Citrus Sinensis ID: 027770


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------22
MFWVLTLLSWYQDSRSVGAIAGLALAIVFTWRMFRSPGAPQRRQPKRQAPSTSNSVGSTQANATSTPFGASSSSEDLRTQIADALFQPVKPTLGQVVRQKLSEGRKVTCRLLGVILEESCPEELQKQVTVKSSVLEALLEITKFCDLYLMERVLDNESEKKVLLALETAGVFTSGGLVKDKVLFCSTEIGRTSFVRQLEPDWHIDTNPEIVSQLAVHLL
cHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccHHHHHHHHHccccEEEEEEHHHHcccccHHHHHcccEEHHHHHHHHHHHHHcccEEEEEEEccHHHHHHHHHHHHHccccccccccccEEEEEccccccccEEEEccccCEECccHHHHHHHHcccc
*FWVLTLLSWYQDSRSVGAIAGLALAIVFTWRMF**********************************************IADALFQPVKPTLGQVVRQKLSEGRKVTCRLLGVILEESCPEELQKQVTVKSSVLEALLEITKFCDLYLMERVLDNESEKKVLLALETAGVFTSGGLVKDKVLFCSTEIGRTSFVRQLEPDWHIDTNPEIVSQLAVHLL
xxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFWVLTLLSWYQDSRSVGAIAGLALAIVFTWRMFRSPGAPQRRQPKRQAPSTSNSVGSTQANATSTPFGASSSSEDLRTQIADALFQPVKPTLGQVVRQKLSEGRKVTCRLLGVILEESCPEELQKQVTVKSSVLEALLEITKFCDLYLMERVLDNESEKKVLLALETAGVFTSGGLVKDKVLFCSTEIGRTSFVRQLEPDWHIDTNPEIVSQLAVHLL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Peroxisome biogenesis protein 22 May tethered PEX4 to the peroxisome membrane and may be involved in a late step of the matrix protein import. Does not play a role in the biogenesis of the peroxisomal membrane.probableQ9LSX7

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2Y9M, chain B
Confidence level:probable
Coverage over the Query: 178-204
View the alignment between query and template
View the model in PyMOL
Template: 2L2T, chain A
Confidence level:probable
Coverage over the Query: 16-36
View the alignment between query and template
View the model in PyMOL