Citrus Sinensis ID: 027701

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220

MEDLYALDFDGVICDSCEETALSAVKAARVRWPSLFDGVDSALEDWIVDQMHTLRPVVETGYDTLLLVRLLLEMRLPSLRKSSVAEGLTVEGILENWLKIKPVIMEEWSENREALIELSGKVRDEWMDTDFTTWIGANRLYPGVSDALKLASSRIYIVTSNQSRFVETLLRELAGVTITPDRLYGLGTGPKVNVLKQLQKKPEHQGLRLQRSTCNPEECD

cccEEEEEccccccccHHHHHHHHHHHHHHHccccccccccHHHHHHHHHcccccccccHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcHHHHHHcccccHHHHHHHHHccccEEEEEcccHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHcccccccEEEEccccccccc

cccEEEEEcccEEEccHHHHHHHHHHHHHHHcHHHccccccccHHHHHHHHHHHccHHcccHHHHHHHHHHHHcccccHcHHHHHccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcHHHHHHHccccccHHHHHHHccccEEEEEccHHHHHHHHHHHHccccccHHHHcccccccHHHHHHHHHHcccccccccccccccccHcc

medlyaldfdgvicdSCEETALSAVKAARvrwpslfdgvdSALEDWIVDQMHTLRPVVETGYDTLLLVRLLLEMRlpslrkssvaegltVEGILENWLKIKPVIMEEWSENREALIELSGKvrdewmdtdfttwiganrlypgvsDALKLASSRIYIVTSNQSRFVETLLRELAgvtitpdrlyglgtgpkvNVLKQLqkkpehqglrlqrstcnpeecd

MEDLYALDFDGVICDSCEETALSAVKAARVRWPSLFDGVDSALEDWIVDQMHTLRPVVETGYDTLLLVRLLLEMRLPslrkssvaegltvegilenwlkIKPVIMEEWSENREALIELSGKVRDEWMDTDFTTWIGANRLYPGVSDALKLASSRIYIVTSNQSRFVETLLRELAGVtitpdrlyglgtGPKVNVLKQLqkkpehqglrlqrstcnpeecd

MEDLYALDFDGVICDSCEETALSAVKAARVRWPSLFDGVDSALEDWIVDQMHTLRPVVETGYDTlllvrlllemrlpslrKSSVAEGLTVEGILENWLKIKPVIMEEWSENREALIELSGKVRDEWMDTDFTTWIGANRLYPGVSDALKLASSRIYIVTSNQSRFVETLLRELAGVTITPDRLYGLGTGPKVNVLKQLQKKPEHQGLRLQRSTCNPEECD

***LYALDFDGVICDSCEETALSAVKAARVRWPSLFDGVDSALEDWIVDQMHTLRPVVETGYDTLLLVRLLLEMRLPSLRKSSVAEGLTVEGILENWLKIKPVIMEEWSENREALIELSGKVRDEWMDTDFTTWIGANRLYPGVSDALKLASSRIYIVTSNQSRFVETLLRELAGVTITPDRLYGLGTGPKVNVL*************************

MEDLYALDFDGVICDSCEETALSAVKAARVRWPSLFDGVDSALEDWIVDQMHTLRPVVETGYDTLLLVRLLLEMRLPSLRK**VAEGLTVEGILENWLKIKPVIMEEWSENREALIELSGKVRDEWMDTDFTTWIGANRLYPGVSDALKLASSRIYIVTSNQSRFVETLLRELAGVTITPDRLYGLGTGPKVNVLKQLQKKPEHQGLRLQRSTCNP****

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

oooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		220
358249046		268	uncharacterized protein LOC100810003 [Gl	0.954	0.783	0.780	4e-94
224127704		268	predicted protein [Populus trichocarpa]	0.954	0.783	0.790	4e-90
388500274		268	unknown [Lotus japonicus]	0.954	0.783	0.771	9e-89
255541628		268	conserved hypothetical protein [Ricinus	0.954	0.783	0.780	2e-88
357507383		268	hypothetical protein MTR_7g077870 [Medic	0.954	0.783	0.766	3e-88
388520247		212	unknown [Lotus japonicus]	0.931	0.966	0.780	9e-88
449441454		268	PREDICTED: uncharacterized protein LOC10	0.954	0.783	0.790	7e-87
79324923		263	uncharacterized protein [Arabidopsis tha	0.968	0.809	0.746	6e-86
79324925		210	uncharacterized protein [Arabidopsis tha	0.954	1.0	0.752	2e-85
297824659		268	hypothetical protein ARALYDRAFT_904052 [	0.954	0.783	0.752	3e-85

>gi\|358249046\|ref\|NP_001239728.1\| uncharacterized protein LOC100810003 [Glycine max] gi\|255647823\|gb\|ACU24371.1\| unknown [Glycine max]	Back alignment and taxonomy information

 Score =  349 bits (896), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 164/210 (78%), Positives = 187/210 (89%)

Query: 1   MEDLYALDFDGVICDSCEETALSAVKAARVRWPSLFDGVDSALEDWIVDQMHTLRPVVET 60
           M +LYALDFDGVICDSC E++LSA+KAA+VRWP LFDGVDS  E+WI+DQMHT+RPVVET
Sbjct: 1   MGELYALDFDGVICDSCGESSLSALKAAKVRWPGLFDGVDSTTENWIIDQMHTVRPVVET 60

Query: 61  GYDTLLLVRLLLEMRLPSLRKSSVAEGLTVEGILENWLKIKPVIMEEWSENREALIELSG 120
           GY+ +LLVRLLLE R P++RKSSVAEGLTVEGILENW K+KP+IMEEW E R+ LI+L G
Sbjct: 61  GYENVLLVRLLLESRTPTIRKSSVAEGLTVEGILENWSKLKPIIMEEWDEKRDDLIDLFG 120

Query: 121 KVRDEWMDTDFTTWIGANRLYPGVSDALKLASSRIYIVTSNQSRFVETLLRELAGVTITP 180
           KVRDEW++ DF TWIGANRLYPGVSDALK ASSR+YIVT+ QSRF + LLRELAGVTI P
Sbjct: 121 KVRDEWLEQDFATWIGANRLYPGVSDALKFASSRVYIVTTKQSRFADALLRELAGVTIPP 180

Query: 181 DRLYGLGTGPKVNVLKQLQKKPEHQGLRLQ 210
           +R+YGLGTGPKV VLKQLQKKPEHQGL L 
Sbjct: 181 ERIYGLGTGPKVEVLKQLQKKPEHQGLTLH 210

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|224127704\|ref\|XP_002320140.1\| predicted protein [Populus trichocarpa] gi\|222860913\|gb\|EEE98455.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|388500274\|gb\|AFK38203.1\| unknown [Lotus japonicus]	Back alignment and taxonomy information

>gi\|255541628\|ref\|XP_002511878.1\| conserved hypothetical protein [Ricinus communis] gi\|223549058\|gb\|EEF50547.1\| conserved hypothetical protein [Ricinus communis]	Back alignment and taxonomy information

>gi\|357507383\|ref\|XP_003623980.1\| hypothetical protein MTR_7g077870 [Medicago truncatula] gi\|217073782\|gb\|ACJ85251.1\| unknown [Medicago truncatula] gi\|355498995\|gb\|AES80198.1\| hypothetical protein MTR_7g077870 [Medicago truncatula] gi\|388518891\|gb\|AFK47507.1\| unknown [Medicago truncatula]	Back alignment and taxonomy information

>gi\|388520247\|gb\|AFK48185.1\| unknown [Lotus japonicus]	Back alignment and taxonomy information

>gi\|449441454\|ref\|XP_004138497.1\| PREDICTED: uncharacterized protein LOC101221288 [Cucumis sativus] gi\|449529778\|ref\|XP_004171875.1\| PREDICTED: uncharacterized LOC101221288 [Cucumis sativus]	Back alignment and taxonomy information

>gi\|79324923\|ref\|NP_001031546.1\| uncharacterized protein [Arabidopsis thaliana] gi\|330255535\|gb\|AEC10629.1\| uncharacterized protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|79324925\|ref\|NP_001031547.1\| uncharacterized protein [Arabidopsis thaliana] gi\|330255536\|gb\|AEC10630.1\| uncharacterized protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|297824659\|ref\|XP_002880212.1\| hypothetical protein ARALYDRAFT_904052 [Arabidopsis lyrata subsp. lyrata] gi\|297326051\|gb\|EFH56471.1\| hypothetical protein ARALYDRAFT_904052 [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		220
TAIR\|locus:2050730		268	AT2G45990 "AT2G45990" [Arabido	0.95	0.779	0.693	1.9e-76

TAIR\|locus:2050730 AT2G45990 "AT2G45990" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 770 (276.1 bits), Expect = 1.9e-76, P = 1.9e-76
 Identities = 145/209 (69%), Positives = 168/209 (80%)

Query:     1 MEDLYALDFDGVICDSCEETALSAVKAARVRWPSLFDGVDSALEDWIVDQMHTLRPVVET 60
             M DLYALDFDGV+CDSC E++LSAVKAA+VRWP LF+GVDSALE+WIVDQMH +RPVVET
Sbjct:     1 MGDLYALDFDGVLCDSCGESSLSAVKAAKVRWPDLFEGVDSALEEWIVDQMHIVRPVVET 60

Query:    61 GYDTXXXXXXXXXXXXXXXXKSSVAEGLTVEGILENWLKIKPVIMEEWSENREALIELSG 120
             GY+                 KSSVAEGLTV+GILE+W K KPVIME W E+R+AL++L G
Sbjct:    61 GYENLLLVRLLLETKIPSIRKSSVAEGLTVDGILESWAKFKPVIMEAWDEDRDALVDLFG 120

Query:   121 KVRDEWMDTDFTTWIGANRLYPGVSDALKLASSRIYIVTSNQSRFVETLLRELAGVTITP 180
             KVRD+W++ D TTWIGANR YPGVSDALK ASS+IYIVT+ Q RF E LLRE+AGV I  
Sbjct:   121 KVRDDWINKDLTTWIGANRFYPGVSDALKFASSKIYIVTTKQGRFAEALLREIAGVIIPS 180

Query:   181 DRLYGLGTGPKVNVLKQLQKKPEHQGLRL 209
             +R+YGLG+GPKV VLK LQ KPEHQGL L
Sbjct:   181 ERIYGLGSGPKVEVLKLLQDKPEHQGLTL 209


Parameters:
  V=100
  filter=SEG
  E=0.001

  ctxfactor=1.00

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   +0      0   BLOSUM62        0.317   0.134   0.404    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E     S W   T  X   E2     S2
   +0      0      220       204   0.00094  111 3  11 22  0.38    33
                                                     31  0.46    35


Statistics:

  Database:  /share/blast/go-seqdb.fasta
   Title:  go_20130330-seqdb.fasta
   Posted:  5:47:42 AM PDT Apr 1, 2013
   Created:  5:47:42 AM PDT Apr 1, 2013
   Format:  XDF-1
   # of letters in database:  169,044,731
   # of sequences in database:  368,745
   # of database sequences satisfying E:  1
  No. of states in DFA:  618 (66 KB)
  Total size of DFA:  187 KB (2105 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t   Elapsed:  00:00:00
  No. of threads or processors used:  24
  Search cpu time:  15.43u 0.12s 15.55t   Elapsed:  00:00:01
  Total cpu time:  15.43u 0.12s 15.55t   Elapsed:  00:00:01
  Start:  Sat May 11 05:27:44 2013   End:  Sat May 11 05:27:45 2013

GO:0003674 "molecular_function" evidence=ND

GO:0008150 "biological_process" evidence=ND

GO:0009570 "chloroplast stroma" evidence=IDA

GO:0009507 "chloroplast" evidence=IDA

GO:0010207 "photosystem II assembly" evidence=RCA

GO:0010264 "myo-inositol hexakisphosphate biosynthetic process" evidence=RCA

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	estExt_Genewise1_v1.C_LG_XIV1313	hypothetical protein (269 aa)
		(Populus trichocarpa)
Predicted Functional Partners:
	eugene3.00150423	SubName- Full=Putative uncharacterized protein; (206 aa)		•	•	0.529
	gw1.XIII.355.1	hypothetical protein (158 aa)	•	•		0.514
	eugene3.00130190	SubName- Full=Putative uncharacterized protein; (339 aa)		•	•	0.502
	gw1.I.8641.1	annotation not avaliable (113 aa)		•		0.501
	grail3.0089000701	hypothetical protein (311 aa)		•		0.501
	eugene3.00061626	hypothetical protein (259 aa)		•		0.500
	estExt_Genewise1_v1.C_LG_II4195	SubName- Full=Putative uncharacterized protein; (140 aa)		•		0.500
	gw1.XII.99.1	hypothetical protein (203 aa)		•		0.498
	gw1.2719.1.1	annotation not avaliable (154 aa)		•		0.498
	gw1.1884.1.1	annotation not avaliable (196 aa)		•		0.498

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		220
COG0546		220	Gph Predicted phosphatases [General function predi	99.95
PRK13226		229	phosphoglycolate phosphatase; Provisional	99.91
PRK13288		214	pyrophosphatase PpaX; Provisional	99.9
PLN03243		260	haloacid dehalogenase-like hydrolase; Provisional	99.89
TIGR03351		220	PhnX-like phosphonatase-like hydrolase. This clade	99.89
PLN02770		248	haloacid dehalogenase-like hydrolase family protei	99.89
TIGR01449		213	PGP_bact 2-phosphoglycolate phosphatase, prokaryot	99.88
PRK13223		272	phosphoglycolate phosphatase; Provisional	99.87
PLN02575		381	haloacid dehalogenase-like hydrolase	99.87
PRK13225		273	phosphoglycolate phosphatase; Provisional	99.87
PRK11587		218	putative phosphatase; Provisional	99.87
TIGR01422		253	phosphonatase phosphonoacetaldehyde hydrolase. Thi	99.87
PRK13478		267	phosphonoacetaldehyde hydrolase; Provisional	99.87
TIGR01454		205	AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthes	99.85
PRK10826		222	2-deoxyglucose-6-phosphatase; Provisional	99.85
TIGR02009		185	PGMB-YQAB-SF beta-phosphoglucomutase family hydrol	99.85
PRK10725		188	fructose-1-P/6-phosphogluconate phosphatase; Provi	99.84
TIGR01990		185	bPGM beta-phosphoglucomutase. The enzyme from L. l	99.84
TIGR01548		197	HAD-SF-IA-hyp1 haloacid dehalogenase superfamily,	99.84
PRK13222		226	phosphoglycolate phosphatase; Provisional	99.84
PLN02940		382	riboflavin kinase	99.83
PRK10563		221	6-phosphogluconate phosphatase; Provisional	99.82
COG0637		221	Predicted phosphatase/phosphohexomutase [General f	99.81
PRK10748		238	flavin mononucleotide phosphatase; Provisional	99.81
TIGR02253		221	CTE7 HAD superfamily (subfamily IA) hydrolase, TIG	99.8
TIGR02252		203	DREG-2 REG-2-like, HAD superfamily (subfamily IA)	99.8
PRK06698		459	bifunctional 5'-methylthioadenosine/S-adenosylhomo	99.8
TIGR01993		184	Pyr-5-nucltdase pyrimidine 5'-nucleotidase. These	99.8
PLN02779		286	haloacid dehalogenase-like hydrolase family protei	99.8
PRK09449		224	dUMP phosphatase; Provisional	99.79
TIGR02254		224	YjjG/YfnB HAD superfamily (subfamily IA) hydrolase	99.76
PHA02597		197	30.2 hypothetical protein; Provisional	99.76
PLN02919		1057	haloacid dehalogenase-like hydrolase family protei	99.75
PF13419		176	HAD_2: Haloacid dehalogenase-like hydrolase; PDB:	99.73
TIGR01428		198	HAD_type_II 2-haloalkanoic acid dehalogenase, type	99.72
PRK14988		224	GMP/IMP nucleotidase; Provisional	99.72
TIGR01549		154	HAD-SF-IA-v1 haloacid dehalogenase superfamily, su	99.72
TIGR02247		211	HAD-1A3-hyp Epoxide hydrolase N-terminal domain-li	99.7
TIGR01493		175	HAD-SF-IA-v2 Haloacid dehalogenase superfamily, su	99.69
PLN02811		220	hydrolase	99.63
PRK09456		199	?-D-glucose-1-phosphatase; Provisional	99.61
TIGR01509		183	HAD-SF-IA-v3 haloacid dehalogenase superfamily, su	99.6
PRK11590		211	hypothetical protein; Provisional	99.6
TIGR00338		219	serB phosphoserine phosphatase SerB. Phosphoserine	99.55
TIGR01672		237	AphA HAD superfamily (subfamily IIIB) phosphatase,	99.54
PLN02954		224	phosphoserine phosphatase	99.53
TIGR01491		201	HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPa	99.51
COG1011		229	Predicted hydrolase (HAD superfamily) [General fun	99.45
PRK13582		205	thrH phosphoserine phosphatase; Provisional	99.45
PRK09552		219	mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosp	99.4
TIGR01662		132	HAD-SF-IIIA HAD-superfamily hydrolase, subfamily I	99.38
TIGR01489		188	DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopent	99.34
KOG2914		222	consensus Predicted haloacid-halidohydrolase and r	99.33
TIGR01685		174	MDP-1 magnesium-dependent phosphatase-1. This mode	99.28
TIGR01656		147	Histidinol-ppas histidinol-phosphate phosphatase f	99.25
PRK08942		181	D,D-heptose 1,7-bisphosphate phosphatase; Validate	99.22
TIGR01691		220	enolase-ppase 2,3-diketo-5-methylthio-1-phosphopen	99.19
PRK11133		322	serB phosphoserine phosphatase; Provisional	99.19
TIGR01545		210	YfhB_g-proteo haloacid dehalogenase superfamily, s	99.17
TIGR01490		202	HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrol	99.15
TIGR01681		128	HAD-SF-IIIC HAD-superfamily phosphatase, subfamily	99.12
TIGR02137		203	HSK-PSP phosphoserine phosphatase/homoserine phosp	99.1
PRK11009		237	aphA acid phosphatase/phosphotransferase; Provisio	99.0
TIGR03333		214	salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl	99.0
TIGR01488		177	HAD-SF-IB Haloacid Dehalogenase superfamily, subfa	98.99
COG0560		212	SerB Phosphoserine phosphatase [Amino acid transpo	98.96
TIGR01663		526	PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase	98.9
TIGR01261		161	hisB_Nterm histidinol-phosphatase. This model desc	98.88
PF00702		215	Hydrolase: haloacid dehalogenase-like hydrolase; I	98.88
KOG3085		237	consensus Predicted hydrolase (HAD superfamily) [G	98.86
TIGR01664		166	DNA-3'-Pase DNA 3'-phosphatase. The central phosph	98.8
TIGR00213		176	GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase	98.78
TIGR01686		320	FkbH FkbH-like domain. The C-terminal portion of t	98.76
smart00577		148	CPDc catalytic domain of ctd-like phosphatases.	98.72
PRK06769		173	hypothetical protein; Validated	98.72
PF06888		234	Put_Phosphatase: Putative Phosphatase; InterPro: I	98.62
PRK08238		479	hypothetical protein; Validated	98.53
TIGR01533		266	lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) famil	98.5
TIGR01458		257	HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydr	98.5
PHA02530		300	pseT polynucleotide kinase; Provisional	98.43
PRK05446		354	imidazole glycerol-phosphate dehydratase/histidino	98.43
TIGR01668		170	YqeG_hyp_ppase HAD superfamily (subfamily IIIA) ph	98.42
TIGR02726		169	phenyl_P_delta phenylphosphate carboxylase, delta	98.25
TIGR01452		279	PGP_euk phosphoglycolate/pyridoxal phosphate phosp	98.23
PRK10530		272	pyridoxal phosphate (PLP) phosphatase; Provisional	98.21
cd01427		139	HAD_like Haloacid dehalogenase-like hydrolases. Th	98.18
TIGR01459		242	HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas	98.16
KOG3109		244	consensus Haloacid dehalogenase-like hydrolase [Ge	98.14
PF12710		192	HAD: haloacid dehalogenase-like hydrolase; PDB: 3P	98.13
TIGR01670		154	YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-pho	98.08
TIGR02244		343	HAD-IG-Ncltidse HAD superfamily (subfamily IG) hyd	98.01
PRK00192		273	mannosyl-3-phosphoglycerate phosphatase; Reviewed	97.99
KOG3120		256	consensus Predicted haloacid dehalogenase-like hyd	97.95
TIGR01684		301	viral_ppase viral phosphatase. These proteins also	97.86
PRK09484		183	3-deoxy-D-manno-octulosonate 8-phosphate phosphata	97.72
PHA03398		303	viral phosphatase superfamily protein; Provisional	97.68
PF06941		191	NT5C: 5' nucleotidase, deoxy (Pyrimidine), cytosol	97.66
PLN02645		311	phosphoglycolate phosphatase	97.66
PF08645		159	PNK3P: Polynucleotide kinase 3 phosphatase; InterP	97.64
TIGR02250		156	FCP1_euk FCP1-like phosphatase, phosphatase domain	97.62
TIGR01544		277	HAD-SF-IE haloacid dehalogenase superfamily, subfa	97.58
PF12689		169	Acid_PPase: Acid Phosphatase; InterPro: IPR010036	97.57
PRK10513		270	sugar phosphate phosphatase; Provisional	97.49
TIGR02251		162	HIF-SF_euk Dullard-like phosphatase domain. This d	97.32
TIGR01459		242	HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas	97.27
COG4229		229	Predicted enolase-phosphatase [Energy production a	97.24
TIGR01457		249	HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydr	97.13
KOG1615		227	consensus Phosphoserine phosphatase [Amino acid tr	97.1
COG2179		175	Predicted hydrolase of the HAD superfamily [Genera	97.09
TIGR02463		221	MPGP_rel mannosyl-3-phosphoglycerate phosphatase-r	97.06
PRK12702		302	mannosyl-3-phosphoglycerate phosphatase; Reviewed	96.98
PLN02177		497	glycerol-3-phosphate acyltransferase	96.93
PRK01158		230	phosphoglycolate phosphatase; Provisional	96.91
PRK15126		272	thiamin pyrimidine pyrophosphate hydrolase; Provis	96.88
TIGR01525		556	ATPase-IB_hvy heavy metal translocating P-type ATP	96.88
PRK10976		266	putative hydrolase; Provisional	96.81
TIGR01512		536	ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translo	96.78
TIGR01675		229	plant-AP plant acid phosphatase. This model explic	96.76
PTZ00174		247	phosphomannomutase; Provisional	96.66
COG4359		220	Uncharacterized conserved protein [Function unknow	96.5
TIGR01680		275	Veg_Stor_Prot vegetative storage protein. The prot	96.38
TIGR01487		215	SPP-like sucrose-phosphate phosphatase-like hydrol	96.33
COG4996		164	Predicted phosphatase [General function prediction	96.33
COG0561		264	Cof Predicted hydrolases of the HAD superfamily [G	96.32
COG0241		181	HisB Histidinol phosphatase and related phosphatas	96.32
PLN02645		311	phosphoglycolate phosphatase	96.25
PF03767		229	Acid_phosphat_B: HAD superfamily, subfamily IIIB (	96.25
TIGR02471		236	sucr_syn_bact_C sucrose phosphate synthase, sucros	96.21
PLN02423		245	phosphomannomutase	96.1
TIGR01482		225	SPP-subfamily Sucrose-phosphate phosphatase subfam	96.06
TIGR01511		562	ATPase-IB1_Cu copper-(or silver)-translocating P-t	96.03
PLN02887		580	hydrolase family protein	95.51
PLN02499		498	glycerol-3-phosphate acyltransferase	95.28
TIGR01681		128	HAD-SF-IIIC HAD-superfamily phosphatase, subfamily	95.26
PRK03669		271	mannosyl-3-phosphoglycerate phosphatase; Reviewed	95.25
PF08282		254	Hydrolase_3: haloacid dehalogenase-like hydrolase;	95.05
PF13344		101	Hydrolase_6: Haloacid dehalogenase-like hydrolase;	94.97
TIGR00099		256	Cof-subfamily Cof subfamily of IIB subfamily of ha	94.91
TIGR01689		126	EcbF-BcbF capsule biosynthesis phosphatase. Due to	94.78
TIGR01484		204	HAD-SF-IIB HAD-superfamily hydrolase, subfamily II	94.71
smart00775		157	LNS2 LNS2 domain. This domain is found in Saccharo	94.54
PRK09484		183	3-deoxy-D-manno-octulosonate 8-phosphate phosphata	94.52
TIGR01456		321	CECR5 HAD-superfamily class IIA hydrolase, TIGR014	94.35
TIGR01684		301	viral_ppase viral phosphatase. These proteins also	94.23
PRK10671		834	copA copper exporting ATPase; Provisional	93.94
TIGR01522		884	ATPase-IIA2_Ca golgi membrane calcium-translocatin	93.91
PHA03398		303	viral phosphatase superfamily protein; Provisional	93.84
cd01427		139	HAD_like Haloacid dehalogenase-like hydrolases. Th	93.66
COG1778		170	Low specificity phosphatase (HAD superfamily) [Gen	93.63
TIGR02461		225	osmo_MPG_phos mannosyl-3-phosphoglycerate phosphat	93.6
PF03031		159	NIF: NLI interacting factor-like phosphatase; Inte	93.5
TIGR01664		166	DNA-3'-Pase DNA 3'-phosphatase. The central phosph	93.44
TIGR01670		154	YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-pho	93.43
PRK10444		248	UMP phosphatase; Provisional	93.32
TIGR01486		256	HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosph	92.99
PRK14502		694	bifunctional mannosyl-3-phosphoglycerate synthase/	92.81
PRK10187		266	trehalose-6-phosphate phosphatase; Provisional	92.65
TIGR01452		279	PGP_euk phosphoglycolate/pyridoxal phosphate phosp	92.02
TIGR00685		244	T6PP trehalose-phosphatase. At least 18 distinct s	91.37
TIGR01457		249	HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydr	91.21
TIGR02726		169	phenyl_P_delta phenylphosphate carboxylase, delta	90.87
TIGR01485		249	SPP_plant-cyano sucrose-6F-phosphate phosphohydrol	90.61
COG1778		170	Low specificity phosphatase (HAD superfamily) [Gen	90.54
PF12689		169	Acid_PPase: Acid Phosphatase; InterPro: IPR010036	90.5
PTZ00445		219	p36-lilke protein; Provisional	90.09
smart00577		148	CPDc catalytic domain of ctd-like phosphatases.	89.98
TIGR01460		236	HAD-SF-IIA Haloacid Dehalogenase Superfamily Class	89.63
COG2503		274	Predicted secreted acid phosphatase [General funct	89.35
KOG2630		254	consensus Enolase-phosphatase E-1 [Amino acid tran	89.3
PF05761		448	5_nucleotid: 5' nucleotidase family; InterPro: IPR	88.95
PF13344		101	Hydrolase_6: Haloacid dehalogenase-like hydrolase;	88.75
TIGR01458		257	HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydr	88.73
TIGR02245		195	HAD_IIID1 HAD-superfamily subfamily IIID hydrolase	88.14
PLN02151		354	trehalose-phosphatase	87.45
PLN03017		366	trehalose-phosphatase	87.43
PRK11033		741	zntA zinc/cadmium/mercury/lead-transporting ATPase	86.72
TIGR00213		176	GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase	86.46
PLN02205		854	alpha,alpha-trehalose-phosphate synthase [UDP-form	86.39
PF05116		247	S6PP: Sucrose-6F-phosphate phosphohydrolase; Inter	86.22
PRK14501		726	putative bifunctional trehalose-6-phosphate syntha	86.02
COG0647		269	NagD Predicted sugar phosphatases of the HAD super	85.84
COG1877		266	OtsB Trehalose-6-phosphatase [Carbohydrate transpo	85.59
TIGR02463		221	MPGP_rel mannosyl-3-phosphoglycerate phosphatase-r	85.15
COG0647		269	NagD Predicted sugar phosphatases of the HAD super	84.42
TIGR02461		225	osmo_MPG_phos mannosyl-3-phosphoglycerate phosphat	84.25
TIGR02251		162	HIF-SF_euk Dullard-like phosphatase domain. This d	83.98
TIGR01261		161	hisB_Nterm histidinol-phosphatase. This model desc	83.77
PF02358		235	Trehalose_PPase: Trehalose-phosphatase; InterPro:	83.53
COG4996		164	Predicted phosphatase [General function prediction	82.51
PLN02580		384	trehalose-phosphatase	82.37
PRK10444		248	UMP phosphatase; Provisional	82.23

>COG0546 Gph Predicted phosphatases [General function prediction only]	Back alignment and domain information

Probab=99.95  E-value=5.1e-27  Score=197.23  Aligned_cols=159  Identities=26%  Similarity=0.310  Sum_probs=126.7

Q ss_pred             CCceEEEecCcccccChHHHHHHHHHHHHHhCCCCCCCCCchhhhHHhhhhcccccccccchhHHHHHHHHHhccccccc
Q 027701            1 MEDLYALDFDGVICDSCEETALSAVKAARVRWPSLFDGVDSALEDWIVDQMHTLRPVVETGYDTLLLVRLLLEMRLPSLR   80 (220)
Q Consensus         1 ~~~~viFDlDGTLvDS~~~i~~s~~~a~~~~~~~~~~g~~~~~~~~~~~~~~~ir~~Ig~G~~~~~~~~~l~~~~~~~~~   80 (220)
                      |+++|+|||||||+||.+.+..++|.+++++|      +++.       ....++.+||.|.+..+. +.+...      
T Consensus         3 ~~~~iiFDlDGTL~Ds~~~~~~~~~~~~~~~~------~~~~-------~~~~~~~~ig~~~~~~~~-~~~~~~------   62 (220)
T COG0546           3 MIKAILFDLDGTLVDSAEDILRAFNAALAELG------LPPL-------DEEEIRQLIGLGLDELIE-RLLGEA------   62 (220)
T ss_pred             CCCEEEEeCCCccccChHHHHHHHHHHHHHcC------CCCC-------CHHHHHHHhcCCHHHHHH-HHhccc------
Confidence            46899999999999999999999999999994      4432       246899999999877552 322110      


Q ss_pred             ccccccCcchHHHhhhhhhhhHHHHHhhcCCHHHHHHHHHHHHHHHhhccccccccCCCCCccHHHHHH---hCCCcEEE
Q 027701           81 KSSVAEGLTVEGILENWLKIKPVIMEEWSENREALIELSGKVRDEWMDTDFTTWIGANRLYPGVSDALK---LASSRIYI  157 (220)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~e~~~~~~~~~r~~y~~~y~~~~~~~~~lypGv~elL~---~~g~~l~I  157 (220)
                              ..                      +...+.++.|+++|.+.|.+..  .+.+||||.++|+   ++|++++|
T Consensus        63 --------~~----------------------~~~~~~~~~~~~~~~~~~~~~~--~~~~~~gv~e~L~~L~~~g~~l~i  110 (220)
T COG0546          63 --------DE----------------------EAAAELVERLREEFLTAYAELL--ESRLFPGVKELLAALKSAGYKLGI  110 (220)
T ss_pred             --------cc----------------------hhHHHHHHHHHHHHHHHHHhhc--cCccCCCHHHHHHHHHhCCCeEEE
Confidence                    00                      0011345566666666655544  4789999999999   89999999


Q ss_pred             EcCCchHHHHHHHHHhhCCCCCCceEecCC----CCCcHHHHHHHHhhCCCCCCceEec
Q 027701          158 VTSNQSRFVETLLRELAGVTITPDRLYGLG----TGPKVNVLKQLQKKPEHQGLRLQRS  212 (220)
Q Consensus       158 ~TnK~~~~a~~iL~~~~gl~~~f~~v~G~~----~~pkp~~l~~~l~~~~~~~~~~~~~  212 (220)
                      +|||++..++.+|++ +|+..+|+.++|.+    .||+|+++..++++++.++++++|=
T Consensus       111 ~T~k~~~~~~~~l~~-~gl~~~F~~i~g~~~~~~~KP~P~~l~~~~~~~~~~~~~~l~V  168 (220)
T COG0546         111 VTNKPERELDILLKA-LGLADYFDVIVGGDDVPPPKPDPEPLLLLLEKLGLDPEEALMV  168 (220)
T ss_pred             EeCCcHHHHHHHHHH-hCCccccceEEcCCCCCCCCcCHHHHHHHHHHhCCChhheEEE
Confidence            999999999999995 99999999999954    4599999999999999998888884

>PRK13226 phosphoglycolate phosphatase; Provisional	Back alignment and domain information

>PRK13288 pyrophosphatase PpaX; Provisional	Back alignment and domain information

>PLN03243 haloacid dehalogenase-like hydrolase; Provisional	Back alignment and domain information

>TIGR03351 PhnX-like phosphonatase-like hydrolase	Back alignment and domain information

>PLN02770 haloacid dehalogenase-like hydrolase family protein	Back alignment and domain information

>TIGR01449 PGP_bact 2-phosphoglycolate phosphatase, prokaryotic	Back alignment and domain information

>PRK13223 phosphoglycolate phosphatase; Provisional	Back alignment and domain information

>PLN02575 haloacid dehalogenase-like hydrolase	Back alignment and domain information

>PRK13225 phosphoglycolate phosphatase; Provisional	Back alignment and domain information

>PRK11587 putative phosphatase; Provisional	Back alignment and domain information

>TIGR01422 phosphonatase phosphonoacetaldehyde hydrolase	Back alignment and domain information

>PRK13478 phosphonoacetaldehyde hydrolase; Provisional	Back alignment and domain information

>TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein	Back alignment and domain information

>PRK10826 2-deoxyglucose-6-phosphatase; Provisional	Back alignment and domain information

>TIGR02009 PGMB-YQAB-SF beta-phosphoglucomutase family hydrolase	Back alignment and domain information

>PRK10725 fructose-1-P/6-phosphogluconate phosphatase; Provisional	Back alignment and domain information

>TIGR01990 bPGM beta-phosphoglucomutase	Back alignment and domain information

>TIGR01548 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, subfamily IA hydrolase, TIGR01548	Back alignment and domain information

>PRK13222 phosphoglycolate phosphatase; Provisional	Back alignment and domain information

>PLN02940 riboflavin kinase	Back alignment and domain information

>PRK10563 6-phosphogluconate phosphatase; Provisional	Back alignment and domain information

>COG0637 Predicted phosphatase/phosphohexomutase [General function prediction only]	Back alignment and domain information

>PRK10748 flavin mononucleotide phosphatase; Provisional	Back alignment and domain information

>TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253	Back alignment and domain information

>TIGR02252 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydrolase	Back alignment and domain information

>PRK06698 bifunctional 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase/phosphatase; Validated	Back alignment and domain information

>TIGR01993 Pyr-5-nucltdase pyrimidine 5'-nucleotidase	Back alignment and domain information

>PLN02779 haloacid dehalogenase-like hydrolase family protein	Back alignment and domain information

>PRK09449 dUMP phosphatase; Provisional	Back alignment and domain information

>TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254	Back alignment and domain information

>PHA02597 30	Back alignment and domain information

>PLN02919 haloacid dehalogenase-like hydrolase family protein	Back alignment and domain information

>PF13419 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A	Back alignment and domain information

>TIGR01428 HAD_type_II 2-haloalkanoic acid dehalogenase, type II	Back alignment and domain information

>PRK14988 GMP/IMP nucleotidase; Provisional	Back alignment and domain information

>TIGR01549 HAD-SF-IA-v1 haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E	Back alignment and domain information

>TIGR02247 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-like phosphatase	Back alignment and domain information

>TIGR01493 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, subfamily IA, variant 2 with 3rd motif like haloacid dehalogenase	Back alignment and domain information

>PLN02811 hydrolase	Back alignment and domain information

>PRK09456 ?-D-glucose-1-phosphatase; Provisional	Back alignment and domain information

>TIGR01509 HAD-SF-IA-v3 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED	Back alignment and domain information

>PRK11590 hypothetical protein; Provisional	Back alignment and domain information

>TIGR00338 serB phosphoserine phosphatase SerB	Back alignment and domain information

>TIGR01672 AphA HAD superfamily (subfamily IIIB) phosphatase, TIGR01672	Back alignment and domain information

>PLN02954 phosphoserine phosphatase	Back alignment and domain information

>TIGR01491 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPase-like hydrolase, archaeal	Back alignment and domain information

>COG1011 Predicted hydrolase (HAD superfamily) [General function prediction only]	Back alignment and domain information

>PRK13582 thrH phosphoserine phosphatase; Provisional	Back alignment and domain information

>PRK09552 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; Reviewed	Back alignment and domain information

>TIGR01662 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily IIIA	Back alignment and domain information

>TIGR01489 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopentane phosphatase	Back alignment and domain information

>KOG2914 consensus Predicted haloacid-halidohydrolase and related hydrolases [General function prediction only]	Back alignment and domain information

>TIGR01685 MDP-1 magnesium-dependent phosphatase-1	Back alignment and domain information

>TIGR01656 Histidinol-ppas histidinol-phosphate phosphatase family domain	Back alignment and domain information

>PRK08942 D,D-heptose 1,7-bisphosphate phosphatase; Validated	Back alignment and domain information

>TIGR01691 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopentane phosphatase	Back alignment and domain information

>PRK11133 serB phosphoserine phosphatase; Provisional	Back alignment and domain information

>TIGR01545 YfhB_g-proteo haloacid dehalogenase superfamily, subfamily IF hydrolase, YfhB	Back alignment and domain information

>TIGR01490 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrolase, TIGR01490	Back alignment and domain information

>TIGR01681 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily IIIC	Back alignment and domain information

>TIGR02137 HSK-PSP phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein	Back alignment and domain information

>PRK11009 aphA acid phosphatase/phosphotransferase; Provisional	Back alignment and domain information

>TIGR03333 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase	Back alignment and domain information

>TIGR01488 HAD-SF-IB Haloacid Dehalogenase superfamily, subfamily IB, phosphoserine phosphatase-like	Back alignment and domain information

>COG0560 SerB Phosphoserine phosphatase [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase	Back alignment and domain information

>TIGR01261 hisB_Nterm histidinol-phosphatase	Back alignment and domain information

>PF00702 Hydrolase: haloacid dehalogenase-like hydrolase; InterPro: IPR005834 This group of hydrolase enzymes is structurally different from the alpha/beta hydrolase family (abhydrolase)	Back alignment and domain information

>KOG3085 consensus Predicted hydrolase (HAD superfamily) [General function prediction only]	Back alignment and domain information

>TIGR01664 DNA-3'-Pase DNA 3'-phosphatase	Back alignment and domain information

>TIGR00213 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase	Back alignment and domain information

>TIGR01686 FkbH FkbH-like domain	Back alignment and domain information

>smart00577 CPDc catalytic domain of ctd-like phosphatases	Back alignment and domain information

>PRK06769 hypothetical protein; Validated	Back alignment and domain information

>PF06888 Put_Phosphatase: Putative Phosphatase; InterPro: IPR016965 This group represents phosphatases related to PHOSPHO1 and PHOSPHO2 []	Back alignment and domain information

>PRK08238 hypothetical protein; Validated	Back alignment and domain information

>TIGR01533 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) family	Back alignment and domain information

>TIGR01458 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydrolase, TIGR01458	Back alignment and domain information

>PHA02530 pseT polynucleotide kinase; Provisional	Back alignment and domain information

>PRK05446 imidazole glycerol-phosphate dehydratase/histidinol phosphatase; Provisional	Back alignment and domain information

>TIGR01668 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) phosphatase, TIGR01668	Back alignment and domain information

>TIGR02726 phenyl_P_delta phenylphosphate carboxylase, delta subunit	Back alignment and domain information

>TIGR01452 PGP_euk phosphoglycolate/pyridoxal phosphate phosphatase family	Back alignment and domain information

>PRK10530 pyridoxal phosphate (PLP) phosphatase; Provisional	Back alignment and domain information

>cd01427 HAD_like Haloacid dehalogenase-like hydrolases	Back alignment and domain information

>TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459	Back alignment and domain information

>KOG3109 consensus Haloacid dehalogenase-like hydrolase [General function prediction only]	Back alignment and domain information

>PF12710 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P96_A 3N28_A 3FVV_A 1RKU_A 1RKV_A 1Y8A_A 2FEA_B 3KD3_B	Back alignment and domain information

>TIGR01670 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family	Back alignment and domain information

>TIGR02244 HAD-IG-Ncltidse HAD superfamily (subfamily IG) hydrolase, 5'-nucleotidase	Back alignment and domain information

>PRK00192 mannosyl-3-phosphoglycerate phosphatase; Reviewed	Back alignment and domain information

>KOG3120 consensus Predicted haloacid dehalogenase-like hydrolase [General function prediction only]	Back alignment and domain information

>TIGR01684 viral_ppase viral phosphatase	Back alignment and domain information

>PRK09484 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; Provisional	Back alignment and domain information

>PHA03398 viral phosphatase superfamily protein; Provisional	Back alignment and domain information

>PF06941 NT5C: 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C); InterPro: IPR010708 This family consists of several 5' nucleotidase, deoxy (Pyrimidine), and cytosolic type C (NT5C) proteins	Back alignment and domain information

>PLN02645 phosphoglycolate phosphatase	Back alignment and domain information

>PF08645 PNK3P: Polynucleotide kinase 3 phosphatase; InterPro: IPR013954 Polynucleotide kinase 3 phosphatases play a role in the repair of single breaks in DNA induced by DNA-damaging agents such as gamma radiation and camptothecin []	Back alignment and domain information

>TIGR02250 FCP1_euk FCP1-like phosphatase, phosphatase domain	Back alignment and domain information

>TIGR01544 HAD-SF-IE haloacid dehalogenase superfamily, subfamily IE hydrolase, TIGR01544	Back alignment and domain information

>PF12689 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 This entry represents two closely related clades of sequences from eukaryotes and archaea	Back alignment and domain information

>PRK10513 sugar phosphate phosphatase; Provisional	Back alignment and domain information

>TIGR02251 HIF-SF_euk Dullard-like phosphatase domain	Back alignment and domain information

>TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459	Back alignment and domain information

>COG4229 Predicted enolase-phosphatase [Energy production and conversion]	Back alignment and domain information

>TIGR01457 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydrolase, TIGR01457	Back alignment and domain information

>KOG1615 consensus Phosphoserine phosphatase [Amino acid transport and metabolism]	Back alignment and domain information

>COG2179 Predicted hydrolase of the HAD superfamily [General function prediction only]	Back alignment and domain information

>TIGR02463 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-related protein	Back alignment and domain information

>PRK12702 mannosyl-3-phosphoglycerate phosphatase; Reviewed	Back alignment and domain information

>PLN02177 glycerol-3-phosphate acyltransferase	Back alignment and domain information

>PRK01158 phosphoglycolate phosphatase; Provisional	Back alignment and domain information

>PRK15126 thiamin pyrimidine pyrophosphate hydrolase; Provisional	Back alignment and domain information

>TIGR01525 ATPase-IB_hvy heavy metal translocating P-type ATPase	Back alignment and domain information

>PRK10976 putative hydrolase; Provisional	Back alignment and domain information

>TIGR01512 ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase	Back alignment and domain information

>TIGR01675 plant-AP plant acid phosphatase	Back alignment and domain information

>PTZ00174 phosphomannomutase; Provisional	Back alignment and domain information

>COG4359 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>TIGR01680 Veg_Stor_Prot vegetative storage protein	Back alignment and domain information

>TIGR01487 SPP-like sucrose-phosphate phosphatase-like hydrolase, Archaeal	Back alignment and domain information

>COG4996 Predicted phosphatase [General function prediction only]	Back alignment and domain information

>COG0561 Cof Predicted hydrolases of the HAD superfamily [General function prediction only]	Back alignment and domain information

>COG0241 HisB Histidinol phosphatase and related phosphatases [Amino acid transport and metabolism]	Back alignment and domain information

>PLN02645 phosphoglycolate phosphatase	Back alignment and domain information

>PF03767 Acid_phosphat_B: HAD superfamily, subfamily IIIB (Acid phosphatase); InterPro: IPR005519 This family of class B acid phosphatases also contains a number of vegetative storage proteins (VPS25)	Back alignment and domain information

>TIGR02471 sucr_syn_bact_C sucrose phosphate synthase, sucrose phosphatase-like domain, bacterial	Back alignment and domain information

>PLN02423 phosphomannomutase	Back alignment and domain information

>TIGR01482 SPP-subfamily Sucrose-phosphate phosphatase subfamily	Back alignment and domain information

>TIGR01511 ATPase-IB1_Cu copper-(or silver)-translocating P-type ATPase	Back alignment and domain information

>PLN02887 hydrolase family protein	Back alignment and domain information

>PLN02499 glycerol-3-phosphate acyltransferase	Back alignment and domain information

>TIGR01681 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily IIIC	Back alignment and domain information

>PRK03669 mannosyl-3-phosphoglycerate phosphatase; Reviewed	Back alignment and domain information

>PF08282 Hydrolase_3: haloacid dehalogenase-like hydrolase; InterPro: IPR013200 The Haloacid Dehydrogenase (HAD) superfamily includes phosphatases, phosphonatases, P-type ATPases, beta-phosphoglucomutases, phosphomannomutases, and dehalogenases, which are involved in a variety of cellular processes ranging from amino acid biosynthesis to detoxification []	Back alignment and domain information

>PF13344 Hydrolase_6: Haloacid dehalogenase-like hydrolase; PDB: 2HO4_B 1YV9_A 1WVI_B 3EPR_A 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A	Back alignment and domain information

>TIGR00099 Cof-subfamily Cof subfamily of IIB subfamily of haloacid dehalogenase superfamily	Back alignment and domain information

>TIGR01689 EcbF-BcbF capsule biosynthesis phosphatase	Back alignment and domain information

>TIGR01484 HAD-SF-IIB HAD-superfamily hydrolase, subfamily IIB	Back alignment and domain information

>smart00775 LNS2 LNS2 domain	Back alignment and domain information

>PRK09484 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; Provisional	Back alignment and domain information

>TIGR01456 CECR5 HAD-superfamily class IIA hydrolase, TIGR01456, CECR5	Back alignment and domain information

>TIGR01684 viral_ppase viral phosphatase	Back alignment and domain information

>PRK10671 copA copper exporting ATPase; Provisional	Back alignment and domain information

>TIGR01522 ATPase-IIA2_Ca golgi membrane calcium-translocating P-type ATPase	Back alignment and domain information

>PHA03398 viral phosphatase superfamily protein; Provisional	Back alignment and domain information

>cd01427 HAD_like Haloacid dehalogenase-like hydrolases	Back alignment and domain information

>COG1778 Low specificity phosphatase (HAD superfamily) [General function prediction only]	Back alignment and domain information

>TIGR02461 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphatase	Back alignment and domain information

>PF03031 NIF: NLI interacting factor-like phosphatase; InterPro: IPR004274 The function of this domain is unclear	Back alignment and domain information

>TIGR01664 DNA-3'-Pase DNA 3'-phosphatase	Back alignment and domain information

>TIGR01670 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family	Back alignment and domain information

>PRK10444 UMP phosphatase; Provisional	Back alignment and domain information

>TIGR01486 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosphatase family	Back alignment and domain information

>PRK14502 bifunctional mannosyl-3-phosphoglycerate synthase/mannosyl-3 phosphoglycerate phosphatase; Provisional	Back alignment and domain information

>PRK10187 trehalose-6-phosphate phosphatase; Provisional	Back alignment and domain information

>TIGR01452 PGP_euk phosphoglycolate/pyridoxal phosphate phosphatase family	Back alignment and domain information

>TIGR00685 T6PP trehalose-phosphatase	Back alignment and domain information

>TIGR01457 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydrolase, TIGR01457	Back alignment and domain information

>TIGR02726 phenyl_P_delta phenylphosphate carboxylase, delta subunit	Back alignment and domain information

>TIGR01485 SPP_plant-cyano sucrose-6F-phosphate phosphohydrolase	Back alignment and domain information

>COG1778 Low specificity phosphatase (HAD superfamily) [General function prediction only]	Back alignment and domain information

>PF12689 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 This entry represents two closely related clades of sequences from eukaryotes and archaea	Back alignment and domain information

>PTZ00445 p36-lilke protein; Provisional	Back alignment and domain information

>smart00577 CPDc catalytic domain of ctd-like phosphatases	Back alignment and domain information

>TIGR01460 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class (subfamily) IIA	Back alignment and domain information

>COG2503 Predicted secreted acid phosphatase [General function prediction only]	Back alignment and domain information

>KOG2630 consensus Enolase-phosphatase E-1 [Amino acid transport and metabolism]	Back alignment and domain information

>PF05761 5_nucleotid: 5' nucleotidase family; InterPro: IPR008380 This family includes a 5'-nucleotidase, 3	Back alignment and domain information

>PF13344 Hydrolase_6: Haloacid dehalogenase-like hydrolase; PDB: 2HO4_B 1YV9_A 1WVI_B 3EPR_A 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A	Back alignment and domain information

>TIGR01458 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydrolase, TIGR01458	Back alignment and domain information

>TIGR02245 HAD_IIID1 HAD-superfamily subfamily IIID hydrolase, TIGR02245	Back alignment and domain information

>PLN02151 trehalose-phosphatase	Back alignment and domain information

>PLN03017 trehalose-phosphatase	Back alignment and domain information

>PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional	Back alignment and domain information

>TIGR00213 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase	Back alignment and domain information

>PLN02205 alpha,alpha-trehalose-phosphate synthase [UDP-forming]	Back alignment and domain information

>PF05116 S6PP: Sucrose-6F-phosphate phosphohydrolase; InterPro: IPR006380 This family of sequences represent sucrose phosphate phosphohydrolase (SPP) from plants and cyanobacteria []	Back alignment and domain information

>PRK14501 putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional	Back alignment and domain information

>COG0647 NagD Predicted sugar phosphatases of the HAD superfamily [Carbohydrate transport and metabolism]	Back alignment and domain information

>COG1877 OtsB Trehalose-6-phosphatase [Carbohydrate transport and metabolism]	Back alignment and domain information

>TIGR02463 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-related protein	Back alignment and domain information

>COG0647 NagD Predicted sugar phosphatases of the HAD superfamily [Carbohydrate transport and metabolism]	Back alignment and domain information

>TIGR02461 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphatase	Back alignment and domain information

>TIGR02251 HIF-SF_euk Dullard-like phosphatase domain	Back alignment and domain information

>TIGR01261 hisB_Nterm histidinol-phosphatase	Back alignment and domain information

>PF02358 Trehalose_PPase: Trehalose-phosphatase; InterPro: IPR003337 Trehalose-phosphatases 3	Back alignment and domain information

>COG4996 Predicted phosphatase [General function prediction only]	Back alignment and domain information

>PLN02580 trehalose-phosphatase	Back alignment and domain information

>PRK10444 UMP phosphatase; Provisional	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		220
2hi0_A		240	Putative phosphoglycolate phosphatase; YP_619066.1	99.89
2ah5_A		210	COG0546: predicted phosphatases; MCSG, structural	99.89
3kbb_A		216	Phosphorylated carbohydrates phosphatase TM_1254;	99.88
4gib_A		250	Beta-phosphoglucomutase; rossmann fold, HAD-like,	99.87
4g9b_A		243	Beta-PGM, beta-phosphoglucomutase; HAD, putative p	99.86
3mc1_A		226	Predicted phosphatase, HAD family; PSI2, NYSGXRC,	99.86
2hsz_A		243	Novel predicted phosphatase; structural genomics,	99.85
2nyv_A		222	Pgpase, PGP, phosphoglycolate phosphatase; structu	99.84
3sd7_A		240	Putative phosphatase; structural genomics, haloaci	99.83
3s6j_A		233	Hydrolase, haloacid dehalogenase-like family; stru	99.83
4ex6_A		237	ALNB; modified rossman fold, phosphatase, magnesiu	99.82
3nas_A		233	Beta-PGM, beta-phosphoglucomutase; PSI, structural	99.81
2hdo_A		209	Phosphoglycolate phosphatase; NP_784602.1, structu	99.8
2gfh_A		260	Haloacid dehalogenase-like hydrolase domain conta;	99.8
3e58_A		214	Putative beta-phosphoglucomutase; structu genomics	99.8
3iru_A		277	Phoshonoacetaldehyde hydrolase like protein; phosp	99.8
3qxg_A		243	Inorganic pyrophosphatase; hydrolase, magnesium bi	99.79
2wf7_A		221	Beta-PGM, beta-phosphoglucomutase; transition stat	99.79
3dv9_A		247	Beta-phosphoglucomutase; structural genomics, APC6	99.79
3ddh_A		234	Putative haloacid dehalogenase-like family hydrol;	99.79
2hcf_A		234	Hydrolase, haloacid dehalogenase-like family; NP_6	99.78
3kzx_A		231	HAD-superfamily hydrolase, subfamily IA, variant;	99.78
2hoq_A		241	Putative HAD-hydrolase PH1655; haloacid dehalogena	99.78
2pib_A		216	Phosphorylated carbohydrates phosphatase TM_1254;	99.78
3l5k_A		250	Protein GS1, haloacid dehalogenase-like hydrolase	99.78
3qnm_A		240	Haloacid dehalogenase-like hydrolase; structural g	99.77
1te2_A		226	Putative phosphatase; structural genomics, phospha	99.77
3ed5_A		238	YFNB; APC60080, bacillus subtilis subsp. subtilis	99.76
2om6_A		235	Probable phosphoserine phosphatase; rossmann fold,	99.76
4eek_A		259	Beta-phosphoglucomutase-related protein; hydrolase	99.76
3d6j_A		225	Putative haloacid dehalogenase-like hydrolase; str	99.75
3vay_A		230	HAD-superfamily hydrolase; rossmann fold, haloacid	99.75
2g80_A		253	Protein UTR4; YEL038W, UTR4 protein (unknown trans	99.74
1swv_A		267	Phosphonoacetaldehyde hydrolase; HAD enzyme superf	99.74
2pke_A		251	Haloacid delahogenase-like family hydrolase; NP_63	99.74
2i6x_A		211	Hydrolase, haloacid dehalogenase-like family; HAD	99.73
2go7_A		207	Hydrolase, haloacid dehalogenase-like family; stru	99.72
3nuq_A		282	Protein SSM1, putative nucleotide phosphatase; sup	99.72
1yns_A		261	E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo	99.71
2zg6_A		220	Putative uncharacterized protein ST2620, probable	99.71
3k1z_A		263	Haloacid dehalogenase-like hydrolase domain-conta	99.71
3umg_A		254	Haloacid dehalogenase; defluorinase, hydrolase; 2.	99.71
3u26_A		234	PF00702 domain protein; structural genomics, PSI-b	99.7
2fdr_A		229	Conserved hypothetical protein; SAD, structural ge	99.7
3umc_A		254	Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeru	99.7
2fi1_A		190	Hydrolase, haloacid dehalogenase-like family; stru	99.69
1zrn_A		232	L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseud	99.68
3m9l_A		205	Hydrolase, haloacid dehalogenase-like family; HAD	99.68
3umb_A		233	Dehalogenase-like hydrolase; 2.20A {Ralstonia sola	99.68
3cnh_A		200	Hydrolase family protein; NP_295428.1, predicted h	99.68
2p11_A		231	Hypothetical protein; putative haloacid dehalogena	99.67
2no4_A		240	(S)-2-haloacid dehalogenase IVA; HAD superfamily,	99.66
3um9_A		230	Haloacid dehalogenase, type II; haloacid dehalogen	99.65
1qq5_A		253	Protein (L-2-haloacid dehalogenase); hydrolase; 1.	99.65
2qlt_A		275	(DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, sac	99.65
3smv_A		240	S-(-)-azetidine-2-carboxylate hydrolase; haloacid	99.65
1nnl_A		225	L-3-phosphoserine phosphatase; PSP, HPSP, phospho-	99.64
2b0c_A		206	Putative phosphatase; alpha-D-glucose-1-phosphate,	99.62
4dcc_A		229	Putative haloacid dehalogenase-like hydrolase; mag	99.61
1rku_A		206	Homoserine kinase; phosphoserine phosphatase, phos	99.61
2w43_A		201	Hypothetical 2-haloalkanoic acid dehalogenase; hyd	99.59
3m1y_A		217	Phosphoserine phosphatase (SERB); NYSGXRC, PSI II,	99.59
2i7d_A		193	5'(3')-deoxyribonucleotidase, cytosolic type; hydr	99.58
3i28_A		555	Epoxide hydrolase 2; aromatic hydrocarbons catabol	99.58
3bwv_A		180	Putative 5'(3')-deoxyribonucleotidase; NP_764060.1	99.57
3fvv_A		232	Uncharacterized protein; unknown function, structu	99.56
1q92_A		197	5(3)-deoxyribonucleotidase; alpha-beta rossman fol	99.54
3a1c_A		287	Probable copper-exporting P-type ATPase A; ATP-bin	99.54
3ib6_A		189	Uncharacterized protein; structural genomics, unkn	99.52
4eze_A		317	Haloacid dehalogenase-like hydrolase; magnesium bi	99.49
2oda_A		196	Hypothetical protein pspto_2114; haloacid dehaloge	99.47
2wm8_A		187	MDP-1, magnesium-dependent phosphatase 1; haloacid	99.46
1l7m_A		211	Phosphoserine phosphatase; rossmann fold, four-hel	99.44
2fea_A		236	2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate	99.44
3p96_A		415	Phosphoserine phosphatase SERB; ssgcid, structural	99.38
3skx_A		280	Copper-exporting P-type ATPase B; P1B-ATPase, ATP	99.36
3l8h_A		179	Putative haloacid dehalogenase-like hydrolase; HAD	99.33
3kd3_A		219	Phosphoserine phosphohydrolase-like protein; csgid	99.28
3zvl_A		416	Bifunctional polynucleotide phosphatase/kinase; hy	99.28
2c4n_A		250	Protein NAGD; nucleotide phosphatase, HAD superfam	99.27
2yj3_A		263	Copper-transporting ATPase; hydrolase, P-type ATPa	98.88
2gmw_A		211	D,D-heptose 1,7-bisphosphate phosphatase; Zn-bindi	99.23
3nvb_A		387	Uncharacterized protein; protein FKBH, protein fkb	99.2
2b82_A		211	APHA, class B acid phosphatase; DDDD acid phosphat	99.2
3gyg_A		289	NTD biosynthesis operon putative hydrolase NTDB; P	99.2
2i33_A		258	Acid phosphatase; HAD superfamily, hydrolase; 1.57	99.19
1yv9_A		264	Hydrolase, haloacid dehalogenase family; hypotheti	99.17
3ij5_A		211	3-deoxy-D-manno-octulosonate 8-phosphate phosphat;	99.17
3n28_A		335	Phosphoserine phosphatase; HAD family hydrolase, s	99.14
3mn1_A		189	Probable YRBI family phosphatase; structural genom	99.12
3e8m_A		164	Acylneuraminate cytidylyltransferase; 2-keto-3-deo	99.1
2ho4_A		259	Haloacid dehalogenase-like hydrolase domain contai	99.08
4ap9_A		201	Phosphoserine phosphatase; hydrolase, haloacid deh	99.05
2p9j_A		162	Hypothetical protein AQ2171; secsg, riken, PSI, st	99.04
3mmz_A		176	Putative HAD family hydrolase; structural genomics	99.03
2o2x_A		218	Hypothetical protein; structural genomics, joint c	99.01
3n07_A		195	3-deoxy-D-manno-octulosonate 8-phosphate phosphat;	99.0
1qyi_A		384	ZR25, hypothetical protein; structural genomics, P	98.94
1k1e_A		180	Deoxy-D-mannose-octulosonate 8-phosphate phosphat;	98.92
2pr7_A		137	Haloacid dehalogenase/epoxide hydrolase family; NP	98.85
3n1u_A		191	Hydrolase, HAD superfamily, subfamily III A; struc	98.85
1vjr_A		271	4-nitrophenylphosphatase; TM1742, structural genom	98.81
3ocu_A		262	Lipoprotein E; hydrolase, outer membrane; HET: NMN	98.77
2fpr_A		176	Histidine biosynthesis bifunctional protein HISB;	98.76
2x4d_A		271	HLHPP, phospholysine phosphohistidine inorganic py	98.75
1wr8_A		231	Phosphoglycolate phosphatase; alpha / beta core do	98.73
3dao_A		283	Putative phosphatse; structural genomics, joint ce	98.73
3pct_A		260	Class C acid phosphatase; hydrolase, outer membran	98.71
4dw8_A		279	Haloacid dehalogenase-like hydrolase; HAD, putativ	98.67
3dnp_A		290	Stress response protein YHAX; structural PSI-2, pr	98.65
3fzq_A		274	Putative hydrolase; YP_001086940.1, putative haloa	98.61
3l7y_A		304	Putative uncharacterized protein SMU.1108C; hydrol	98.59
2oyc_A		306	PLP phosphatase, pyridoxal phosphate phosphatase;	98.53
1rlm_A		271	Phosphatase; HAD family, rossman fold, hydrolase;	98.53
3mpo_A		279	Predicted hydrolase of the HAD superfamily; SGX, P	98.52
1ltq_A		301	Polynucleotide kinase; phosphatase, alpha/beta, P-	98.51
3pgv_A		285	Haloacid dehalogenase-like hydrolase; structural g	98.5
1zjj_A		263	Hypothetical protein PH1952; alpha/beta hydrolase	98.5
3pdw_A		266	Uncharacterized hydrolase YUTF; structural genomic	98.28
3epr_A		264	Hydrolase, haloacid dehalogenase-like family; stru	98.15
4gxt_A		385	A conserved functionally unknown protein; structur	97.99
4as2_A		327	Phosphorylcholine phosphatase; hydrolase, HAD supe	97.92
2ght_A		181	Carboxy-terminal domain RNA polymerase II polypept	97.92
2hhl_A		195	CTD small phosphatase-like protein; CTD phosphatas	97.87
2r8e_A		188	3-deoxy-D-manno-octulosonate 8-phosphate phosphata	97.84
1y8a_A		332	Hypothetical protein AF1437; structural genomics,	97.83
3zx4_A		259	MPGP, mannosyl-3-phosphoglycerate phosphatase; hyd	97.8
3ef0_A		372	RNA polymerase II subunit A C-terminal domain phos	97.78
3qgm_A		268	P-nitrophenyl phosphatase (PHO2); structural genom	97.67
3r4c_A		268	Hydrolase, haloacid dehalogenase-like hydrolase; h	97.66
2hx1_A		284	Predicted sugar phosphatases of the HAD superfamil	97.61
2obb_A		142	Hypothetical protein; structural genomics, PSI-2,	97.46
2hx1_A		284	Predicted sugar phosphatases of the HAD superfamil	97.45
2pq0_A		258	Hypothetical conserved protein GK1056; hyopthetica	97.43
3ewi_A		168	N-acylneuraminate cytidylyltransferase; beta barre	97.38
1nrw_A		288	Hypothetical protein, haloacid dehalogenase-like h	97.33
4fe3_A		297	Cytosolic 5'-nucleotidase 3; substrate complex, HA	97.27
1nf2_A		268	Phosphatase; structural proteomics, HAD NEW fold,	97.21
3kc2_A		352	Uncharacterized protein YKR070W; HAD-like, mitocho	97.14
1rkq_A		282	Hypothetical protein YIDA; two domain structure wi	97.0
2rbk_A		261	Putative uncharacterized protein; HAD-like phospha	97.0
1xvi_A		275	MPGP, YEDP, putative mannosyl-3-phosphoglycerate p	97.0
3j08_A		645	COPA, copper-exporting P-type ATPase A; copper tra	96.88
3f9r_A		246	Phosphomannomutase; trypanosome glycobiology struc	96.85
1xpj_A		126	Hypothetical protein; structural genomics, MCSG, p	96.81
2b30_A		301	Pvivax hypothetical protein; SGPP, structural geno	96.75
2amy_A		246	PMM 2, phosphomannomutase 2; HS.459855, HS.313504,	96.5
1l6r_A		227	Hypothetical protein TA0175; structural genomics,	96.44
2fue_A		262	PMM 1, PMMH-22, phosphomannomutase 1; enzyme-produ	96.31
2zos_A		249	MPGP, mannosyl-3-phosphoglycerate phosphatase; hal	96.22
2jc9_A		555	Cytosolic purine 5'-nucleotidase; cytosolic 5-prim	96.1
1s2o_A		244	SPP, sucrose-phosphatase; phosphohydrolase, HAD su	95.94
2r8e_A		188	3-deoxy-D-manno-octulosonate 8-phosphate phosphata	95.74
1u02_A		239	Trehalose-6-phosphate phosphatase related protein;	95.28
2pr7_A		137	Haloacid dehalogenase/epoxide hydrolase family; NP	95.21
3ewi_A		168	N-acylneuraminate cytidylyltransferase; beta barre	95.12
3qle_A		204	TIM50P; chaperone, mitochondrion, preprotein trans	93.59
2hhl_A		195	CTD small phosphatase-like protein; CTD phosphatas	91.35
4g63_A		470	Cytosolic IMP-GMP specific 5'-nucleotidase; struct	90.39
2fpr_A		176	Histidine biosynthesis bifunctional protein HISB;	89.34
2ght_A		181	Carboxy-terminal domain RNA polymerase II polypept	88.83
3j09_A		723	COPA, copper-exporting P-type ATPase A; copper tra	85.53
3qle_A		204	TIM50P; chaperone, mitochondrion, preprotein trans	81.25
3shq_A		320	UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila	80.66

>2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii}	Back alignment and structure

Probab=99.89  E-value=1.4e-22  Score=168.33  Aligned_cols=178  Identities=14%  Similarity=0.108  Sum_probs=125.0

Q ss_pred             CCceEEEecCcccccChHHHHHHHHHHHHHhCCCCCCCCC-chhhhHHhhhhcccccccccchhHHHHHHHHHhcccccc
Q 027701            1 MEDLYALDFDGVICDSCEETALSAVKAARVRWPSLFDGVD-SALEDWIVDQMHTLRPVVETGYDTLLLVRLLLEMRLPSL   79 (220)
Q Consensus         1 ~~~~viFDlDGTLvDS~~~i~~s~~~a~~~~~~~~~~g~~-~~~~~~~~~~~~~ir~~Ig~G~~~~~~~~~l~~~~~~~~   79 (220)
                      |.|+|+|||||||+||.+.+..+.+.+++++      |++ ...       .+.++.++|.+....+ .+.+....    
T Consensus         3 ~~k~viFDlDGTL~ds~~~~~~~~~~~~~~~------g~~~~~~-------~~~~~~~~g~~~~~~~-~~~~~~~~----   64 (240)
T 2hi0_A            3 KYKAAIFDMDGTILDTSADLTSALNYAFEQT------GHRHDFT-------VEDIKNFFGSGVVVAV-TRALAYEA----   64 (240)
T ss_dssp             SCSEEEECSBTTTEECHHHHHHHHHHHHHHT------TSCCCCC-------HHHHHHHCSSCHHHHH-HHHHHHHT----
T ss_pred             cccEEEEecCCCCccCHHHHHHHHHHHHHHc------CCCCCCC-------HHHHHHhcCccHHHHH-HHHHHhcc----
Confidence            4799999999999999999999999999999      443 211       2456778888765433 12221000    


Q ss_pred             cccccccCcchHHHhhhhhhhhHHHHH-hhcCCHHHHHHHHHHHHHHHhhccccccccCCCCCccHHHHHH---hCCCcE
Q 027701           80 RKSSVAEGLTVEGILENWLKIKPVIME-EWSENREALIELSGKVRDEWMDTDFTTWIGANRLYPGVSDALK---LASSRI  155 (220)
Q Consensus        80 ~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~g~~~e~~~~~~~~~r~~y~~~y~~~~~~~~~lypGv~elL~---~~g~~l  155 (220)
                             ....... ..+.   ..+.. ..+++.+...+..+.++++|.+.    ......+|||+.++|+   ++|+++
T Consensus        65 -------~~~~~~~-~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~----~~~~~~~~~g~~~~l~~l~~~g~~~  129 (240)
T 2hi0_A           65 -------GSSRESL-VAFG---TKDEQIPEAVTQTEVNRVLEVFKPYYADH----CQIKTGPFPGILDLMKNLRQKGVKL  129 (240)
T ss_dssp             -------TCCHHHH-TTTT---STTCCCCTTCCHHHHHHHHHHHHHHHHHT----SSSSCEECTTHHHHHHHHHHTTCEE
T ss_pred             -------ccccccc-cccc---ccccccCCCCCHHHHHHHHHHHHHHHHHh----hhhcCCcCCCHHHHHHHHHHCCCEE
Confidence                   0001000 0000   00000 01234555666667777776543    2234689999999999   789999


Q ss_pred             EEEcCCchHHHHHHHHHhhCCCCCCceEecCC----CCCcHHHHHHHHhhCCCCCCceEecc
Q 027701          156 YIVTSNQSRFVETLLRELAGVTITPDRLYGLG----TGPKVNVLKQLQKKPEHQGLRLQRST  213 (220)
Q Consensus       156 ~I~TnK~~~~a~~iL~~~~gl~~~f~~v~G~~----~~pkp~~l~~~l~~~~~~~~~~~~~~  213 (220)
                      +|+||++...++.++++ +|+. +|+.+++++    .||||++++++++++|.++++++|=-
T Consensus       130 ~i~t~~~~~~~~~~l~~-~~l~-~f~~~~~~~~~~~~Kp~p~~~~~~~~~l~~~~~~~~~vG  189 (240)
T 2hi0_A          130 AVVSNKPNEAVQVLVEE-LFPG-SFDFALGEKSGIRRKPAPDMTSECVKVLGVPRDKCVYIG  189 (240)
T ss_dssp             EEEEEEEHHHHHHHHHH-HSTT-TCSEEEEECTTSCCTTSSHHHHHHHHHHTCCGGGEEEEE
T ss_pred             EEEeCCCHHHHHHHHHH-cCCc-ceeEEEecCCCCCCCCCHHHHHHHHHHcCCCHHHeEEEc
Confidence            99999999999999995 9998 999998865    35999999999999999999998743

PyMOL of 2hi0

>2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6	Back alignment and structure

>3kbb_A Phosphorylated carbohydrates phosphatase TM_1254; hydrolase, arbohydrate metabolism, COBA magnesium, manganese, metal-binding, nickel; HET: MSE GOL; 1.74A {Thermotoga maritima MSB8}	Back alignment and structure

>4gib_A Beta-phosphoglucomutase; rossmann fold, HAD-like, structural genomics, center for structural genomics of infectious DISE csgid, isomerase; 2.27A {Clostridium difficile}	Back alignment and structure

>4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli}	Back alignment and structure

>3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} SCOP: c.108.1.0	Back alignment and structure

>2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6	Back alignment and structure

>2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A	Back alignment and structure

>3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile}	Back alignment and structure

>3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV}	Back alignment and structure

>4ex6_A ALNB; modified rossman fold, phosphatase, magnesium binding, hydro; 1.25A {Streptomyces SP} PDB: 4ex7_A	Back alignment and structure

>3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis}	Back alignment and structure

>2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6	Back alignment and structure

>2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A	Back alignment and structure

>3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311}	Back alignment and structure

>3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} SCOP: c.108.1.0	Back alignment and structure

>3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A	Back alignment and structure

>2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A	Back alignment and structure

>3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus}	Back alignment and structure

>3ddh_A Putative haloacid dehalogenase-like family hydrol; hydrolase, HAD superfamily, ST genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides thetaiotaomicron}	Back alignment and structure

>2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6	Back alignment and structure

>3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis}	Back alignment and structure

>2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii}	Back alignment and structure

>3l5k_A Protein GS1, haloacid dehalogenase-like hydrolase domain- containing protein 1A; HDHD1A, haloacid dehalogenase-like hydrolase domain containing 1A; 2.00A {Homo sapiens}	Back alignment and structure

>3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0	Back alignment and structure

>1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6	Back alignment and structure

>3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A	Back alignment and structure

>2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii}	Back alignment and structure

>4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A	Back alignment and structure

>3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343}	Back alignment and structure

>3vay_A HAD-superfamily hydrolase; rossmann fold, haloacid dehalogenase; 1.98A {Pseudomonas syringae PV}	Back alignment and structure

>2g80_A Protein UTR4; YEL038W, UTR4 protein (unknown transcript 4 protein), struct genomics, PSI, protein structure initiative; 2.28A {Saccharomyces cerevisiae} SCOP: c.108.1.22	Back alignment and structure

>1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A	Back alignment and structure

>2pke_A Haloacid delahogenase-like family hydrolase; NP_639141.1, ST genomics, joint center for structural genomics, JCSG; 1.81A {Xanthomonas campestris PV}	Back alignment and structure

>2i6x_A Hydrolase, haloacid dehalogenase-like family; HAD superfamily, struct genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Porphyromonas gingivalis}	Back alignment and structure

>2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6	Back alignment and structure

>3nuq_A Protein SSM1, putative nucleotide phosphatase; suppresses the 6-AU sensitivity of transcription elongation II; 1.70A {Saccharomyces cerevisiae} PDB: 3onn_A 3opx_A*	Back alignment and structure

>1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A	Back alignment and structure

>2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii}	Back alignment and structure

>3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens}	Back alignment and structure

>3umg_A Haloacid dehalogenase; defluorinase, hydrolase; 2.25A {Rhodococcus jostii}	Back alignment and structure

>3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} SCOP: c.108.1.1 PDB: 1x42_A	Back alignment and structure

>2fdr_A Conserved hypothetical protein; SAD, structural genomics, agrobacter tumefaciens, HAD-superfamily hydrolase; 2.00A {Agrobacterium tumefaciens str} SCOP: c.108.1.6	Back alignment and structure

>3umc_A Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeruginosa}	Back alignment and structure

>2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3	Back alignment and structure

>1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP} SCOP: c.108.1.1 PDB: 1zrm_A 1jud_A 1qh9_A	Back alignment and structure

>3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A*	Back alignment and structure

>3umb_A Dehalogenase-like hydrolase; 2.20A {Ralstonia solanacearum}	Back alignment and structure

>3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1}	Back alignment and structure

>2p11_A Hypothetical protein; putative haloacid dehalogenase-like hydrolase, structural GE joint center for structural genomics, JCSG; 2.20A {Burkholderia xenovorans}	Back alignment and structure

>2no4_A (S)-2-haloacid dehalogenase IVA; HAD superfamily, rossman fold, hydrol; 1.93A {Burkholderia cepacia} PDB: 2no5_A*	Back alignment and structure

>3um9_A Haloacid dehalogenase, type II; haloacid dehalogenase-like hydrolase protein superfamily, defluorinase, hydrolase; 2.19A {Polaromonas SP}	Back alignment and structure

>1qq5_A Protein (L-2-haloacid dehalogenase); hydrolase; 1.52A {Xanthobacter autotrophicus} SCOP: c.108.1.1 PDB: 1qq6_A* 1qq7_A* 1aq6_A	Back alignment and structure

>2qlt_A (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, saccharom cerevisiae, structural genomics, PSI-2, protein structure initiative; 1.60A {Saccharomyces cerevisiae}	Back alignment and structure

>3smv_A S-(-)-azetidine-2-carboxylate hydrolase; haloacid dehalogenase superfamily, L-azetidine-2- carboxylate; HET: GOL; 1.38A {Pseudomonas}	Back alignment and structure

>1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A	Back alignment and structure

>2b0c_A Putative phosphatase; alpha-D-glucose-1-phosphate, structural genomic protein structure initiative, midwest center for structural genomics, MCSG; HET: G1P; 2.00A {Escherichia coli} SCOP: c.108.1.2	Back alignment and structure

>4dcc_A Putative haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 1.65A {Bacteroides thetaiotaomicron} PDB: 4dfd_A 4f71_A 4f72_A	Back alignment and structure

>1rku_A Homoserine kinase; phosphoserine phosphatase, phosphoserine:homoserine phosphotransferase, THRH, phosphoserine phosphoryl donor; 1.47A {Pseudomonas aeruginosa} SCOP: c.108.1.11 PDB: 1rkv_A	Back alignment and structure

>2w43_A Hypothetical 2-haloalkanoic acid dehalogenase; hydrolase, metabolic process; HET: MES; 1.66A {Sulfolobus tokodaii} PDB: 2w11_A	Back alignment and structure

>3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} SCOP: c.108.1.0	Back alignment and structure

>2i7d_A 5'(3')-deoxyribonucleotidase, cytosolic type; hydrolase; HET: DUR; 1.20A {Homo sapiens} PDB: 2jar_A* 2jao_A*	Back alignment and structure

>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A*	Back alignment and structure

>3bwv_A Putative 5'(3')-deoxyribonucleotidase; NP_764060.1, deoxyribonucleotidase-like protein; HET: MSE; 1.55A {Staphylococcus epidermidis}	Back alignment and structure

>3fvv_A Uncharacterized protein; unknown function, structural genomics, PSI,MCSG, protein STR initiative, midwest center for structural genomics; 2.10A {Bordetella pertussis}	Back alignment and structure

>1q92_A 5(3)-deoxyribonucleotidase; alpha-beta rossman fold, hydrolase; HET: DRM; 1.40A {Homo sapiens} SCOP: c.108.1.8 PDB: 1mh9_A* 1q91_A* 1z4m_A* 1z4i_A* 1z4j_A* 1z4l_A* 1z4k_A* 1z4p_X* 1z4q_A* 2jau_A* 2jaw_A* 3u19_A* 3u13_A 4e88_A	Back alignment and structure

>3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I	Back alignment and structure

>3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes}	Back alignment and structure

>4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp}	Back alignment and structure

>2oda_A Hypothetical protein pspto_2114; haloacid dehalogenase, phosphonoacetaldehyde hydrolase, protein binding; HET: EPE; 1.90A {Pseudomonas syringae PV}	Back alignment and structure

>2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A	Back alignment and structure

>1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A*	Back alignment and structure

>2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20	Back alignment and structure

>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium}	Back alignment and structure

>3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A*	Back alignment and structure

>3l8h_A Putative haloacid dehalogenase-like hydrolase; HAD superfamily, GMHB, D-glycero-D-manno-heptose-1, 7-bispho phosphatase; HET: FX1; 1.68A {Bordetella bronchiseptica}	Back alignment and structure

>3kd3_A Phosphoserine phosphohydrolase-like protein; csgid, niaid, S genomics, national institute of allergy and infectious DISE (niaid); 1.70A {Francisella tularensis subsp}	Back alignment and structure

>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A*	Back alignment and structure

>2c4n_A Protein NAGD; nucleotide phosphatase, HAD superfamily, UMP phosphatase, carbohydrate metabolism, hydrolase; 1.8A {Escherichia coli} SCOP: c.108.1.14	Back alignment and structure

>2yj3_A Copper-transporting ATPase; hydrolase, P-type ATPase, COPB, heavy metal translocation; 2.20A {Sulfolobus solfataricus} PDB: 2iye_A 2yj6_A* 2yj5_A* 2yj4_A*	Back alignment and structure

>2gmw_A D,D-heptose 1,7-bisphosphate phosphatase; Zn-binding protein, hydrolase; 1.50A {Escherichia coli} SCOP: c.108.1.19 PDB: 3esq_A 3esr_A 3l1u_A 3l1v_A 3l8e_A 3l8f_A 3l8g_A*	Back alignment and structure

>2b82_A APHA, class B acid phosphatase; DDDD acid phosphatase, metallo-ENZ hydrolase; HET: ADN; 1.25A {Escherichia coli} SCOP: c.108.1.12 PDB: 2b8j_A* 2hf7_A 1rmt_A* 1n9k_A 1rmq_A 1n8n_A* 1rmy_A* 2g1a_A* 3cz4_A 2heg_A* 1z5g_A 1z5u_A* 1z88_A 2aut_A	Back alignment and structure

>3gyg_A NTD biosynthesis operon putative hydrolase NTDB; PF05116, PF08282, MCSG, PSI-2, haloacid dehalogenase-like HY structural genomics; 2.45A {Bacillus subtilis subsp}	Back alignment and structure

>2i33_A Acid phosphatase; HAD superfamily, hydrolase; 1.57A {Bacillus anthracis} PDB: 2i34_A	Back alignment and structure

>1yv9_A Hydrolase, haloacid dehalogenase family; hypothetical protein, struc genomics, PSI, protein structure initiative; 2.80A {Enterococcus faecalis} SCOP: c.108.1.14	Back alignment and structure

>3ij5_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; IDP022 hydrolase, lipopolysaccharide biosynthesis, magnesium, STRU genomics; 1.95A {Yersinia pestis}	Back alignment and structure

>3n28_A Phosphoserine phosphatase; HAD family hydrolase, structural genomics, PSI, protein STRU initiative, nysgrc; 2.30A {Vibrio cholerae}	Back alignment and structure

>3mn1_A Probable YRBI family phosphatase; structural genomics, PSI, protein structure initiative, NYSG phosphatase; 1.80A {Pseudomonas syringae PV} PDB: 3nrj_A	Back alignment and structure

>3e8m_A Acylneuraminate cytidylyltransferase; 2-keto-3-deoxynononic acid 9-phosphate phosphohydrolase, nucleotidyltransferase; HET: PEG PG4 EDO PGE; 1.10A {Bacteroides thetaiotaomicron} PDB: 3e84_A 3e81_A*	Back alignment and structure

>2ho4_A Haloacid dehalogenase-like hydrolase domain containing 2; HDHD2, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; 2.20A {Mus musculus} PDB: 3hlt_A	Back alignment and structure

>4ap9_A Phosphoserine phosphatase; hydrolase, haloacid dehalogenase superfamily, NDSB; HET: 1PS; 1.78A {Thermococcus onnurineus} PDB: 4b6j_A	Back alignment and structure

>2p9j_A Hypothetical protein AQ2171; secsg, riken, PSI, structural GENO protein structure initiative, southeast collaboratory for S genomics; 2.40A {Aquifex aeolicus}	Back alignment and structure

>3mmz_A Putative HAD family hydrolase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.84A {Streptomyces avermitilis}	Back alignment and structure

>2o2x_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; 1.50A {Mesorhizobium loti} SCOP: c.108.1.19	Back alignment and structure

>3n07_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; structural genomics, phosphatase, PSI-2, protein structure initiative; HET: MSE; 1.76A {Vibrio cholerae}	Back alignment and structure

>1qyi_A ZR25, hypothetical protein; structural genomics, PSI, protein structure initiative, NORT structural genomics consortium, NESG; 2.50A {Staphylococcus aureus subsp} SCOP: c.108.1.13	Back alignment and structure

>1k1e_A Deoxy-D-mannose-octulosonate 8-phosphate phosphat; structural genomics, KDO 8-P phosphatase, structure function project, S2F; HET: MES; 1.67A {Haemophilus influenzae RD} SCOP: c.108.1.5 PDB: 1j8d_A*	Back alignment and structure

>2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032}	Back alignment and structure

>3n1u_A Hydrolase, HAD superfamily, subfamily III A; structural genomics, PSI-2; 1.80A {Legionella pneumophila} SCOP: c.108.1.0	Back alignment and structure

>1vjr_A 4-nitrophenylphosphatase; TM1742, structural genomics, JCSG, protein structure initiative, joint center for structural G hydrolase; 2.40A {Thermotoga maritima} SCOP: c.108.1.14 PDB: 1pw5_A*	Back alignment and structure

>3ocu_A Lipoprotein E; hydrolase, outer membrane; HET: NMN; 1.35A {Haemophilus influenzae} PDB: 3ocv_A* 3ocw_A* 3ocx_A* 3ocz_A* 3ocy_A* 3sf0_A* 2hlk_A 2hll_A 3et4_A 3et5_A	Back alignment and structure

>2fpr_A Histidine biosynthesis bifunctional protein HISB; histidinola phosphate phosphatase, bifunctional enzyme structural genomics; 1.70A {Escherichia coli} SCOP: c.108.1.19 PDB: 2fps_A 2fpu_A* 2fpx_A 2fpw_A*	Back alignment and structure

>2x4d_A HLHPP, phospholysine phosphohistidine inorganic pyrophos phosphatase; hydrolase; 1.92A {Homo sapiens}	Back alignment and structure

>1wr8_A Phosphoglycolate phosphatase; alpha / beta core domain, HAD superfamily, structural genomi structural genomics/proteomics initiative, RSGI; 1.60A {Pyrococcus horikoshii} SCOP: c.108.1.10	Back alignment and structure

>3dao_A Putative phosphatse; structural genomics, joint center for S genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE 1PE CIT; 1.80A {Eubacterium rectale}	Back alignment and structure

>3pct_A Class C acid phosphatase; hydrolase, outer membrane; 1.85A {Pasteurella multocida}	Back alignment and structure

>4dw8_A Haloacid dehalogenase-like hydrolase; HAD, putative phosphatase, enzyme function initiative, EFI, structural genomics; 1.50A {Bacteroides thetaiotaomicron} PDB: 3niw_A 4dwo_A	Back alignment and structure

>3dnp_A Stress response protein YHAX; structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG, unknown function; HET: MSE; 1.85A {Bacillus subtilis} SCOP: c.108.1.0	Back alignment and structure

>3fzq_A Putative hydrolase; YP_001086940.1, putative haloacid dehalogenase-like hydrolas structural genomics, joint center for structural genomics; HET: MSE; 2.10A {Clostridium difficile} SCOP: c.108.1.0	Back alignment and structure

>3l7y_A Putative uncharacterized protein SMU.1108C; hydrolase; 2.00A {Streptococcus mutans}	Back alignment and structure

>2oyc_A PLP phosphatase, pyridoxal phosphate phosphatase; structural genomics, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI-2; 1.72A {Homo sapiens} PDB: 2p27_A 2p69_A* 2cft_A* 2cfs_A 2cfr_A*	Back alignment and structure

>1rlm_A Phosphatase; HAD family, rossman fold, hydrolase; 1.90A {Escherichia coli} SCOP: c.108.1.10 PDB: 1rlt_A 1rlo_A* 2hf2_A	Back alignment and structure

>3mpo_A Predicted hydrolase of the HAD superfamily; SGX, PSI, structural genomics, protein structure initiative; 2.90A {Lactobacillus brevis} SCOP: c.108.1.0	Back alignment and structure

>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A	Back alignment and structure

>3pgv_A Haloacid dehalogenase-like hydrolase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: EPE; 2.39A {Klebsiella pneumoniae subsp}	Back alignment and structure

>1zjj_A Hypothetical protein PH1952; alpha/beta hydrolase fold, HAD superfamily, structural genom riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii}	Back alignment and structure

>3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} SCOP: c.108.1.0	Back alignment and structure

>3epr_A Hydrolase, haloacid dehalogenase-like family; structural genomics, unknown function, HAD superfamily hydro PSI-2; 1.55A {Streptococcus agalactiae serogroup V} SCOP: c.108.1.14 PDB: 1ys9_A 1wvi_A 1ydf_A	Back alignment and structure

>4gxt_A A conserved functionally unknown protein; structural genomics, PSI-biology; 1.82A {Anaerococcus prevotii}	Back alignment and structure

>4as2_A Phosphorylcholine phosphatase; hydrolase, HAD superfamily, alkylammonium compounds; HET: BTB; 2.12A {Pseudomonas aeruginosa} PDB: 4as3_A*	Back alignment and structure

>2ght_A Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; protein-peptide complex, HAD superfamily, hydrolase; HET: SEP; 1.80A {Homo sapiens} PDB: 2ghq_A* 3pgl_A* 1t9z_A* 1ta0_A* 3l0c_A 3l0y_A 3l0b_A* 2q5e_A	Back alignment and structure

>2hhl_A CTD small phosphatase-like protein; CTD phosphatase, keggins anion, structural genomics, PSI, protein structure initiative; HET: KEG; 2.10A {Homo sapiens}	Back alignment and structure

>2r8e_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; YRBI, divalent metal, HAD superfamily, KDO 8-P, hydrolase; 1.40A {Escherichia coli O6} PDB: 2r8x_A 2r8y_A 2r8z_A 3hyc_A 3i6b_A*	Back alignment and structure

>1y8a_A Hypothetical protein AF1437; structural genomics, protein structu initiative, PSI, midwest center for structural genomics; 1.40A {Archaeoglobus fulgidus} SCOP: c.108.1.24	Back alignment and structure

>3zx4_A MPGP, mannosyl-3-phosphoglycerate phosphatase; hydrolase, haloalkanoid acid dehalogenase-like phosphatase, crystallographic snapshot; HET: 2M8; 1.74A {Thermus thermophilus} PDB: 3zty_A 3zu6_A* 3ztw_A* 3zw7_A* 3zwd_A* 3zwk_A 3zup_A* 3zx5_A*	Back alignment and structure

>3ef0_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, ALF4, transition state analog, cobalt, magnesium; 2.10A {Schizosaccharomyces pombe}	Back alignment and structure

>3qgm_A P-nitrophenyl phosphatase (PHO2); structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 2.00A {Archaeoglobus fulgidus} SCOP: c.108.1.0	Back alignment and structure

>3r4c_A Hydrolase, haloacid dehalogenase-like hydrolase; haloalkanoate dehalogenase enzyme superfamily, phosphohydrol hydrolase; 1.82A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0	Back alignment and structure

>2hx1_A Predicted sugar phosphatases of the HAD superfamily; ZP_00311070.1, possible sugar phosphatase, structural genomics; HET: MSE EPE; 2.10A {Cytophaga hutchinsonii}	Back alignment and structure

>2obb_A Hypothetical protein; structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic unknown function; 2.20A {Bacteroides thetaiotaomicron} SCOP: c.108.1.25	Back alignment and structure

>2hx1_A Predicted sugar phosphatases of the HAD superfamily; ZP_00311070.1, possible sugar phosphatase, structural genomics; HET: MSE EPE; 2.10A {Cytophaga hutchinsonii}	Back alignment and structure

>2pq0_A Hypothetical conserved protein GK1056; hyopthetical protein, structural genomics, unknown function; 2.60A {Geobacillus kaustophilus} PDB: 2qyh_A	Back alignment and structure

>3ewi_A N-acylneuraminate cytidylyltransferase; beta barrel, HAD-like, rossmannoid fold, nucleotidyltransferase, nucleus; 1.90A {Mus musculus}	Back alignment and structure

>1nrw_A Hypothetical protein, haloacid dehalogenase-like hydrolase; structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: c.108.1.10	Back alignment and structure

>4fe3_A Cytosolic 5'-nucleotidase 3; substrate complex, HAD-like, protein binding; HET: U5P; 1.74A {Mus musculus} PDB: 2g09_A* 2bdu_A* 2g08_A 2g06_A* 2g0a_A* 2q4t_A* 2g07_A* 2jga_A 2vkq_A 2cn1_A	Back alignment and structure

>1nf2_A Phosphatase; structural proteomics, HAD NEW fold, structural genomics, BSGC structure funded by NIH structure initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.108.1.10	Back alignment and structure

>3kc2_A Uncharacterized protein YKR070W; HAD-like, mitochondral protein, PSI, MCSG, structural genomi protein structure initiative; HET: MSE; 1.55A {Saccharomyces cerevisiae} PDB: 3rf6_A*	Back alignment and structure

>1rkq_A Hypothetical protein YIDA; two domain structure with beta-alpha sandwich. stucture contains A magnesium ION., PSI, protein structure initiative; 1.40A {Escherichia coli} SCOP: c.108.1.10	Back alignment and structure

>2rbk_A Putative uncharacterized protein; HAD-like phosphatase, unknown function; 1.00A {Bacteroides thetaiotaomicron} SCOP: c.108.1.10 PDB: 1ymq_A 2rb5_A 2rav_A 2rar_A	Back alignment and structure

>1xvi_A MPGP, YEDP, putative mannosyl-3-phosphoglycerate phosphatase; hypothetical protein, conserved protein, phophatase-like domain; HET: 1PE PG4 PGE; 2.26A {Escherichia coli K12} SCOP: c.108.1.10	Back alignment and structure

>3j08_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus}	Back alignment and structure

>3f9r_A Phosphomannomutase; trypanosome glycobiology structural genomics, isomerase, structural genomics consortium, SGC; 1.85A {Trypanosoma brucei} SCOP: c.108.1.0 PDB: 2i54_A* 2i55_A*	Back alignment and structure

>1xpj_A Hypothetical protein; structural genomics, MCSG, protein STR initiative, PSI, midwest center for structural genomics, UN function; HET: TLA; 2.30A {Vibrio cholerae} SCOP: c.108.1.18	Back alignment and structure

>2b30_A Pvivax hypothetical protein; SGPP, structural genomics, PSI, protein structure initiative; 2.70A {Plasmodium vivax} SCOP: c.108.1.10	Back alignment and structure

>2amy_A PMM 2, phosphomannomutase 2; HS.459855, HS.313504, BC008310, phosphatase, PFAM PF03332, H superfamily, jaecken disease; 2.09A {Homo sapiens} SCOP: c.108.1.10 PDB: 2q4r_A	Back alignment and structure

>1l6r_A Hypothetical protein TA0175; structural genomics, putative hydrolas midwest center for structural genomics, MCSG, PSI; 1.40A {Thermoplasma acidophilum} SCOP: c.108.1.10 PDB: 1kyt_A	Back alignment and structure

>2fue_A PMM 1, PMMH-22, phosphomannomutase 1; enzyme-product complex, protein glycosyl carbohydrate-deficient glycoprotein syndrome; HET: MSE M1P; 1.75A {Homo sapiens} SCOP: c.108.1.10 PDB: 2fuc_A*	Back alignment and structure

>2zos_A MPGP, mannosyl-3-phosphoglycerate phosphatase; haloacid dehalogenase like hydrolase, mannosylglycerate, cytoplasm, hydrolase, magnesium; 1.70A {Pyrococcus horikoshii} PDB: 1wzc_A	Back alignment and structure

>2jc9_A Cytosolic purine 5'-nucleotidase; cytosolic 5-prime nucleotidase II, GMP-IMP specific nucleotidase, CN-II, NT5C2, hydrolase, polymorphism; HET: ADN; 1.5A {Homo sapiens} PDB: 2j2c_A* 2xje_A* 2xjf_A* 2jcm_A* 2xcw_A* 2xcv_A* 2xcx_A 2xjb_A* 2xjc_A* 2xjd_A*	Back alignment and structure

>1s2o_A SPP, sucrose-phosphatase; phosphohydrolase, HAD superfamily, cyanobacteria; 1.40A {Synechocystis SP} SCOP: c.108.1.10 PDB: 1tj3_A 1tj4_A* 1tj5_A* 1u2s_A* 1u2t_A* 2b1q_A* 2b1r_A* 2d2v_A*	Back alignment and structure

>2r8e_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; YRBI, divalent metal, HAD superfamily, KDO 8-P, hydrolase; 1.40A {Escherichia coli O6} PDB: 2r8x_A 2r8y_A 2r8z_A 3hyc_A 3i6b_A*	Back alignment and structure

>1u02_A Trehalose-6-phosphate phosphatase related protein; structural genomics, PSI; 1.92A {Thermoplasma acidophilum} SCOP: c.108.1.15	Back alignment and structure

>2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032}	Back alignment and structure

>3ewi_A N-acylneuraminate cytidylyltransferase; beta barrel, HAD-like, rossmannoid fold, nucleotidyltransferase, nucleus; 1.90A {Mus musculus}	Back alignment and structure

>3qle_A TIM50P; chaperone, mitochondrion, preprotein translocation; HET: 1PE; 1.83A {Saccharomyces cerevisiae EC1118}	Back alignment and structure

>2hhl_A CTD small phosphatase-like protein; CTD phosphatase, keggins anion, structural genomics, PSI, protein structure initiative; HET: KEG; 2.10A {Homo sapiens}	Back alignment and structure

>4g63_A Cytosolic IMP-GMP specific 5'-nucleotidase; structural genomics, PSI-biology, northeast structural genom consortium, NESG; 2.70A {Legionella pneumophila subsp} PDB: 2bde_A	Back alignment and structure

>2fpr_A Histidine biosynthesis bifunctional protein HISB; histidinola phosphate phosphatase, bifunctional enzyme structural genomics; 1.70A {Escherichia coli} SCOP: c.108.1.19 PDB: 2fps_A 2fpu_A* 2fpx_A 2fpw_A*	Back alignment and structure

>2ght_A Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; protein-peptide complex, HAD superfamily, hydrolase; HET: SEP; 1.80A {Homo sapiens} PDB: 2ghq_A* 3pgl_A* 1t9z_A* 1ta0_A* 3l0c_A 3l0y_A 3l0b_A* 2q5e_A	Back alignment and structure

>3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus}	Back alignment and structure

>3qle_A TIM50P; chaperone, mitochondrion, preprotein translocation; HET: 1PE; 1.83A {Saccharomyces cerevisiae EC1118}	Back alignment and structure

>3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		220
d2hdoa1		207	Phosphoglycolate phosphatase {Lactobacillus planta	99.9
d2go7a1		204	Hypothetical protein SP2064 {Streptococcus pneumon	99.88
d1te2a_		218	Phosphatase YniC {Escherichia coli [TaxId: 562]}	99.88
d2ah5a1		210	predicted phosphatase SP0104 {Streptococcus pneumo	99.88
d2hsza1		224	Phosphoglycolate phosphatase Gph {Haemophilus somn	99.87
d1o08a_		221	beta-Phosphoglucomutase {Lactococcus lactis [TaxId	99.84
d2fi1a1		187	Putative hydrolase SP0805 {Streptococcus pneumonia	99.83
d1swva_		257	Phosphonoacetaldehyde hydrolase {Bacillus cereus [	99.82
d2hcfa1		228	Hypothetical protein CT1708 {Chlorobium tepidum [T	99.79
d1x42a1		230	Hypothetical protein PH0459 {Archaeon Pyrococcus h	99.77
d2fdra1		222	Hypothetical protein Atu0790 {Agrobacterium tumefa	99.76
d2gfha1		247	N-acylneuraminate-9-phosphatase NANP {Mouse (Mus m	99.73
d1qq5a_		245	L-2-Haloacid dehalogenase, HAD {Xanthobacter autot	99.67
d1zrna_		220	L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., s	99.61
d1zs9a1		253	E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]}	99.61
d1u7pa_		164	Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mu	99.59
d1cr6a1		222	Epoxide hydrolase, N-terminal domain {Mouse (Mus m	99.56
d1zd3a1		225	Epoxide hydrolase, N-terminal domain {Human (Homo	99.53
d2feaa1		226	2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate	99.45
d2g80a1		225	Protein UTR4 {Baker's yeast (Saccharomyces cerevis	99.37
d2b0ca1		197	Putative phosphatase YihX {Escherichia coli [TaxId	99.33
d2fpwa1		161	Histidine biosynthesis bifunctional protein HisB,	99.14
d1nnla_		217	Phosphoserine phosphatase {Human (Homo sapiens) [T	99.08
d2gmwa1		182	D,D-heptose 1,7-bisphosphate phosphatase GmhB {Esc	99.0
d1j97a_		210	Phosphoserine phosphatase {Archaeon Methanococcus	98.97
d1ltqa1		149	Polynucleotide kinase, phosphatase domain {Bacteri	98.74
d2o2xa1		209	Hypothetical protein Mll2559 {Mesorhizobium loti [	98.39
d1rkua_		206	Homoserine kinase ThrH {Pseudomonas aeruginosa [Ta	98.24
d1wvia_		253	Putative phosphatase SMU.1415c {Streptococcus muta	98.18
d2c4na1		250	NagD {Escherichia coli [TaxId: 562]}	98.17
d1qyia_		380	Hypothetical protein MW1667 (SA1546) {Staphylococc	98.0
d1rkqa_		271	Hypothetical protein YidA {Escherichia coli [TaxId	97.7
d1l6ra_		225	Phosphoglycolate phosphatase, PGPase {Archaeon The	97.58
d1q92a_		195	5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo	97.4
d2amya1		243	Phosphomannomutase 2 {Human (Homo sapiens) [TaxId:	97.24
d1nf2a_		267	Hypothetical protein TM0651 {Thermotoga maritima [	97.18
d1xpja_		124	Hypothetical protein VC0232 {Vibrio cholerae [TaxI	97.17
d1wr8a_		230	Phosphoglycolate phosphatase, PGPase {Pyrococcus h	97.07
d2bdua1		291	Cytosolic 5'-nucleotidase III {Mouse (Mus musculus	96.98
d1wzca1		243	Putative mannosyl-3-phosphoglycerate phosphatase M	96.57
d2fuea1		244	Phosphomannomutase 1 {Human (Homo sapiens) [TaxId:	96.55
d1vjra_		261	Hypothetical protein TM1742 {Thermotoga maritima [	96.47
d1nrwa_		285	Hypothetical protein YwpJ {Bacillus subtilis [TaxI	96.41
d1yv9a1		253	Putative hydrolase EF1188 {Enterococcus faecalis [	96.31
d2b30a1		283	PFL1270w orthologue {Plasmodium vivax [TaxId: 5855	96.27
d1u02a_		229	Trehalose-6-phosphate phosphatase related protein	96.15
d1yj5a1		195	5' polynucleotide kinase-3' phosphatase, middle do	95.99
d1xvia_		232	Putative mannosyl-3-phosphoglycerate phosphatase M	95.92
d1rlma_		269	Sugar phosphatase SupH (YbiV) {Escherichia coli [T	95.91
d1s2oa1		244	Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc	95.55
d2b82a1		209	Class B acid phosphatase, AphA {Escherichia coli [	95.5
d2rbka1		260	Sugar-phosphate phosphatase BT4131 {Bacteroides th	95.24
d2obba1		122	Hypothetical protein BT0820 {Bacteroides thetaiota	92.37
d1k1ea_		177	Probable phosphatase YrbI {Haemophilus influenzae,	91.84
d2o2xa1		209	Hypothetical protein Mll2559 {Mesorhizobium loti [	89.2
d2bdea1		458	Cytosolic IMP-GMP specific 5'-nucleotidase {Legion	88.23
d1ta0a_		181	Carboxy-terminal domain RNA polymerase II polypept	86.24
d1yj5a1		195	5' polynucleotide kinase-3' phosphatase, middle do	85.46
d1qyia_		380	Hypothetical protein MW1667 (SA1546) {Staphylococc	84.64
d2b8ea1		135	Cation-transporting ATPase {Archaeon Archaeoglobus	83.81
d1xvia_		232	Putative mannosyl-3-phosphoglycerate phosphatase M	80.94
d1y8aa1		308	Hypothetical protein AF1437 {Archaeon Archaeoglobu	80.82
d2c4na1		250	NagD {Escherichia coli [TaxId: 562]}	80.46

>d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: HAD-like
superfamily: HAD-like
family: beta-Phosphoglucomutase-like
domain: Phosphoglycolate phosphatase
species: Lactobacillus plantarum [TaxId: 1590]

Probab=99.90  E-value=7.5e-24  Score=170.51  Aligned_cols=153  Identities=14%  Similarity=0.092  Sum_probs=113.9

Q ss_pred             CC-ceEEEecCcccccChHHHHHHHHHHHHHhCCCCCCCCCchhhhHHhhhhcccccccccchhHHHHHHHHHhcccccc
Q 027701            1 ME-DLYALDFDGVICDSCEETALSAVKAARVRWPSLFDGVDSALEDWIVDQMHTLRPVVETGYDTLLLVRLLLEMRLPSL   79 (220)
Q Consensus         1 ~~-~~viFDlDGTLvDS~~~i~~s~~~a~~~~~~~~~~g~~~~~~~~~~~~~~~ir~~Ig~G~~~~~~~~~l~~~~~~~~   79 (220)
                      |+ |+|+|||||||+||.+.+..+++.+++++|      .+...        ++.+..++...+..+     .+      
T Consensus         1 M~~k~viFD~DGTL~ds~~~~~~a~~~~~~~~g------~~~~~--------~~~~~~~~~~~~~~~-----~~------   55 (207)
T d2hdoa1           1 MTYQALMFDIDGTLTNSQPAYTTVMREVLATYG------KPFSP--------AQAQKTFPMAAEQAM-----TE------   55 (207)
T ss_dssp             CCCSEEEECSBTTTEECHHHHHHHHHHHHHTTT------CCCCH--------HHHHHHTTSCHHHHH-----HH------
T ss_pred             CCCcEEEEeCCCCcCcCHHHHHHHHHHHHHHcC------CCCCH--------HHHHHHhcchhhhhh-----hc------
Confidence            77 999999999999999999999999999994      44221        223333333322211     11      


Q ss_pred             cccccccCcchHHHhhhhhhhhHHHHHhhcCCHHHHHHHHHHHHHHHhhccccccccCCCCCccHHHHHH--hCCCcEEE
Q 027701           80 RKSSVAEGLTVEGILENWLKIKPVIMEEWSENREALIELSGKVRDEWMDTDFTTWIGANRLYPGVSDALK--LASSRIYI  157 (220)
Q Consensus        80 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~e~~~~~~~~~r~~y~~~y~~~~~~~~~lypGv~elL~--~~g~~l~I  157 (220)
                                                  .+.+....++....|++.+.+.     ...+++|||+.++|+  +++++++|
T Consensus        56 ----------------------------~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~g~~~~L~~l~~~~~~~i  102 (207)
T d2hdoa1          56 ----------------------------LGIAASEFDHFQAQYEDVMASH-----YDQIELYPGITSLFEQLPSELRLGI  102 (207)
T ss_dssp             ----------------------------TTCCGGGHHHHHHHHHHHHTTC-----GGGCEECTTHHHHHHHSCTTSEEEE
T ss_pred             ----------------------------cccchhhHHHHHHHhhhhhccc-----ccccccccchhhhhhhhcccccccc
Confidence                                        1111222223334445544332     345789999999999  77899999


Q ss_pred             EcCCchHHHHHHHHHhhCCCCCCceEecCC----CCCcHHHHHHHHhhCCCCCCceEec
Q 027701          158 VTSNQSRFVETLLRELAGVTITPDRLYGLG----TGPKVNVLKQLQKKPEHQGLRLQRS  212 (220)
Q Consensus       158 ~TnK~~~~a~~iL~~~~gl~~~f~~v~G~~----~~pkp~~l~~~l~~~~~~~~~~~~~  212 (220)
                      +||++...++.+|++ +|+..+|+.+++++    .||+|+++.+++++++.++++++|=
T Consensus       103 vT~~~~~~~~~~l~~-~~l~~~f~~i~~~~~~~~~KP~p~~~~~~~~~~~~~~~~~l~V  160 (207)
T d2hdoa1         103 VTSQRRNELESGMRS-YPFMMRMAVTISADDTPKRKPDPLPLLTALEKVNVAPQNALFI  160 (207)
T ss_dssp             ECSSCHHHHHHHHTT-SGGGGGEEEEECGGGSSCCTTSSHHHHHHHHHTTCCGGGEEEE
T ss_pred             ccccccccccccccc-ccccccccccccccccccchhhhhhhcccccceeeeccceeEe
Confidence            999999999999995 99999999999875    3599999999999999999999983

PyMOL of d2hdoa1

>d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]}	Back information, alignment and structure

>d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]}	Back information, alignment and structure

>d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]}	Back information, alignment and structure

>d1o08a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]}	Back information, alignment and structure

>d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]}	Back information, alignment and structure

>d1swva_ c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]}	Back information, alignment and structure

>d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]}	Back information, alignment and structure

>d1x42a1 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d2fdra1 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1qq5a_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus [TaxId: 280]}	Back information, alignment and structure

>d1zrna_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., strain YL [TaxId: 306]}	Back information, alignment and structure

>d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1cr6a1 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1zd3a1 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d2g80a1 c.108.1.22 (A:17-241) Protein UTR4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2b0ca1 c.108.1.2 (A:8-204) Putative phosphatase YihX {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2fpwa1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2gmwa1 c.108.1.19 (A:24-205) D,D-heptose 1,7-bisphosphate phosphatase GmhB {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d1ltqa1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4 [TaxId: 10665]}	Back information, alignment and structure

>d2o2xa1 c.108.1.19 (A:8-216) Hypothetical protein Mll2559 {Mesorhizobium loti [TaxId: 381]}	Back information, alignment and structure

>d1rkua_ c.108.1.11 (A:) Homoserine kinase ThrH {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1wvia_ c.108.1.14 (A:) Putative phosphatase SMU.1415c {Streptococcus mutans [TaxId: 1309]}	Back information, alignment and structure

>d2c4na1 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure

>d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d1q92a_ c.108.1.8 (A:) 5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nf2a_ c.108.1.10 (A:) Hypothetical protein TM0651 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1xpja_ c.108.1.18 (A:) Hypothetical protein VC0232 {Vibrio cholerae [TaxId: 666]}	Back information, alignment and structure

>d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d2bdua1 c.108.1.21 (A:7-297) Cytosolic 5'-nucleotidase III {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1wzca1 c.108.1.10 (A:1-243) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d2fuea1 c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1vjra_ c.108.1.14 (A:) Hypothetical protein TM1742 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1nrwa_ c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1yv9a1 c.108.1.14 (A:4-256) Putative hydrolase EF1188 {Enterococcus faecalis [TaxId: 1351]}	Back information, alignment and structure

>d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]}	Back information, alignment and structure

>d1u02a_ c.108.1.15 (A:) Trehalose-6-phosphate phosphatase related protein {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d1yj5a1 c.108.1.9 (A:144-338) 5' polynucleotide kinase-3' phosphatase, middle domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1rlma_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1s2oa1 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 6803 [TaxId: 1148]}	Back information, alignment and structure

>d2b82a1 c.108.1.12 (A:4-212) Class B acid phosphatase, AphA {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2rbka1 c.108.1.10 (A:2-261) Sugar-phosphate phosphatase BT4131 {Bacteroides thetaiotaomicron [TaxId: 818]}	Back information, alignment and structure

>d2obba1 c.108.1.25 (A:1-122) Hypothetical protein BT0820 {Bacteroides thetaiotaomicron [TaxId: 818]}	Back information, alignment and structure

>d1k1ea_ c.108.1.5 (A:) Probable phosphatase YrbI {Haemophilus influenzae, HI1679 [TaxId: 727]}	Back information, alignment and structure

>d2o2xa1 c.108.1.19 (A:8-216) Hypothetical protein Mll2559 {Mesorhizobium loti [TaxId: 381]}	Back information, alignment and structure

>d2bdea1 c.108.1.23 (A:2-459) Cytosolic IMP-GMP specific 5'-nucleotidase {Legionella pneumophila [TaxId: 446]}	Back information, alignment and structure

>d1ta0a_ c.108.1.16 (A:) Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1yj5a1 c.108.1.9 (A:144-338) 5' polynucleotide kinase-3' phosphatase, middle domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure

>d2b8ea1 c.108.1.7 (A:416-434,A:548-663) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1y8aa1 c.108.1.24 (A:1-308) Hypothetical protein AF1437 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d2c4na1 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId: 562]}	Back information, alignment and structure