Citrus Sinensis ID: 027686


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220
MATGNRTGVYRKKRDSLKSARAPLSSSASGSAGPVIEMVSGSLLRSNRSSYAPLSTEDPGPSSSDAFSVGLPPAWVDDAEEIANLSSFGDGKQDQHMIEILTYEITDLLRGSEKRLDKLSAAGSSEDSNLRKNVQHSLATDLQNHSMDLRKNHSTYLKHLQQQKEGCDGVDLEMNFNEDKYRLEDDGFSDGGFDAHQMMKLNNCRKSSSFPEIINPLTKA
cccccccHHHHHHHHccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccHcccHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcc
****NRTGVYRKKR******************************************************VGLPPAWVDDAEEIANLSSFG***QDQHMIEILTYEITDLLRGS********************NVQHSLATDLQNHSMDLRKNHSTY*********************************************************INPLT**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATGNRTGVYRKKRDSLKSARAPLSSSASGSAGPVIEMVSGSLLRSNRSSYAPLSTEDPGPSSSDAFSVGLPPAWVDDAEEIANLSSFGDGKQDQHMIEILTYEITDLLRGSEKRLDKLSAAGSSEDSNLRKNVQHSLATDLQNHSMDLRKNHSTYLKHLQQQKEGCDGVDLEMNFNEDKYRLEDDGFSDGGFDAHQMMKLNNCRKSSSFPEIINPLTKA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Syntaxin-42 Vesicle trafficking protein that functions in the secretory pathway.probableQ9SWH4

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2XHE, chain B
Confidence level:confident
Coverage over the Query: 69-167
View the alignment between query and template
View the model in PyMOL