Citrus Sinensis ID: 027653


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220
MAEDTGDGSTAEMDDYETLMSTTDAELLKTAWRNEKAAPEILQFQAPLVKRAKEQIQLMEETVEEYEESGMDPLTVSLYQMDLDRAHFLLRSYLRVRLQKLEKYMFYIWKNESLWSRLSDPEKMFVQRCIDDMEKHLEETVLSKLPDNYQSVRRQSVISEEDDMVPEPQLDTFIACKARNRFVSLRLADSERPLEMERHDVSFVLYKVIEDKIGADIDLV
cccccccccccccccccccccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHccccHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHcccccccccccccccccccEEEEEEccccccEEcccccccEEECcccEEEEEHHHHHHHHccccCCc
******************LMSTTDAELLKTAWRNEKAAPEILQFQAPLVKRAKEQIQL*************DPLTVSLYQMDLDRAHFLLRSYLRVRLQKLEKYMFYIWKNESLWSRLSDPEKMFVQRCIDDMEKHLEETVLSKLPDNYQSVR*************EPQLDTFIACKARNRFVSLRLADSERPLEMERHDVSFVLYKVIEDKIGADIDLV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAEDTGDGSTAEMDDYETLMSTTDAELLKTAWRNEKAAPEILQFQAPLxxxxxxxxxxxxxxxxxxxxxGMDPLTVSLYQMDLDRAHFLLRSYLRVRLQKLEKYMFYIWKNESLWSRLSDPEKMFVQRCIDDMEKHLEETVLSKLPDNYQSVRRQSVISEEDDMVPEPQLDTFIACKARNRFVSLRLADSERPLEMERHDVSFVLYKVIEDKIGADIDLV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
DNA replication complex GINS protein sld5 The GINS complex plays an essential role in the initiation of DNA replication. Has a role in chromosome segregation and is required for bir1 localization.probableQ9P7C8

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2E9X, chain D
Confidence level:very confident
Coverage over the Query: 19-220
View the alignment between query and template
View the model in PyMOL