Citrus Sinensis ID: 027750


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------22
MDPRQDRFEIAFFDVETAFPNPPGQRIAILEFGAILVCPKTLEELQPYSTLLASLATYFGLGQQTHRSLDDVRMNLEVLKYCATVLFLESGLPDIFTVNRWEMCSAASVSEGSSGYARFMEPDELYCSRLKIRYGISTRFVDQAGRPRLSFVVDASQSLCTVLDACEVVAKKLFEDSRSNSEWNPVVTRQSGNDPAARLRNLGYRGMFISISLAFCGTH
ccHHHHHHHHHHHHcccccccccccHHHHHHHccccccccccccccccHHHHHHHHHHHcccccccccccccccHHHHHHHHHEEEEEcccccccEEccEEEEccccccccccccccccccccccEEccEEEEEcccEEcccccccccEEEEEcccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccEEEcccccccEEEEccccEEEcc
ccccccccEEEEEEEcccccccccccEEEEEEEEEEEcccccEEcccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHccccccEcccccccccEEEcccccccccccccccEcccccEEEEEEccEEccccccccEEEEEcccHHHHHHHHHHHHHHHHcccccccccccccEEEEccccccEEEEEcccccccEccccccccccc
MDPRQDRFEIAFfdvetafpnppgqriaILEFGAILvcpktleelQPYSTLLASLATYFglgqqthrsLDDVRMNLEVLKYCATVLFlesglpdiftvnrWEMCSAasvsegssgyarfmepdelYCSRLKIRygistrfvdqagrprlsFVVDASQSLCTVLDACEVVAKKLFEdsrsnsewnpvvtrqsgndpaarLRNLGYRGMFISISLAFCGTH
MDPRQDRFEIAFFDVETAFPNPPGQRIAILEFGAILVCPKTLEELQPYSTLLASLATYFGLGQQTHRSLDDVRMNLEVLKYCATVLFLESGLPDIFTVNRWEMCSAASVSEGSSGYARFMEPDELYCSRLKIRYGISTRFVDQAGRPRLSFVVDASQSLCTVLDACEVVAKKLfedsrsnsewnpvvtrqsgndpaARLRNLGYRGMFISISLAFCGTH
MDPRQDRFEIAFFDVETAFPNPPGQRIAILEFGAILVCPKTLEELQPYSTLLASLATYFGLGQQTHRSLDDVRMNLEVLKYCATVLFLESGLPDIFTVNRWEMCSAASVSEGSSGYARFMEPDELYCSRLKIRYGISTRFVDQAGRPRLSFVVDASQSLCTVLDACEVVAKKLFEDSRSNSEWNPVVTRQSGNDPAARLRNLGYRGMFISISLAFCGTH
*******FEIAFFDVETAFPNPPGQRIAILEFGAILVCPKTLEELQPYSTLLASLATYFGLGQQTHRSLDDVRMNLEVLKYCATVLFLESGLPDIFTVNRWEMCSAASVSEGSSGYARFMEPDELYCSRLKIRYGISTRFVDQAGRPRLSFVVDASQSLCTVLDACEVVAKKLFE*********************ARLRNLGYRGMFISISLAFCG**
******R***AFFDVETAFPNPPGQRIAILEFGAILVCPKTLEELQPYSTLLASLATYFGLGQQTHRSLDDVRMNLEVLKYCATVLFLESGLPDIFT**********************MEPDELYCSRLKIRYGISTRFVDQAGRPRLSFVVDASQSLCTVLDACE*******************VTRQSGNDPAARLRNLGYRGMFISISLAFCG**
MDPRQDRFEIAFFDVETAFPNPPGQRIAILEFGAILVCPKTLEELQPYSTLLASLATYFGLGQQTHRSLDDVRMNLEVLKYCATVLFLESGLPDIFTVNRWEMCSAASVSEGSSGYARFMEPDELYCSRLKIRYGISTRFVDQAGRPRLSFVVDASQSLCTVLDACEVVAKKLFEDSRSNSEWNPVVTRQSGNDPAARLRNLGYRGMFISISLAFCGTH
*****DRFEIAFFDVETAFPNPPGQRIAILEFGAILVCPKTLEELQPYSTLLASLATYFGLGQQTHRSLDDVRMNLEVLKYCATVLFLESGLPDIFTVNRWEMCSAASVSEGSSGYARFMEPDELYCSRLKIRYGISTRFVDQAGRPRLSFVVDASQSLCTVLDACEVVAKKLF****SNSEWNPVVTRQSGNDPAARLRNLGYRGMFISISLAFC***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDPRQDRFEIAFFDVETAFPNPPGQRIAILEFGAILVCPKTLEELQPYSTLLASLATYFGLGQQTHRSLDDVRMNLEVLKYCATVLFLESGLPDIFTVNRWEMCSAASVSEGSSGYARFMEPDELYCSRLKIRYGISTRFVDQAGRPRLSFVVDASQSLCTVLDACEVVAKKLFEDSRSNSEWNPVVTRQSGNDPAARLRNLGYRGMFISISLAFCGTH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query219
255547337 448 exonuclease, putative [Ricinus communis] 0.680 0.332 0.403 6e-32
297733948 447 unnamed protein product [Vitis vinifera] 0.484 0.237 0.517 6e-21
147817752 535 hypothetical protein VITISV_031720 [Viti 0.461 0.188 0.451 7e-21
225457353 497 PREDICTED: uncharacterized protein LOC10 0.447 0.197 0.453 3e-20
356562862 501 PREDICTED: uncharacterized protein LOC10 0.347 0.151 0.615 1e-18
356512002 501 PREDICTED: uncharacterized protein LOC10 0.273 0.119 0.741 2e-18
224124082 470 predicted protein [Populus trichocarpa] 0.347 0.161 0.589 4e-18
449477209 359 PREDICTED: uncharacterized LOC101223607 0.351 0.214 0.582 5e-18
449440810 471 PREDICTED: uncharacterized protein LOC10 0.351 0.163 0.582 7e-18
218184498 422 hypothetical protein OsI_33530 [Oryza sa 0.666 0.345 0.359 3e-17
>gi|255547337|ref|XP_002514726.1| exonuclease, putative [Ricinus communis] gi|223546330|gb|EEF47832.1| exonuclease, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  143 bits (360), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 88/218 (40%), Positives = 114/218 (52%), Gaps = 69/218 (31%)

Query: 52  LASLATYFGLGQQTHRSLDDVRMNLEVLKYCATVLFLESGLPDIFTVNRW---------- 101
           +ASLATYFGLG+QTHRSLDDVRMN++VLK CATVL L + LP  F V             
Sbjct: 152 MASLATYFGLGKQTHRSLDDVRMNVDVLKCCATVLLLVTILPYAFVVTNVGSTTFQPAPF 211

Query: 102 ---------------------------EMCSAASVSEGSSGYARFMEPDE---------- 124
                                      E+ S+ +V EG SG+  F+EPDE          
Sbjct: 212 SRGTLGNEMNIDSLQQDAAIEPKKESSEIPSSLTVPEGGSGHGGFLEPDEVSVSFIRASF 271

Query: 125 --------------------LYCSRLKIRY-GISTRFVDQAGRPRLSFVVDASQSLCTVL 163
                               L+CS L++RY G+ST+F D AGRPRLSFVVDA  +L ++L
Sbjct: 272 CPHSWGVQRMVLLYKDVPLQLHCSHLRVRYNGLSTKFADYAGRPRLSFVVDAPPNLYSIL 331

Query: 164 DACEVVAKKLFEDSRSNSEWNPVVTRQS-GNDPAARLR 200
           DAC+ +A+K+  +S S+S+W  VVT+    N P  RL 
Sbjct: 332 DACDKIAQKVSAESGSSSKWKHVVTKHDFDNSPTVRLH 369




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|297733948|emb|CBI15195.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147817752|emb|CAN66660.1| hypothetical protein VITISV_031720 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225457353|ref|XP_002281793.1| PREDICTED: uncharacterized protein LOC100265514 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356562862|ref|XP_003549687.1| PREDICTED: uncharacterized protein LOC100818863 [Glycine max] Back     alignment and taxonomy information
>gi|356512002|ref|XP_003524710.1| PREDICTED: uncharacterized protein LOC100788659 [Glycine max] Back     alignment and taxonomy information
>gi|224124082|ref|XP_002330100.1| predicted protein [Populus trichocarpa] gi|222871234|gb|EEF08365.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449477209|ref|XP_004154961.1| PREDICTED: uncharacterized LOC101223607 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449440810|ref|XP_004138177.1| PREDICTED: uncharacterized protein LOC101203629 [Cucumis sativus] Back     alignment and taxonomy information
>gi|218184498|gb|EEC66925.1| hypothetical protein OsI_33530 [Oryza sativa Indica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query219
TAIR|locus:2160359468 AT5G07710 [Arabidopsis thalian 0.356 0.166 0.537 6.3e-50
TAIR|locus:2019100 506 AT1G74390 [Arabidopsis thalian 0.228 0.098 0.8 4.7e-49
TAIR|locus:2163208487 AT5G61390 [Arabidopsis thalian 0.356 0.160 0.487 8.6e-49
TAIR|locus:2135302255 AT4G39810 [Arabidopsis thalian 0.415 0.356 0.494 1.8e-14
TAIR|locus:2160359 AT5G07710 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 210 (79.0 bits), Expect = 6.3e-50, Sum P(3) = 6.3e-50
 Identities = 43/80 (53%), Positives = 57/80 (71%)

Query:   122 PDELYCSRLKIRYGISTRFVDQAGRPRLSFVVDASQSLCTVLDACEVVAKKLFEDSRSNS 181
             P +LYCS LKIR+G++ +F+D  GR RL+FVVD + SL ++L+AC+  A+KL  DS S S
Sbjct:   312 PLQLYCSYLKIRFGVNGKFLDNTGRRRLNFVVDLNPSLYSILEACDSNAQKLSVDSGSTS 371

Query:   182 EWNPVVTRQSG--NDPAARL 199
             EWNPVV    G  N P AR+
Sbjct:   372 EWNPVVNPMKGFVNYPNARI 391


GO:0003676 "nucleic acid binding" evidence=IEA
GO:0004527 "exonuclease activity" evidence=IEA;ISS
GO:0005622 "intracellular" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM
TAIR|locus:2019100 AT1G74390 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2163208 AT5G61390 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2135302 AT4G39810 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00016302001
SubName- Full=Chromosome chr17 scaffold_12, whole genome shotgun sequence; (390 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 219
PRK07883 557 hypothetical protein; Validated 99.93
PRK07740244 hypothetical protein; Provisional 99.5
cd06133176 ERI-1_3'hExo_like DEDDh 3'-5' exonuclease domain o 99.47
PRK08517257 DNA polymerase III subunit epsilon; Provisional 99.46
PRK07246 820 bifunctional ATP-dependent DNA helicase/DNA polyme 99.42
PRK09145202 DNA polymerase III subunit epsilon; Validated 99.41
PRK07247195 DNA polymerase III subunit epsilon; Validated 99.4
smart00479169 EXOIII exonuclease domain in DNA-polymerase alpha 99.4
PF00929164 RNase_T: Exonuclease; InterPro: IPR013520 This ent 99.4
PRK07748207 sporulation inhibitor KapD; Provisional 99.4
PRK09146239 DNA polymerase III subunit epsilon; Validated 99.37
cd06131167 DNA_pol_III_epsilon_Ecoli_like DEDDh 3'-5' exonucl 99.36
PRK06807313 DNA polymerase III subunit epsilon; Validated 99.36
PRK07942232 DNA polymerase III subunit epsilon; Provisional 99.35
cd06136177 TREX1_2 DEDDh 3'-5' exonuclease domain of three pr 99.35
PRK06063313 DNA polymerase III subunit epsilon; Provisional 99.35
TIGR00573217 dnaq exonuclease, DNA polymerase III, epsilon subu 99.34
PRK06310250 DNA polymerase III subunit epsilon; Validated 99.33
cd06130156 DNA_pol_III_epsilon_like an uncharacterized bacter 99.31
PRK09182294 DNA polymerase III subunit epsilon; Validated 99.3
PRK06722281 exonuclease; Provisional 99.26
TIGR01298200 RNaseT ribonuclease T. in gamma-subdivision Proteo 99.26
COG2176 1444 PolC DNA polymerase III, alpha subunit (gram-posit 99.25
PRK05168211 ribonuclease T; Provisional 99.25
TIGR01406225 dnaQ_proteo DNA polymerase III, epsilon subunit, P 99.24
PRK06195309 DNA polymerase III subunit epsilon; Validated 99.23
cd06127159 DEDDh DEDDh 3'-5' exonuclease domain family. DEDDh 99.23
cd06134189 RNaseT DEDDh 3'-5' exonuclease domain of RNase T. 99.22
TIGR01405 1213 polC_Gram_pos DNA polymerase III, alpha chain, Gra 99.22
PRK08074 928 bifunctional ATP-dependent DNA helicase/DNA polyme 99.19
PRK05711240 DNA polymerase III subunit epsilon; Provisional 99.18
cd06135173 Orn DEDDh 3'-5' exonuclease domain of oligoribonuc 99.18
TIGR01407 850 dinG_rel DnaQ family exonuclease/DinG family helic 99.16
PRK06309232 DNA polymerase III subunit epsilon; Validated 99.15
cd06138183 ExoI_N N-terminal DEDDh 3'-5' exonuclease domain o 99.12
PRK07983219 exodeoxyribonuclease X; Provisional 99.1
PRK05359181 oligoribonuclease; Provisional 99.01
PRK11779 476 sbcB exonuclease I; Provisional 98.96
COG0847243 DnaQ DNA polymerase III, epsilon subunit and relat 98.94
PRK00448 1437 polC DNA polymerase III PolC; Validated 98.88
cd06149157 ISG20 DEDDh 3'-5' exonuclease domain of Interferon 98.87
PTZ00315 582 2'-phosphotransferase; Provisional 98.82
PRK05601 377 DNA polymerase III subunit epsilon; Validated 98.8
cd06137161 DEDDh_RNase DEDDh 3'-5' exonuclease domain of the 98.77
cd06144152 REX4_like DEDDh 3'-5' exonuclease domain of RNA ex 98.66
PRK14667 567 uvrC excinuclease ABC subunit C; Provisional 98.43
PRK12306 519 uvrC excinuclease ABC subunit C; Reviewed 98.37
PRK00558 598 uvrC excinuclease ABC subunit C; Validated 98.36
PRK10545 286 nucleotide excision repair endonuclease; Provision 98.33
PRK14666 694 uvrC excinuclease ABC subunit C; Provisional 98.33
PRK14669 624 uvrC excinuclease ABC subunit C; Provisional 98.28
PRK14671 621 uvrC excinuclease ABC subunit C; Provisional 98.28
TIGR00194 574 uvrC excinuclease ABC, C subunit. This family cons 98.27
cd06145150 REX1_like DEDDh 3'-5' exonuclease domain of RNA ex 98.21
PRK14668 577 uvrC excinuclease ABC subunit C; Provisional 98.18
COG0322 581 UvrC Nuclease subunit of the excinuclease complex 98.14
COG5018210 KapD Inhibitor of the KinA pathway to sporulation, 98.09
PRK14672 691 uvrC excinuclease ABC subunit C; Provisional 98.03
COG1949184 Orn Oligoribonuclease (3'-5' exoribonuclease) [RNA 97.04
KOG0542280 consensus Predicted exonuclease [Replication, reco 94.96
PRK14670 574 uvrC excinuclease ABC subunit C; Provisional 94.6
smart0046584 GIYc GIY-YIG type nucleases (URI domain). 94.42
cd05160199 DEDDy_DNA_polB_exo DEDDy 3'-5' exonuclease domain 94.05
PHA02598138 denA endonuclease II; Provisional 93.66
COG3359278 Predicted exonuclease [DNA replication, recombinat 92.12
PHA02570220 dexA exonuclease; Provisional 89.0
PF13482164 RNase_H_2: RNase_H superfamily; PDB: 1TKD_A 1TK5_A 85.72
cd0612596 DnaQ_like_exo DnaQ-like (or DEDD) 3'-5' exonucleas 85.05
PF0154180 GIY-YIG: GIY-YIG catalytic domain; InterPro: IPR00 80.52
>PRK07883 hypothetical protein; Validated Back     alignment and domain information
Probab=99.93  E-value=2.6e-26  Score=218.35  Aligned_cols=187  Identities=26%  Similarity=0.296  Sum_probs=146.7

Q ss_pred             CCceEEEEEeecCCCCCCCCceeEEEEeeEEEecCceeecccHHHH----------------------------------
Q 027750            6 DRFEIAFFDVETAFPNPPGQRIAILEFGAILVCPKTLEELQPYSTL----------------------------------   51 (219)
Q Consensus         6 ~~~e~vffDvETT~~~~~~~~~~ilEfgAI~V~p~~l~e~~sf~TL----------------------------------   51 (219)
                      .+..||+||+||||.++..  ++|+|||||+|..+.+  ++.|++|                                  
T Consensus        13 ~~~~~Vv~D~ETTGl~p~~--~~IIEIgaV~v~~g~i--v~~f~~lV~P~~~i~~~~~~itGIt~e~l~~ap~~~evl~~   88 (557)
T PRK07883         13 RDVTFVVVDLETTGGSPAG--DAITEIGAVKVRGGEV--LGEFATLVNPGRPIPPFITVLTGITTAMVAGAPPIEEVLPA   88 (557)
T ss_pred             cCCCEEEEEEecCCCCCCC--CeEEEEEEEEEECCEE--EEEEEEEECCCCCCChhHHhhcCCCHHHHhCCCCHHHHHHH
Confidence            4578999999999998865  8999999999998877  4456555                                  


Q ss_pred             ----------------------------------------------------------HHHHHHhhCCC-CCccccchhh
Q 027750           52 ----------------------------------------------------------LASLATYFGLG-QQTHRSLDDV   72 (219)
Q Consensus        52 ----------------------------------------------------------LatLA~~Fg~~-~~~HRALdDa   72 (219)
                                                                                |++|+.+||++ .+.||||+||
T Consensus        89 f~~fl~~~~lVaHNa~FD~~fL~~~~~r~g~~~~~~~~iDTl~lar~l~~~~~~~~~~L~~L~~~~gi~~~~~H~Al~DA  168 (557)
T PRK07883         89 FLEFARGAVLVAHNAPFDIGFLRAAAARCGYPWPGPPVLCTVRLARRVLPRDEAPNVRLSTLARLFGATTTPTHRALDDA  168 (557)
T ss_pred             HHHHhcCCEEEEeCcHHHHHHHHHHHHHcCCCCCCCCcEecHHHHHHhcccCCCCCCCHHHHHHHCCcccCCCCCHHHHH
Confidence                                                                      89999999999 8999999999


Q ss_pred             hccHHHHHHhh------hhhhhhcCcCccccccccCCc------cccccCCCCCCeeeeccCCc--ce-ecCcceeeecc
Q 027750           73 RMNLEVLKYCA------TVLFLESGLPDIFTVNRWEMC------SAASVSEGSSGYARFMEPDE--LY-CSRLKIRYGIS  137 (219)
Q Consensus        73 r~tvdVl~~~~------gVl~lE~~~p~~~~~~~~v~p------~la~~lp~~pGvy~F~~p~d--Ly-gtsl~vR~rVr  137 (219)
                      ++|++||..++      |+.+++++    ..+.+.++|      +....+|..||||.|.+.++  || |++.|||.||+
T Consensus       169 ~ata~l~~~l~~~~~~~~~~~~~~l----~~~~~~~~~~~~~~~~~~~~lP~~PGVY~~~d~~g~viYVGKAknLr~Rv~  244 (557)
T PRK07883        169 RATVDVLHGLIERLGNLGVHTLEEL----LTYLPRVTPAQRRKRHLADGLPHAPGVYLFRGPSGEVLYVGTAVNLRRRVR  244 (557)
T ss_pred             HHHHHHHHHHHHHHHhcCCCCHHHH----HHhhhhcChhhhcchHHHhhCCCCceEEEEECCCCcEEEeehhhhHHHHHH
Confidence            99999999998      67777777    445555555      45689999999999999988  99 99999999999


Q ss_pred             ccccCCCCCccceeeeccccc---------hHHHHHHHHHHHHHhhccCCCCCCCccceeeccCCCceEEeeecCcceee
Q 027750          138 TRFVDQAGRPRLSFVVDASQS---------LCTVLDACEVVAKKLFEDSRSNSEWNPVVTRQSGNDPAARLRNLGYRGMF  208 (219)
Q Consensus       138 syFt~se~RpRm~emVdla~~---------v~~Vl~~Cd~~a~~~~~~~gs~S~W~p~v~~~~gn~ptvRl~i~~~~~~~  208 (219)
                      +||..+..++|...||.-..+         +++.|-.|.-|-|-..       .+|-.. |..-.+|.+||.--+|....
T Consensus       245 sYF~~~~~~~k~~~lv~~i~~ie~i~t~sE~eAllLE~~lIk~~~P-------~yN~~l-kd~k~ypyi~i~~~~~Prl~  316 (557)
T PRK07883        245 SYFTAAETRGRMREMVALAERVDHVECAHALEAEVRELRLIAAHKP-------PYNRRS-KFPERRWWVRLTDEAFPRLS  316 (557)
T ss_pred             HHcCCCCCCchHHHHHhhhceEEEEEeCCHHHHHHHHHHHHHHhCC-------cchhhc-cCCCCceEEEEecCCCceEE
Confidence            999988778898888776655         4556666655544322       244343 44446888887644554443



>PRK07740 hypothetical protein; Provisional Back     alignment and domain information
>cd06133 ERI-1_3'hExo_like DEDDh 3'-5' exonuclease domain of Caenorhabditis elegans ERI-1, human 3' exonuclease, and similar proteins Back     alignment and domain information
>PRK08517 DNA polymerase III subunit epsilon; Provisional Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK09145 DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK07247 DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>smart00479 EXOIII exonuclease domain in DNA-polymerase alpha and epsilon chain, ribonuclease T and other exonucleases Back     alignment and domain information
>PF00929 RNase_T: Exonuclease; InterPro: IPR013520 This entry includes a variety of exonuclease proteins, such as ribonuclease T [] and the epsilon subunit of DNA polymerase III Back     alignment and domain information
>PRK07748 sporulation inhibitor KapD; Provisional Back     alignment and domain information
>PRK09146 DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>cd06131 DNA_pol_III_epsilon_Ecoli_like DEDDh 3'-5' exonuclease domain of the epsilon subunit of Escherichia coli DNA polymerase III and similar proteins Back     alignment and domain information
>PRK06807 DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK07942 DNA polymerase III subunit epsilon; Provisional Back     alignment and domain information
>cd06136 TREX1_2 DEDDh 3'-5' exonuclease domain of three prime repair exonuclease (TREX)1, TREX2, and similar proteins Back     alignment and domain information
>PRK06063 DNA polymerase III subunit epsilon; Provisional Back     alignment and domain information
>TIGR00573 dnaq exonuclease, DNA polymerase III, epsilon subunit family Back     alignment and domain information
>PRK06310 DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>cd06130 DNA_pol_III_epsilon_like an uncharacterized bacterial subgroup of the DEDDh 3'-5' exonuclease domain family with similarity to the epsilon subunit of DNA polymerase III Back     alignment and domain information
>PRK09182 DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK06722 exonuclease; Provisional Back     alignment and domain information
>TIGR01298 RNaseT ribonuclease T Back     alignment and domain information
>COG2176 PolC DNA polymerase III, alpha subunit (gram-positive type) [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK05168 ribonuclease T; Provisional Back     alignment and domain information
>TIGR01406 dnaQ_proteo DNA polymerase III, epsilon subunit, Proteobacterial Back     alignment and domain information
>PRK06195 DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>cd06127 DEDDh DEDDh 3'-5' exonuclease domain family Back     alignment and domain information
>cd06134 RNaseT DEDDh 3'-5' exonuclease domain of RNase T Back     alignment and domain information
>TIGR01405 polC_Gram_pos DNA polymerase III, alpha chain, Gram-positive type Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK05711 DNA polymerase III subunit epsilon; Provisional Back     alignment and domain information
>cd06135 Orn DEDDh 3'-5' exonuclease domain of oligoribonuclease and similar proteins Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>PRK06309 DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>cd06138 ExoI_N N-terminal DEDDh 3'-5' exonuclease domain of Escherichia coli exonuclease I and similar proteins Back     alignment and domain information
>PRK07983 exodeoxyribonuclease X; Provisional Back     alignment and domain information
>PRK05359 oligoribonuclease; Provisional Back     alignment and domain information
>PRK11779 sbcB exonuclease I; Provisional Back     alignment and domain information
>COG0847 DnaQ DNA polymerase III, epsilon subunit and related 3'-5' exonucleases [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK00448 polC DNA polymerase III PolC; Validated Back     alignment and domain information
>cd06149 ISG20 DEDDh 3'-5' exonuclease domain of Interferon Stimulated Gene product of 20 kDa, and similar proteins Back     alignment and domain information
>PTZ00315 2'-phosphotransferase; Provisional Back     alignment and domain information
>PRK05601 DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>cd06137 DEDDh_RNase DEDDh 3'-5' exonuclease domain of the eukaryotic exoribonucleases PAN2, RNA exonuclease (REX)-1,-3, and -4, ISG20, and similar proteins Back     alignment and domain information
>cd06144 REX4_like DEDDh 3'-5' exonuclease domain of RNA exonuclease 4, XPMC2, Interferon Stimulated Gene product of 20 kDa, and similar proteins Back     alignment and domain information
>PRK14667 uvrC excinuclease ABC subunit C; Provisional Back     alignment and domain information
>PRK12306 uvrC excinuclease ABC subunit C; Reviewed Back     alignment and domain information
>PRK00558 uvrC excinuclease ABC subunit C; Validated Back     alignment and domain information
>PRK10545 nucleotide excision repair endonuclease; Provisional Back     alignment and domain information
>PRK14666 uvrC excinuclease ABC subunit C; Provisional Back     alignment and domain information
>PRK14669 uvrC excinuclease ABC subunit C; Provisional Back     alignment and domain information
>PRK14671 uvrC excinuclease ABC subunit C; Provisional Back     alignment and domain information
>TIGR00194 uvrC excinuclease ABC, C subunit Back     alignment and domain information
>cd06145 REX1_like DEDDh 3'-5' exonuclease domain of RNA exonuclease 1, -3 and similar eukaryotic proteins Back     alignment and domain information
>PRK14668 uvrC excinuclease ABC subunit C; Provisional Back     alignment and domain information
>COG0322 UvrC Nuclease subunit of the excinuclease complex [DNA replication, recombination, and repair] Back     alignment and domain information
>COG5018 KapD Inhibitor of the KinA pathway to sporulation, predicted exonuclease [General function prediction only] Back     alignment and domain information
>PRK14672 uvrC excinuclease ABC subunit C; Provisional Back     alignment and domain information
>COG1949 Orn Oligoribonuclease (3'-5' exoribonuclease) [RNA processing and modification] Back     alignment and domain information
>KOG0542 consensus Predicted exonuclease [Replication, recombination and repair] Back     alignment and domain information
>PRK14670 uvrC excinuclease ABC subunit C; Provisional Back     alignment and domain information
>smart00465 GIYc GIY-YIG type nucleases (URI domain) Back     alignment and domain information
>cd05160 DEDDy_DNA_polB_exo DEDDy 3'-5' exonuclease domain of family-B DNA polymerases Back     alignment and domain information
>PHA02598 denA endonuclease II; Provisional Back     alignment and domain information
>COG3359 Predicted exonuclease [DNA replication, recombination, and repair] Back     alignment and domain information
>PHA02570 dexA exonuclease; Provisional Back     alignment and domain information
>PF13482 RNase_H_2: RNase_H superfamily; PDB: 1TKD_A 1TK5_A 2AJQ_F 1T8E_A 1T7P_A 1SKR_A 1X9W_A 1TK8_A 1TK0_A 1SL2_A Back     alignment and domain information
>cd06125 DnaQ_like_exo DnaQ-like (or DEDD) 3'-5' exonuclease domain superfamily Back     alignment and domain information
>PF01541 GIY-YIG: GIY-YIG catalytic domain; InterPro: IPR000305 During the process of Escherichia coli nucleotide excision repair, DNA damage recognition and processing are achieved by the action of the uvrA, uvrB, and uvrC gene products [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query219
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 39.8 bits (92), Expect = 5e-04
 Identities = 28/178 (15%), Positives = 58/178 (32%), Gaps = 57/178 (32%)

Query: 59  FGLGQQTHRSLDDVRMNLEVLKY---CATVL-FLESGLP-----DIF----TVNR----- 100
           F  G+  ++  D + +  +       C  V    +S L       I      V+      
Sbjct: 9   FETGEHQYQYKDILSVFEDAFVDNFDCKDVQDMPKSILSKEEIDHIIMSKDAVSGTLRLF 68

Query: 101 WEMCSAASVSEGSSGYARFMEPDELYCSRLKIRYG-ISTRFVDQAGRPRLSFVVDASQSL 159
           W + S     +      +F+E        L+I Y  + +    +  +P +   +   Q  
Sbjct: 69  WTLLS-----KQEEMVQKFVE------EVLRINYKFLMSPIKTEQRQPSMMTRMYIEQR- 116

Query: 160 CTVLDACEVVAKKLFEDSRSNSEWNPVVTRQSGNDPAARLR----------NLGYRGM 207
                       +L+ D++  +++N  V+R     P  +LR          N+   G+
Sbjct: 117 -----------DRLYNDNQVFAKYN--VSRL---QPYLKLRQALLELRPAKNVLIDGV 158


>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query219
2p1j_A186 POLIII, DNA polymerase III POLC-type; structural g 99.4
2xri_A224 ERI1 exoribonuclease 3; hydrolase, metal binding; 99.29
2gui_A194 DNA polymerase III epsilon subunit; DNA polymerase 99.27
2gbz_A194 Oligoribonuclease; ORN, deddh, structural genomics 99.23
1w0h_A204 3'-5' exonuclease ERI1; nuclease domain, hydrolase 99.22
2f96_A224 Ribonuclease T; RNAse, RNT, RNAse T, tRNA hydrolas 99.21
3mxm_B242 Three prime repair exonuclease 1; RNAse H-like fol 99.19
3tr8_A186 Oligoribonuclease; transcription, hydrolase; 2.50A 99.19
1y97_A238 Three prime repair exonuclease 2; TREX2, hydrolase 99.17
2igi_A180 Oligoribonuclease; RNAse, exoribonuclease, exonucl 99.16
3v9w_A235 Ribonuclease T; DEDD nucleases family, EXO-nucleas 99.13
3cg7_A308 CRN-4, cell death-related nuclease 4; hydrolase, a 99.11
1zbh_A299 3'-5' exonuclease ERI1; histone mRNA 3'-END-specif 99.07
3u3y_B314 Three prime repair exonuclease 1; RNAse H fold, 3' 99.05
1wlj_A189 Interferon stimulated gene 20KDA; exoribonuclease, 99.01
1zbu_A349 ERI-1 homolog, 3'-5' exonuclease ERI1; hydrolase; 98.96
2qxf_A 482 Exodeoxyribonuclease I; alpha-beta domain, DNAQ su 98.92
1yd6_A99 UVRC; DNA binding protein; 2.00A {Bacillus caldote 98.77
1yd0_A96 Uvrabc system protein C; DNA binding protein; 1.50 98.68
2wsh_A143 Endonuclease II; GIY-YIG, hydrolase; 1.90A {Entero 97.39
4hec_A190 Putative uncharacterized protein; ssgcid, structur 96.15
2kfn_A 605 Klenow fragment of DNA polymerase I; complex (poly 89.48
1x9m_A 698 DNA polymerase; DNA ploymerase, N-2-acetylaminoflu 80.8
>2p1j_A POLIII, DNA polymerase III POLC-type; structural genomics, exonuclease, PSI-2, protein structure initiative; HET: DNA; 2.50A {Thermotoga maritima MSB8} Back     alignment and structure
Probab=99.40  E-value=2e-13  Score=109.30  Aligned_cols=74  Identities=31%  Similarity=0.446  Sum_probs=60.8

Q ss_pred             CCceEEEEEeecCCCCCCCCceeEEEEeeEEEecCceeecccHHHH----------------------------------
Q 027750            6 DRFEIAFFDVETAFPNPPGQRIAILEFGAILVCPKTLEELQPYSTL----------------------------------   51 (219)
Q Consensus         6 ~~~e~vffDvETT~~~~~~~~~~ilEfgAI~V~p~~l~e~~sf~TL----------------------------------   51 (219)
                      .+..+|+||+||||.++..  .+|+|||||++..|+++  ++|++|                                  
T Consensus        10 ~~~~~v~iD~ETTGl~~~~--~~IieIg~v~~~~g~i~--~~f~~lv~P~~~i~~~~~~i~GIt~~~l~~~~~~~~v~~~   85 (186)
T 2p1j_A           10 GDATFVVLDFETTGLDPQV--DEIIEIGAVKIQGGQIV--DEYHTLIKPSREISRKSSEITGITQEMLENKRSIEEVLPE   85 (186)
T ss_dssp             ---CEEEEEEEESCSCTTT--CCEEEEEEEEEETTEEE--EEEEEECBCSSCCCHHHHHHHCCCHHHHTTCCBHHHHHHH
T ss_pred             cCCCEEEEEEECCCCCCCC--CeEEEEEEEEEECCEEE--EEEEEEECcCCCCCHHHhhhcCCCHHHHhcCCCHHHHHHH
Confidence            4568999999999998765  68999999999988764  233322                                  


Q ss_pred             -------------------------------------------------------HHHHHHhhCCC-CCccccchhhhcc
Q 027750           52 -------------------------------------------------------LASLATYFGLG-QQTHRSLDDVRMN   75 (219)
Q Consensus        52 -------------------------------------------------------LatLA~~Fg~~-~~~HRALdDar~t   75 (219)
                                                                             |.+|+++||+. .+.||||+||++|
T Consensus        86 ~~~~l~~~~lv~hn~~fD~~~L~~~~~~~g~~~~~~~~iDt~~l~~~~~~~~~~~L~~l~~~~gi~~~~~H~Al~Da~~t  165 (186)
T 2p1j_A           86 FLGFLEDSIIVAHNANFDYRFLRLWIKKVMGLDWERPYIDTLALAKSLLKLRSYSLDSVVEKLGLGPFRHHRALDDARVT  165 (186)
T ss_dssp             HHHHSSSCEEEETTHHHHHHHHHHHHHHHHCCCCCCCEEEHHHHHHHHTCCSCCSHHHHHHHTTCCSTTCCHHHHHHHHH
T ss_pred             HHHHHCCCEEEEECcHHHHHHHHHHHHHcCCCCCCCCEEeHHHHHHHHhhcCCCCHHHHHHHcCCCCCCCcCHHHHHHHH
Confidence                                                                   67799999998 7899999999999


Q ss_pred             HHHHHHhh
Q 027750           76 LEVLKYCA   83 (219)
Q Consensus        76 vdVl~~~~   83 (219)
                      ++|+..++
T Consensus       166 ~~l~~~l~  173 (186)
T 2p1j_A          166 AQVFLRFV  173 (186)
T ss_dssp             HHHHHHHT
T ss_pred             HHHHHHHH
Confidence            99999886



>2xri_A ERI1 exoribonuclease 3; hydrolase, metal binding; 2.15A {Homo sapiens} Back     alignment and structure
>2gui_A DNA polymerase III epsilon subunit; DNA polymerase proofreading domain, transferase; HET: DNA U5P; 1.60A {Escherichia coli} SCOP: c.55.3.5 PDB: 1j54_A* 1j53_A* 2ido_A* 2xy8_A* Back     alignment and structure
>2gbz_A Oligoribonuclease; ORN, deddh, structural genomics, hydrolase; 2.30A {Xanthomonas campestris PV} Back     alignment and structure
>1w0h_A 3'-5' exonuclease ERI1; nuclease domain, hydrolase; HET: AMP; 1.59A {Homo sapiens} SCOP: c.55.3.5 Back     alignment and structure
>2f96_A Ribonuclease T; RNAse, RNT, RNAse T, tRNA hydrolase, SAD, PS protein structure initiative, midwest center for structural genomics; 2.09A {Pseudomonas aeruginosa} SCOP: c.55.3.5 Back     alignment and structure
>3mxm_B Three prime repair exonuclease 1; RNAse H-like fold, polyproline type II helix, hydrolase-DNA; HET: DNA; 1.75A {Mus musculus} SCOP: c.55.3.5 PDB: 3mxj_B 2ioc_B 3mxi_B* 3b6o_A* 2o4g_A* 3b6p_A* 2o4i_A 2oa8_A Back     alignment and structure
>3tr8_A Oligoribonuclease; transcription, hydrolase; 2.50A {Coxiella burnetii} Back     alignment and structure
>1y97_A Three prime repair exonuclease 2; TREX2, hydrolase; 2.50A {Homo sapiens} SCOP: c.55.3.5 Back     alignment and structure
>2igi_A Oligoribonuclease; RNAse, exoribonuclease, exonuclease, hydrolase, mRNA decay; 1.70A {Escherichia coli} SCOP: c.55.3.5 PDB: 1yta_A 1j9a_A Back     alignment and structure
>3v9w_A Ribonuclease T; DEDD nucleases family, EXO-nucleases, hydrolase-DNA complex; HET: DNA; 1.70A {Escherichia coli} PDB: 3ngy_A 3v9u_A* 3ngz_A* 3va3_A* 3v9z_A* 3nh0_A 3nh2_A 3nh1_A* 3v9s_A* 3v9x_A* 3va0_A* 2is3_A Back     alignment and structure
>3cg7_A CRN-4, cell death-related nuclease 4; hydrolase, apoptosis, 3'-5' exonuclease, deddh; 2.50A {Caenorhabditis elegans} PDB: 3cm5_A 3cm6_A Back     alignment and structure
>1zbh_A 3'-5' exonuclease ERI1; histone mRNA 3'-END-specific recognition, structures of 3'- exonuclease and ITS RNA complex, hydrolase/RNA complex; HET: AMP; 3.00A {Homo sapiens} Back     alignment and structure
>3u3y_B Three prime repair exonuclease 1; RNAse H fold, 3' exonuclease, homodimer, hydrolase-DNA compl; HET: BU1; 2.28A {Mus musculus} PDB: 3u6f_B* Back     alignment and structure
>1wlj_A Interferon stimulated gene 20KDA; exoribonuclease, hydrolase; HET: U5P; 1.90A {Homo sapiens} SCOP: c.55.3.5 Back     alignment and structure
>1zbu_A ERI-1 homolog, 3'-5' exonuclease ERI1; hydrolase; HET: AMP; 3.00A {Homo sapiens} Back     alignment and structure
>2qxf_A Exodeoxyribonuclease I; alpha-beta domain, DNAQ superfamily, SH3-like domain, produc structure, DNA damage, DNA repair, exonuclease; HET: TMP; 1.50A {Escherichia coli} SCOP: c.55.3.5 PDB: 1fxx_A* 3c94_A 3c95_A 3hl8_A* 3hp9_A* Back     alignment and structure
>1yd6_A UVRC; DNA binding protein; 2.00A {Bacillus caldotenax} Back     alignment and structure
>1yd0_A Uvrabc system protein C; DNA binding protein; 1.50A {Thermotoga maritima} PDB: 1ycz_A 1yd1_A 1yd4_A 1yd3_A 1yd2_A 1yd5_A Back     alignment and structure
>2wsh_A Endonuclease II; GIY-YIG, hydrolase; 1.90A {Enterobacteria phage T4} Back     alignment and structure
>4hec_A Putative uncharacterized protein; ssgcid, structural genomics, SEA structural genomics center for infectious disease, unknown; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>2kfn_A Klenow fragment of DNA polymerase I; complex (polymerase/DNA), exonuclease, transferase, transferase/DNA complex; HET: US1; 2.03A {Escherichia coli} SCOP: c.55.3.5 e.8.1.1 PDB: 1d9f_A* 1d9d_A* 1krp_A* 1ksp_A* 1qsl_A* 1kfs_A* 2kfz_A* 2kzm_A* 2kzz_A* 1dpi_A* 1kfd_A* 1kln_A* 1d8y_A* Back     alignment and structure
>1x9m_A DNA polymerase; DNA ploymerase, N-2-acetylaminofluorene, replication block, mutagenesis, transferase/electron transport/DNA complex; HET: DNA 2DT 8FG; 2.10A {Enterobacteria phage T7} SCOP: c.55.3.5 e.8.1.1 PDB: 1skr_A* 1skw_A* 1sl0_A* 1sks_A* 1sl2_A* 1t7p_A* 1t8e_A* 1tk0_A* 1tk5_A* 1tk8_A* 1tkd_A* 1sl1_A* 1x9s_A* 1x9w_A* 1zyq_A* 2ajq_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query219
d2guia1174 N-terminal exonuclease domain of the epsilon subun 99.55
d2igia1180 Oligoribonuclease {Escherichia coli [TaxId: 562]} 99.5
d1w0ha_200 Exonuclease ERI1 {Human (Homo sapiens) [TaxId: 960 99.46
d2f96a1202 Ribonuclease T {Pseudomonas aeruginosa [TaxId: 287 99.42
d3b6oa1226 Three prime repair exonuclease 1, TREX1 {Mouse (Mu 99.3
d1y97a1228 Three prime repair exonuclease 2, TREX2 {Human (Ho 99.29
d2qxfa1 467 Exonuclease I {Escherichia coli K12 (Escherichia c 99.25
d1wlja_173 Interferon-stimulated gene 20 kDa protein, ISG20 { 99.12
d1x9ma1204 Exonuclease domain of T7 DNA polymerase {Bacteriop 90.12
>d2guia1 c.55.3.5 (A:7-180) N-terminal exonuclease domain of the epsilon subunit of DNA polymerase III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Ribonuclease H-like motif
superfamily: Ribonuclease H-like
family: DnaQ-like 3'-5' exonuclease
domain: N-terminal exonuclease domain of the epsilon subunit of DNA polymerase III
species: Escherichia coli [TaxId: 562]
Probab=99.55  E-value=1.9e-15  Score=112.53  Aligned_cols=74  Identities=24%  Similarity=0.308  Sum_probs=63.2

Q ss_pred             EEEEEeecCCCCCCCC---ceeEEEEeeEEEecCceeecccHHHH-----------------------------------
Q 027750           10 IAFFDVETAFPNPPGQ---RIAILEFGAILVCPKTLEELQPYSTL-----------------------------------   51 (219)
Q Consensus        10 ~vffDvETT~~~~~~~---~~~ilEfgAI~V~p~~l~e~~sf~TL-----------------------------------   51 (219)
                      .||||+||||+++.+.   +.+|||||||++..+.+++ ++|+++                                   
T Consensus         2 ~vv~D~ETTGl~~~~~~~~~d~IIeIg~v~~~~~~~~~-~~~~~~v~P~~~i~~~~~~i~gIt~e~~~~~~~~~~~~~~~   80 (174)
T d2guia1           2 QIVLDTETTGMNQIGAHYEGHKIIEIGAVEVVNRRLTG-NNFHVYLKPDRLVDPEAFGVHGIADEFLLDKPTFAEVADEF   80 (174)
T ss_dssp             EEEEEEEESCCCSSSSTTTTCCEEEEEEEEEETTEECS-CCEEEECCCSSCCCHHHHHHHCCCHHHHTTSCCHHHHHHHH
T ss_pred             EEEEEeeCCCCCcccccCCCCEEEEEEEEEEECCEEee-eEEEEEeccCccchhhhhhccccchhhhhcchhHHHHHHHH
Confidence            6899999999988642   3689999999999887643 577777                                   


Q ss_pred             ----------------------------------------------------------HHHHHHhhCCC---CCccccch
Q 027750           52 ----------------------------------------------------------LASLATYFGLG---QQTHRSLD   70 (219)
Q Consensus        52 ----------------------------------------------------------LatLA~~Fg~~---~~~HRALd   70 (219)
                                                                                |..|+.+||++   ...||||+
T Consensus        81 ~~~~~~~~~v~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~L~~l~~~~~~~~~~~~~H~Al~  160 (174)
T d2guia1          81 MDYIRGAELVIHNAAFDIGFMDYEFSLLKRDIPKTNTFCKVTDSLAVARKMFPGKRNSLDALCARYEIDNSKRTLHGALL  160 (174)
T ss_dssp             HHHHTTSEEEETTHHHHHHHHHHHHHHTCSCCCCGGGTSEEEEHHHHHHHHSTTSCCSHHHHHHHTTCCCTTCSSCCHHH
T ss_pred             HHhcCCCeEEEeecchhhHHHHHHHHHhCCCCCCcccccchhhHHHHHHHHcCCCCCCHHHHHHHcCCCCCCCCCcCHHH
Confidence                                                                      99999999997   23599999


Q ss_pred             hhhccHHHHHHhhh
Q 027750           71 DVRMNLEVLKYCAT   84 (219)
Q Consensus        71 Dar~tvdVl~~~~g   84 (219)
                      ||++|++|+..++|
T Consensus       161 Da~~ta~v~~~l~~  174 (174)
T d2guia1         161 DAQILAEVYLAMTG  174 (174)
T ss_dssp             HHHHHHHHHHHHTC
T ss_pred             HHHHHHHHHHHHcC
Confidence            99999999999876



>d2igia1 c.55.3.5 (A:1-180) Oligoribonuclease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w0ha_ c.55.3.5 (A:) Exonuclease ERI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f96a1 c.55.3.5 (A:19-220) Ribonuclease T {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d3b6oa1 c.55.3.5 (A:9-234) Three prime repair exonuclease 1, TREX1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1y97a1 c.55.3.5 (A:1-228) Three prime repair exonuclease 2, TREX2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qxfa1 c.55.3.5 (A:8-474) Exonuclease I {Escherichia coli K12 (Escherichia coli K-12) [TaxId: 83333]} Back     information, alignment and structure
>d1wlja_ c.55.3.5 (A:) Interferon-stimulated gene 20 kDa protein, ISG20 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x9ma1 c.55.3.5 (A:1-210) Exonuclease domain of T7 DNA polymerase {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure