Citrus Sinensis ID: 027782

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------22
MQSSMDVETVSSQTQNEPGPLPLKPLFEPLKAHEMSDGRVQFQKVNVPPHRYSPLKKVWMDIYTPIFEQMKIDIRMNLKARRVELKTRADTPDISNLQKCADFVHAFMLGFDVIDAIALLRLDELYVESFEIKDVKTLRGEHLSRAIGRLSGKGGKTKFAIENATKTRIVIADTKIHILGSFANIKIARDSLCSLILGSPAGKVYSKLRAVTARLAERF
cccccccccccccccccccccccccccccccccccccccCEEEEEccccccccHHHHccHHHHHHHHHHHccEEEEEccccEEEEEcccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHccccEEEEEEEcccccccccHHHHHHHccccccccHHHHHHHHHccEEEEcccEEEEEccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcc
*****************************************FQKVNVPPHRYSPLKKVWMDIYTPIFEQMKIDIRMNLKARRVELKTRADTPDISNLQKCADFVHAFMLGFDVIDAIALLRLDELYVESFEIKDVKTLRGEHLSRAIGRLSGKGGKTKFAIENATKTRIVIADTKIHILGSFANIKIARDSLCSLILGSPAGKVYSKLRAVTARL*ER*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQSSMDVETVSSQTQNEPGPLPLKPLFEPLKAHEMSDGRVQFQKVNVPPHRYSPLKKVWMDIYTPIFEQMKIDIRMNLKARRVELKTRADTPDISNLQKCADFVHAFMLGFDVIDAIALLRLDELYVESFEIKDVKTLRGEHLSRAIGRLSGKGGKTKFAIENATKTRIVIADTKIHILGSFANIKIARDSLCSLILGSPAGKVYSKLRAVTARLAERF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
RNA-binding protein PNO1 probableQ6DDB9
Pre-rRNA-processing protein pno1 Required for small ribosomal subunit (SSU) synthesis. Has a role in the processing of early nucleolar and late cytoplasmic pre-RNA species.probableO14044
RNA-binding protein PNO1 probableQ6VEU3

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2E3U, chain A
Confidence level:very confident
Coverage over the Query: 41-211
View the alignment between query and template
View the model in PyMOL