Citrus Sinensis ID: 027757


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------22
MILPGSNIVVGPYAGHSQIKEVEFVKSSGRAKDCPKDDRPEFAILGRSNVGKSSLINALVRKKELALTSKKPGKTQLINHFLVNKSWYIVDLPGYGFAKAPDVTRMDWSSFTKGYFLNRESLVGVLLLIDASVPPQKIDLDCANWLGRNNIPLTFVFTKCDKMKVAKGRRPDENIKSFQQLIRENYPHHPPWIMTSSVTGLGRDELLLHMSQLRNYWDQ
cccccccEEEccccccccEEEEEEEEECccccccccccccEEEEEccccccHHHHHHHHHcccccCCcccccccccEEEEEEEcccEEEEEccccccccccHHHHHHHHHHHHHHHHccccccEEEEEEEccccccHHHHHHHHHHHHccccEEEEEEcccccccccccccHHHHHHHHHHHHccccccccEEEEEccccccHHHHHHHHHHHHHHHHc
*****SNIVVGPYAGHSQIKEVEFVKSSGRAKDCPKDDRPEFAILGRSNVGKSSLINALVRKKELALTSKKPGKTQLINHFLVNKSWYIVDLPGYGFAKAPDVTRMDWSSFTKGYFLNRESLVGVLLLIDASVPPQKIDLDCANWLGRNNIPLTFVFTKCDKMKVAK******NIKSFQQLIRENYPHHPPWIMTSSVTGLGRDELLLHMSQLRNYWD*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MILPGSNIVVGPYAGHSQIKEVEFVKSSGRAKDCPKDDRPEFAILGRSNVGKSSLINALVRKKELALTSKKPGKTQLINHFLVNKSWYIVDLPGYGFAKAPDVTRMDWSSFTKGYFLNRESLVGVLLLIDASVPPQKIDLDCANWLGRNNIPLTFVFTKCDKMKVAKGRRPDENIKSFQQLIRENYPHHPPWIMTSSVTGLGRDELLLHMSQLRNYWDQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
GTP-binding protein At2g22870 probableO81004
Probable GTP-binding protein EngB Necessary for normal cell division and for the maintenance of normal septation.probableA5D451
Probable GTP-binding protein EngB Necessary for normal cell division and for the maintenance of normal septation.probableB0TFJ0

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3PQC, chain A
Confidence level:very confident
Coverage over the Query: 19-215
View the alignment between query and template
View the model in PyMOL