Citrus Sinensis ID: 027780

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------22

MFTRLFGKPKQETNALTTLDKLNETLEMLEKKEKVLLKKASVEVEKAKDYSKAKNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGASTMKAMQKATNIDDVDKTMDEINEQTENMKQIQEALSTPIGAAADFDEDELEAELEELEGAELEEQLLQPATTAPAAPVQVPAGRQQARPVPQKQRTAEEDELAALQAEMAL

ccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHHHHHHHcc

MFTR*****************************************************AAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGA**********NIDDVDKTMDEINEQTENMKQIQEAL**PIGAAADFDEDELEAELEE************************************************LQAEMAL

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MFTRLFGKPKQxxxxxxxxxxxxxxxxxxxxxxxxxxxxASVEVEKAKDYSKAKNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGASTMKAMQKATNIDDxxxxxxxxxxxxxxxxxxxxxLSTPIGAAxxxxxxxxxxxxxxxxxxxxxxxxxQPATTAPAAPVQVPAGRQQARPVPQKQRTAEEDELAALQAEMAL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Vacuolar protein sorting-associated protein 32 homolog 2	Component of the ESCRT-III complex, which is required for multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. The ESCRT-III complex is probably involved in the concentration of MVB cargo.	confident	Q9SZE4
Vacuolar protein sorting-associated protein 32 homolog 1	Component of the ESCRT-III complex, which is required for multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. The ESCRT-III complex is probably involved in the concentration of MVB cargo.	probable	O82197
Vacuolar-sorting protein snf7	Required for the sorting and concentration of proteins resulting in the entry of these proteins into the invaginating vesicles of the multivesicular body (MVB).	probable	Q9P7F7

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3FRT, chain A
Confidence level:confident
Coverage over the Query: 13-141
View the alignment between query and template
View the model in PyMOL