccccccEEEEEccccccc
**********A*******************DFAGFPSEITPKWPGMAIDNCSMRQSKLFSRISGDYKLSPNPISHEVESFLLNAINMSFFDRLNLAWKIVFPSPTT****NARIAKQRLQMILFSDRCAVSDEAKRKIVNNIVHALSDFVEIESQDKVQLNVSTDTDLGTIYSVTVPVRRVKPEYLDSYDVGTIANVEYKDTGETSGSVDVRFDFFVP**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAISGDLRVAATLASYHQHPLRSSLPSSKVDFAGFPSEITPKWPGMAIDNCSMRQSKLFSRISGDYKLSPNPISHEVESFLLNAINMSFFDRLNLAWKIVFPSPTTRRNSNARIAKQRLQMILFSDRCAVSDEAKRKIVNNIVHALSDFVEIESQDKVQLNVSTDTDLGTIYSVTVPVRRVKPEYLDSYDVGTIANVEYKDTGETSGSVDVRFDFFVPDE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cell division topological specificity factor homolog, chloroplastic Acts as a topological specificity factor during plastid division and specify plastid constriction sites. May contribute to gravitropism in stems and hypocotyls. Stimulates MIND1 ATPase activity. In cooperation with MIND1, prevents FtsZ ring formation anywhere outside of the mid-plastids.probableQ9C4Z7

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2KXO, chain A
Confidence level:confident
Coverage over the Query: 87-95,107-185
View the alignment between query and template
View the model in PyMOL