Citrus Sinensis ID: 027782

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------22
MQSSMDVETVSSQTQNEPGPLPLKPLFEPLKAHEMSDGRVQFQKVNVPPHRYSPLKKVWMDIYTPIFEQMKIDIRMNLKARRVELKTRADTPDISNLQKCADFVHAFMLGFDVIDAIALLRLDELYVESFEIKDVKTLRGEHLSRAIGRLSGKGGKTKFAIENATKTRIVIADTKIHILGSFANIKIARDSLCSLILGSPAGKVYSKLRAVTARLAERF
cccccccccccccccccccccccccccccccccccccccEEEEEEcccccccHHHHHccHHHHHHHHHHHccEEEEEccccEEEEEcccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHccccEEEEEEEcccccccccHHHHHHHccccccccHHHHHHHHHccEEEEcccEEEEEccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcc
cccccccccccccccccccccccccccccccHHcccccccEEEEEccccccccHHHHHHHHHccHHHHHccEEEEEEccccEEEEEcccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcEEEEEEEEcccccccccHHHHHHHHccccccEEEEEEEcccEEEEEEccEEEEEccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHc
mqssmdvetvssqtqnepgplplkplfeplkahemsdgrvqfqkvnvpphrysplkKVWMDIYTPIFEQMKIDIRMNLKARRVELktradtpdisnlqKCADFVHAFMLGFDVIDAIALLRLDELYVESFEIKDVKTLRGEHLSRAIgrlsgkggktKFAIENATKTRIVIADTKIHILGSFANIKIARDSLCSlilgspagkvYSKLRAVTARLAERF
mqssmdvetvssqtqnepgplpLKPLFEPLKAHEMSDGRvqfqkvnvpphrysplkKVWMDIYTPIFEQMKIDIRMNLKARRVELKtradtpdisnlQKCADFVHAFMLGFDVIDAIALLRLDELYVESFeikdvktlrgehlsraigrlsgkggktkfaienatktriviadtKIHILGSFANIKIARDSLCSLIlgspagkvyskLRAVTARLAERF
MQSSMDVETVSSQTQNepgplplkplfeplkAHEMSDGRVQFQKVNVPPHRYSPLKKVWMDIYTPIFEQMKIDIRMNLKARRVELKTRADTPDISNLQKCADFVHAFMLGFDVIDAIALLRLDELYVESFEIKDVKTLRGEHLSRAIGRLSGKGGKTKFAIENATKTRIVIADTKIHILGSFANIKIARDSLCSLILGSPAGKVYSKLRAVTARLAERF
*****************************************FQKVNVPPHRYSPLKKVWMDIYTPIFEQMKIDIRMNLKARRVELKTRADTPDISNLQKCADFVHAFMLGFDVIDAIALLRLDELYVESFEIKDVKTLRGEHLSRAIGRLSGKGGKTKFAIENATKTRIVIADTKIHILGSFANIKIARDSLCSLILGSPAGKVYSKLRAVT*******
*********************************************NVPPHRYSPLKKVWMDIYTPIFEQMKIDIRMNLKARRVELKTRADTPDISNLQKCADFVHAFMLGFDVIDAIALLRLDELYVESFEIKDVKTLR**********LSGKGGKTKFAIENATKTRIVIADTKIHILGSFANIKIARDSLCSLILGSPAGKVYSKLRAVTARL*ER*
*****************PGPLPLKPLFEPLKAHEMSDGRVQFQKVNVPPHRYSPLKKVWMDIYTPIFEQMKIDIRMNLKARRVELKTRADTPDISNLQKCADFVHAFMLGFDVIDAIALLRLDELYVESFEIKDVKTLRGEHLSRAIGRLSGKGGKTKFAIENATKTRIVIADTKIHILGSFANIKIARDSLCSLILGSPAGKVYSKLRAVTARLAERF
***************************EP********GRVQFQKVNVPPHRYSPLKKVWMDIYTPIFEQMKIDIRMNLKARRVELKTRADTPDISNLQKCADFVHAFMLGFDVIDAIALLRLDELYVESFEIKDVKTLRGEHLSRAIGRLSGKGGKTKFAIENATKTRIVIADTKIHILGSFANIKIARDSLCSLILGSPAGKVYSKLRAVTARLAE**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQSSMDVETVSSQTQNEPGPLPLKPLFEPLKAHEMSDGRVQFQKVNVPPHRYSPLKKVWMDIYTPIFEQMKIDIRMNLKARRVELKTRADTPDISNLQKCADFVHAFMLGFDVIDAIALLRLDELYVESFEIKDVKTLRGEHLSRAIGRLSGKGGKTKFAIENATKTRIVIADTKIHILGSFANIKIARDSLCSLILGSPAGKVYSKLRAVTARLAERF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query219 2.2.26 [Sep-21-2011]
Q9VR89240 RNA-binding protein pno1 yes no 0.826 0.754 0.674 1e-70
A7RP64238 RNA-binding protein pno1 N/A no 0.894 0.823 0.617 1e-70
Q29IG6238 RNA-binding protein pno1 yes no 0.817 0.752 0.670 7e-70
Q6VEU3252 RNA-binding protein PNO1 yes no 0.958 0.833 0.582 7e-69
Q1DQZ5255 Pre-rRNA-processing prote N/A no 0.881 0.756 0.621 4e-68
Q5ACM4276 Pre-rRNA-processing prote N/A no 0.890 0.706 0.622 7e-68
Q6VBQ6243 RNA-binding protein PNO1 N/A no 0.890 0.802 0.612 2e-67
Q6VBQ8248 RNA-binding protein PNO1 yes no 0.894 0.790 0.596 2e-67
Q8AVH4236 RNA-binding protein PNO1 N/A no 0.894 0.830 0.586 5e-67
Q9CPS7248 RNA-binding protein PNO1 yes no 0.894 0.790 0.591 1e-66
>sp|Q9VR89|PNO1_DROME RNA-binding protein pno1 OS=Drosophila melanogaster GN=l(1)G0004 PE=2 SV=1 Back     alignment and function desciption
 Score =  266 bits (679), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 122/181 (67%), Positives = 154/181 (85%)

Query: 39  RVQFQKVNVPPHRYSPLKKVWMDIYTPIFEQMKIDIRMNLKARRVELKTRADTPDISNLQ 98
           R + +KV+VPPHRYS LK+ WM I+TP+ E MK+ IR N+KAR+VEL+   +TPDI+NLQ
Sbjct: 60  RSELRKVSVPPHRYSSLKEHWMKIFTPVVEHMKLQIRFNMKARQVELRVGPETPDIANLQ 119

Query: 99  KCADFVHAFMLGFDVIDAIALLRLDELYVESFEIKDVKTLRGEHLSRAIGRLSGKGGKTK 158
           + ADFV AF+ GF+V DA+ALLRL++L+VESFEIKDVKTLRG+H SRAIGRL+GKGG+TK
Sbjct: 120 RGADFVRAFLCGFEVDDALALLRLEDLFVESFEIKDVKTLRGDHQSRAIGRLAGKGGRTK 179

Query: 159 FAIENATKTRIVIADTKIHILGSFANIKIARDSLCSLILGSPAGKVYSKLRAVTARLAER 218
           F IEN TKTRIV+AD+KIHILGS+ NI++AR ++C+LILGSP  KVY  LRAV +RL+ER
Sbjct: 180 FTIENVTKTRIVLADSKIHILGSYQNIQLARRAVCNLILGSPPSKVYGNLRAVASRLSER 239

Query: 219 F 219
            
Sbjct: 240 M 240

Drosophila melanogaster (taxid: 7227)
>sp|A7RP64|PNO1_NEMVE RNA-binding protein pno1 OS=Nematostella vectensis GN=pno1 PE=3 SV=1 Back     alignment and function description
>sp|Q29IG6|PNO1_DROPS RNA-binding protein pno1 OS=Drosophila pseudoobscura pseudoobscura GN=l(1)G0004 PE=3 SV=1 Back     alignment and function description
>sp|Q6VEU3|PNO1_DANRE RNA-binding protein PNO1 OS=Danio rerio GN=pno1 PE=2 SV=2 Back     alignment and function description
>sp|Q1DQZ5|PNO1_COCIM Pre-rRNA-processing protein PNO1 OS=Coccidioides immitis (strain RS) GN=PNO1 PE=3 SV=1 Back     alignment and function description
>sp|Q5ACM4|PNO1_CANAL Pre-rRNA-processing protein PNO1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PNO1 PE=3 SV=1 Back     alignment and function description
>sp|Q6VBQ6|PNO1_ORYLA RNA-binding protein PNO1 OS=Oryzias latipes GN=pno1 PE=2 SV=1 Back     alignment and function description
>sp|Q6VBQ8|PNO1_RAT RNA-binding protein PNO1 OS=Rattus norvegicus GN=Pno1 PE=2 SV=1 Back     alignment and function description
>sp|Q8AVH4|PNO1_XENLA RNA-binding protein PNO1 OS=Xenopus laevis GN=pno1 PE=2 SV=1 Back     alignment and function description
>sp|Q9CPS7|PNO1_MOUSE RNA-binding protein PNO1 OS=Mus musculus GN=Pno1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query219
449461072224 PREDICTED: RNA-binding protein pno1-like 0.990 0.968 0.898 1e-111
449456341224 PREDICTED: RNA-binding protein pno1-like 0.986 0.964 0.902 1e-111
449506557224 PREDICTED: RNA-binding protein pno1-like 0.990 0.968 0.894 1e-110
356566309220 PREDICTED: RNA-binding protein pno1-like 0.972 0.968 0.894 1e-109
255647070220 unknown [Glycine max] 0.972 0.968 0.894 1e-109
224122312212 predicted protein [Populus trichocarpa] 0.968 1.0 0.888 1e-108
225455820224 PREDICTED: RNA-binding protein pno1-like 0.990 0.968 0.875 1e-108
356566307220 PREDICTED: RNA-binding protein pno1-like 0.972 0.968 0.889 1e-108
224056873223 predicted protein [Populus trichocarpa] 0.995 0.977 0.861 1e-108
356527189220 PREDICTED: RNA-binding protein pno1-like 0.972 0.968 0.875 1e-107
>gi|449461072|ref|XP_004148267.1| PREDICTED: RNA-binding protein pno1-like [Cucumis sativus] Back     alignment and taxonomy information
 Score =  407 bits (1046), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 195/217 (89%), Positives = 208/217 (95%)

Query: 3   SSMDVETVSSQTQNEPGPLPLKPLFEPLKAHEMSDGRVQFQKVNVPPHRYSPLKKVWMDI 62
           +SMDVET+S+QT++    LP KP F+PLK HEM+DGRVQF+KV+VPPHRYSPLKK WMDI
Sbjct: 8   TSMDVETISTQTKDVVSTLPPKPQFDPLKPHEMNDGRVQFRKVSVPPHRYSPLKKAWMDI 67

Query: 63  YTPIFEQMKIDIRMNLKARRVELKTRADTPDISNLQKCADFVHAFMLGFDVIDAIALLRL 122
           YTPI++QMKIDIRMNLKAR+VELKTRADTPDISNLQKCADFVHAFMLGFDVIDAIALLR+
Sbjct: 68  YTPIYDQMKIDIRMNLKARKVELKTRADTPDISNLQKCADFVHAFMLGFDVIDAIALLRV 127

Query: 123 DELYVESFEIKDVKTLRGEHLSRAIGRLSGKGGKTKFAIENATKTRIVIADTKIHILGSF 182
           DELYVESFEIKDVKTLRGEHLSRAIGRLSGK GKTKFAIENATKTRIVIADTKIHILGSF
Sbjct: 128 DELYVESFEIKDVKTLRGEHLSRAIGRLSGKAGKTKFAIENATKTRIVIADTKIHILGSF 187

Query: 183 ANIKIARDSLCSLILGSPAGKVYSKLRAVTARLAERF 219
           ANIKIARDSLCSLILGSPAGKVYSKLRAVTARLAERF
Sbjct: 188 ANIKIARDSLCSLILGSPAGKVYSKLRAVTARLAERF 224

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449456341|ref|XP_004145908.1| PREDICTED: RNA-binding protein pno1-like [Cucumis sativus] gi|449497281|ref|XP_004160361.1| PREDICTED: RNA-binding protein pno1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449506557|ref|XP_004162782.1| PREDICTED: RNA-binding protein pno1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356566309|ref|XP_003551375.1| PREDICTED: RNA-binding protein pno1-like [Glycine max] Back     alignment and taxonomy information
>gi|255647070|gb|ACU24003.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|224122312|ref|XP_002330592.1| predicted protein [Populus trichocarpa] gi|222872150|gb|EEF09281.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225455820|ref|XP_002272565.1| PREDICTED: RNA-binding protein pno1-like [Vitis vinifera] gi|225455824|ref|XP_002272932.1| PREDICTED: RNA-binding protein pno1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356566307|ref|XP_003551374.1| PREDICTED: RNA-binding protein pno1-like [Glycine max] Back     alignment and taxonomy information
>gi|224056873|ref|XP_002299066.1| predicted protein [Populus trichocarpa] gi|222846324|gb|EEE83871.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356527189|ref|XP_003532195.1| PREDICTED: RNA-binding protein pno1-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query219
TAIR|locus:2088120215 AT3G13230 [Arabidopsis thalian 0.849 0.865 0.854 9.1e-84
FB|FBgn0027334240 l(1)G0004 "lethal (1) G0004" [ 0.821 0.75 0.677 2e-63
UNIPROTKB|Q29IG6238 l(1)G0004 "RNA-binding protein 0.812 0.747 0.674 8.8e-63
CGD|CAL0000825276 orf19.7618 [Candida albicans ( 0.826 0.655 0.651 1.5e-60
UNIPROTKB|Q6VBQ6243 pno1 "RNA-binding protein PNO1 0.831 0.748 0.637 2.4e-60
UNIPROTKB|F1NGE6251 PNO1 "RNA-binding protein PNO1 0.831 0.725 0.637 3.9e-60
UNIPROTKB|Q5F414242 PNO1 "RNA-binding protein PNO1 0.831 0.752 0.637 3.9e-60
ZFIN|ZDB-GENE-040426-1419252 pno1 "partner of NOB1 homolog 0.849 0.738 0.623 3.9e-60
UNIPROTKB|E1BTT0242 PNO1 "RNA-binding protein PNO1 0.831 0.752 0.631 8.1e-60
UNIPROTKB|Q8AVH4236 pno1 "RNA-binding protein PNO1 0.840 0.779 0.616 1e-59
TAIR|locus:2088120 AT3G13230 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 839 (300.4 bits), Expect = 9.1e-84, P = 9.1e-84
 Identities = 159/186 (85%), Positives = 180/186 (96%)

Query:    32 AHEMSDGRVQFQKVNVPPHRYSPLKKVWMDIYTPIFEQMKIDIRMNLKARRVELKTRADT 91
             AHEMSDG+VQF+K+ VPP+RYSPLKK W+DIYTPI++QMK+DIRMNLKAR+VELKTRADT
Sbjct:    30 AHEMSDGKVQFRKIAVPPNRYSPLKKAWLDIYTPIYDQMKVDIRMNLKARKVELKTRADT 89

Query:    92 PDISNLQKCADFVHAFMLGFDVIDAIALLRLDELYVESFEIKDVKTLRGEHLSRAIGRLS 151
             PDISNLQK ADFVHAFMLGFD+ DAI+LLR+DELYVESFEIKDVKTL+GEHLSRAIGRLS
Sbjct:    90 PDISNLQKSADFVHAFMLGFDIPDAISLLRMDELYVESFEIKDVKTLKGEHLSRAIGRLS 149

Query:   152 GKGGKTKFAIENATKTRIVIADTKIHILGSFANIKIARDSLCSLILGSPAGKVYSKLRAV 211
             GKGGKTKFAIEN+TKTRIVIADT+IHILG+F+NIK+AR SLCSLI+GSPAGKVYSKLR+V
Sbjct:   150 GKGGKTKFAIENSTKTRIVIADTRIHILGAFSNIKVARSSLCSLIMGSPAGKVYSKLRSV 209

Query:   212 TARLAE 217
             +ARL E
Sbjct:   210 SARLNE 215
GO:0003723 "RNA binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0006364 "rRNA processing" evidence=RCA
FB|FBgn0027334 l(1)G0004 "lethal (1) G0004" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q29IG6 l(1)G0004 "RNA-binding protein pno1" [Drosophila pseudoobscura pseudoobscura (taxid:46245)] Back     alignment and assigned GO terms
CGD|CAL0000825 orf19.7618 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|Q6VBQ6 pno1 "RNA-binding protein PNO1" [Oryzias latipes (taxid:8090)] Back     alignment and assigned GO terms
UNIPROTKB|F1NGE6 PNO1 "RNA-binding protein PNO1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q5F414 PNO1 "RNA-binding protein PNO1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1419 pno1 "partner of NOB1 homolog (S. cerevisiae)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1BTT0 PNO1 "RNA-binding protein PNO1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q8AVH4 pno1 "RNA-binding protein PNO1" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6C7G0PNO1_YARLINo assigned EC number0.65340.80360.6821yesno
O18216PNO1_CAEELNo assigned EC number0.57380.79900.6317yesno
Q8AVH4PNO1_XENLANo assigned EC number0.58670.89490.8305N/Ano
Q9NRX1PNO1_HUMANNo assigned EC number0.59180.89490.7777yesno
Q753C6PNO1_ASHGONo assigned EC number0.58370.89490.7340yesno
Q6VBQ6PNO1_ORYLANo assigned EC number0.61220.89040.8024N/Ano
Q99216PNO1_YEASTNo assigned EC number0.58880.89490.7153yesno
Q9CPS7PNO1_MOUSENo assigned EC number0.59180.89490.7903yesno
Q4WNG7PNO1_ASPFUNo assigned EC number0.58370.89040.7738yesno
Q4PMC9PNO1_IXOSCNo assigned EC number0.55490.87210.8162N/Ano
Q6FMB3PNO1_CANGANo assigned EC number0.59390.89490.7509yesno
Q2UMG1PNO1_ASPORNo assigned EC number0.59890.89040.75yesno
Q6DDB9PNO1_XENTRNo assigned EC number0.58670.89490.8305yesno
O14044PNO1_SCHPONo assigned EC number0.58880.89040.8091yesno
Q7YRD0PNO1_BOVINNo assigned EC number0.58670.89490.7777yesno
P0CO46PNO1_CRYNJNo assigned EC number0.59790.88120.7255yesno
Q6CUA5PNO1_KLULANo assigned EC number0.59890.89490.7153yesno
Q6VEU3PNO1_DANRENo assigned EC number0.58290.95890.8333yesno
Q5F414PNO1_CHICKNo assigned EC number0.63730.83100.7520yesno
Q9VR89PNO1_DROMENo assigned EC number0.67400.82640.7541yesno
Q4IN63PNO1_GIBZENo assigned EC number0.60770.82640.7098yesno
Q6VBQ8PNO1_RATNo assigned EC number0.59690.89490.7903yesno
Q6BJ75PNO1_DEBHANo assigned EC number0.62980.82640.7098yesno
Q29IG6PNO1_DROPSNo assigned EC number0.67030.81730.7521yesno
Q54K66PNO1_DICDINo assigned EC number0.62010.81730.7489yesno
A7RP64PNO1_NEMVENo assigned EC number0.61730.89490.8235N/Ano
Q5B0Z5PNO1_EMENINo assigned EC number0.58880.89040.7558yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query219
COG1094194 COG1094, COG1094, Predicted RNA-binding protein (c 3e-53
TIGR03665172 TIGR03665, arCOG04150, arCOG04150 universal archae 3e-18
PRK13763180 PRK13763, PRK13763, putative RNA-processing protei 9e-18
pfam0001359 pfam00013, KH_1, KH domain 8e-06
smart0032268 smart00322, KH, K homology RNA-binding domain 2e-05
>gnl|CDD|224019 COG1094, COG1094, Predicted RNA-binding protein (contains KH domains) [General function prediction only] Back     alignment and domain information 
 Score =  169 bits (429), Expect = 3e-53
 Identities = 64/178 (35%), Positives = 93/178 (52%), Gaps = 1/178 (0%)

Query: 41  QFQKVNVPPHRYSPLKKVWMDIYTPIFEQMKIDIRMNLKARRVELKTRADTPDISNLQKC 100
             + V +P  R   L   W ++   I E+  + +R++ K   V ++T   T D   L K 
Sbjct: 8   SSEAVKIPKDRIGVLIGKWGEVKKAIEEKTGVKLRIDSKTGSVTIRTTRKTEDPLALLKA 67

Query: 101 ADFVHAFMLGFDVIDAIALLRLDELYVESFEIKDVKTLRGEHLSRAIGRLSGKGGKTKFA 160
            D V A   GF    A+ LL  D+ Y+E  ++KDV TL G+HL R  GR+ G+ GKT+ A
Sbjct: 68  RDVVKAIGRGFPPEKALKLLE-DDYYLEVIDLKDVVTLSGDHLRRIKGRIIGREGKTRRA 126

Query: 161 IENATKTRIVIADTKIHILGSFANIKIARDSLCSLILGSPAGKVYSKLRAVTARLAER 218
           IE  T   I +    + I+G F  ++IAR+++  LI G+P GKVY  L      L ER
Sbjct: 127 IEELTGVYISVYGKTVAIIGGFEQVEIAREAVEMLINGAPHGKVYKFLERKERELKER 184

Length = 194
>gnl|CDD|211858 TIGR03665, arCOG04150, arCOG04150 universal archaeal KH domain protein Back     alignment and domain information
>gnl|CDD|237494 PRK13763, PRK13763, putative RNA-processing protein; Provisional Back     alignment and domain information
>gnl|CDD|215657 pfam00013, KH_1, KH domain Back     alignment and domain information
>gnl|CDD|197652 smart00322, KH, K homology RNA-binding domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 219
COG1094194 Predicted RNA-binding protein (contains KH domains 100.0
KOG3273252 consensus Predicted RNA-binding protein Pno1p inte 100.0
PRK13763180 putative RNA-processing protein; Provisional 100.0
TIGR03665172 arCOG04150 arCOG04150 universal archaeal KH domain 100.0
KOG2874 356 consensus rRNA processing protein [Translation, ri 100.0
KOG1676 600 consensus K-homology type RNA binding proteins [RN 99.55
TIGR03319 514 YmdA_YtgF conserved hypothetical protein YmdA/YtgF 99.23
KOG2193584 consensus IGF-II mRNA-binding protein IMP, contain 99.22
PRK00106 535 hypothetical protein; Provisional 99.17
KOG1676 600 consensus K-homology type RNA binding proteins [RN 99.17
PRK12704 520 phosphodiesterase; Provisional 99.05
KOG2191 402 consensus RNA-binding protein NOVA1/PASILLA and re 98.82
PRK12705 508 hypothetical protein; Provisional 98.71
cd0239361 PNPase_KH Polynucleotide phosphorylase (PNPase) K 98.61
PF0001360 KH_1: KH domain syndrome, contains KH motifs.; Int 98.57
KOG2193 584 consensus IGF-II mRNA-binding protein IMP, contain 98.55
cd0239462 vigilin_like_KH K homology RNA-binding domain_vigi 98.53
smart0032269 KH K homology RNA-binding domain. 98.48
cd02395120 SF1_like-KH Splicing factor 1 (SF1) K homology RNA 98.43
cd0239361 PNPase_KH Polynucleotide phosphorylase (PNPase) K 98.42
cd0010564 KH-I K homology RNA-binding domain, type I. KH bin 98.39
PRK13763180 putative RNA-processing protein; Provisional 98.27
cd0239665 PCBP_like_KH K homology RNA-binding domain, PCBP_l 98.21
KOG2190 485 consensus PolyC-binding proteins alphaCP-1 and rel 98.09
PF0001360 KH_1: KH domain syndrome, contains KH motifs.; Int 98.0
cd0239462 vigilin_like_KH K homology RNA-binding domain_vigi 97.84
cd0239665 PCBP_like_KH K homology RNA-binding domain, PCBP_l 97.84
TIGR03665172 arCOG04150 arCOG04150 universal archaeal KH domain 97.81
PF1301443 KH_3: KH domain 97.8
cd0010564 KH-I K homology RNA-binding domain, type I. KH bin 97.75
smart0032269 KH K homology RNA-binding domain. 97.42
TIGR02696719 pppGpp_PNP guanosine pentaphosphate synthetase I/p 97.23
cd02395120 SF1_like-KH Splicing factor 1 (SF1) K homology RNA 97.22
PRK08406140 transcription elongation factor NusA-like protein; 97.08
TIGR02696719 pppGpp_PNP guanosine pentaphosphate synthetase I/p 96.96
TIGR03591684 polynuc_phos polyribonucleotide nucleotidyltransfe 96.91
KOG2190 485 consensus PolyC-binding proteins alphaCP-1 and rel 96.81
KOG1588259 consensus RNA-binding protein Sam68 and related KH 96.76
TIGR03591684 polynuc_phos polyribonucleotide nucleotidyltransfe 96.63
KOG0119 554 consensus Splicing factor 1/branch point binding p 96.53
PRK04163235 exosome complex RNA-binding protein Rrp4; Provisio 96.16
COG1185692 Pnp Polyribonucleotide nucleotidyltransferase (pol 95.99
KOG2192 390 consensus PolyC-binding hnRNP-K protein HRB57A/hnR 95.92
PLN00207 891 polyribonucleotide nucleotidyltransferase; Provisi 95.9
TIGR01952141 nusA_arch NusA family KH domain protein, archaeal. 95.75
COG1185692 Pnp Polyribonucleotide nucleotidyltransferase (pol 95.48
PF1301443 KH_3: KH domain 95.33
PRK0282177 hypothetical protein; Provisional 95.18
COG0195190 NusA Transcription elongation factor [Transcriptio 95.06
cd0213461 NusA_KH NusA_K homology RNA-binding domain (KH). N 95.03
PRK11824693 polynucleotide phosphorylase/polyadenylase; Provis 94.75
PLN00207891 polyribonucleotide nucleotidyltransferase; Provisi 94.65
PRK0046875 hypothetical protein; Provisional 94.53
PRK04163235 exosome complex RNA-binding protein Rrp4; Provisio 94.53
PF1308373 KH_4: KH domain; PDB: 3GKU_B. 94.36
COG5176269 MSL5 Splicing factor (branch point binding protein 94.23
PRK0106478 hypothetical protein; Provisional 94.19
KOG2191402 consensus RNA-binding protein NOVA1/PASILLA and re 94.14
PF14611210 SLS: Mitochondrial inner-membrane-bound regulator 93.68
COG1094194 Predicted RNA-binding protein (contains KH domains 93.16
KOG2279 608 consensus Kinase anchor protein AKAP149, contains 92.99
COG183776 Predicted RNA-binding protein (contains KH domain) 92.55
PRK11824693 polynucleotide phosphorylase/polyadenylase; Provis 92.08
cd0240968 KH-II KH-II (K homology RNA-binding domain, type I 91.63
cd0241477 jag_KH jag_K homology RNA-binding domain. The KH d 91.47
KOG2814 345 consensus Transcription coactivator complex, P50 c 91.06
COG1097239 RRP4 RNA-binding protein Rrp4 and related proteins 90.39
KOG0336 629 consensus ATP-dependent RNA helicase [RNA processi 89.4
KOG2192390 consensus PolyC-binding hnRNP-K protein HRB57A/hnR 87.25
COG1702 348 PhoH Phosphate starvation-inducible protein PhoH, 86.02
cd0213461 NusA_KH NusA_K homology RNA-binding domain (KH). N 84.43
COG5176269 MSL5 Splicing factor (branch point binding protein 83.26
COG1159298 Era GTPase [General function prediction only] 81.77
COG1847208 Jag Predicted RNA-binding protein [General functio 80.66
>COG1094 Predicted RNA-binding protein (contains KH domains) [General function prediction only] Back     alignment and domain information 
Probab=100.00  E-value=3e-60  Score=402.07  Aligned_cols=179  Identities=36%  Similarity=0.551  Sum_probs=175.2

Q ss_pred             ceeEEEEeeCCCccccchhcCccchhHHHhhcccEEEEEcCCceEEEEeCCCCCCHHHHHHHHHHHHHHHcCCChHHHHH
Q 027782           39 RVQFQKVNVPPHRYSPLKKVWMDIYTPIFEQMKIDIRMNLKARRVELKTRADTPDISNLQKCADFVHAFMLGFDVIDAIA  118 (219)
Q Consensus        39 ~~~~~~I~IP~~Rv~~lig~wg~i~k~i~e~~~~~i~id~~~~~V~I~~~~~t~dp~~i~KA~d~I~Ai~rGF~~e~A~~  118 (219)
                      ..+++.++||++|+++|+|.||+++++|+++++++++||+++++|+|+|+..|.||++++||+|+|+||+|||+||+|++
T Consensus         6 ~~~~~~v~iPk~R~~~lig~~g~v~k~ie~~~~~~~~iD~~~~~V~i~~~~~t~Dp~~~~ka~d~VkAIgrGF~pe~A~~   85 (194)
T COG1094           6 EKSSEAVKIPKDRIGVLIGKWGEVKKAIEEKTGVKLRIDSKTGSVTIRTTRKTEDPLALLKARDVVKAIGRGFPPEKALK   85 (194)
T ss_pred             ccceeeeecCchhheeeecccccchHHHHhhcCeEEEEECCCCeEEEEecCCCCChHHHHHHHHHHHHHhcCCCHHHHHH
Confidence            46678899999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhcCcceeeeEEecccccccchhhhhhhcceecCCCchHHHHHHhhCceEEEcCceEEEeeCCchHHHHHHHHHHHHcC
Q 027782          119 LLRLDELYVESFEIKDVKTLRGEHLSRAIGRLSGKGGKTKFAIENATKTRIVIADTKIHILGSFANIKIARDSLCSLILG  198 (219)
Q Consensus       119 Ll~~Dd~~~e~i~I~dv~~~~~~~~~R~~gRIIGk~G~t~~~IE~~Tg~~I~V~~~tV~IiG~~~~i~~Ar~aI~~Li~g  198 (219)
                      ||+ ||++|++|+|.|++.++++||+|++|||||++|+|+++||++|||+|+|+|+||||||.|+++++||+||+|||+|
T Consensus        86 LL~-d~~~levIdi~~~~~~~~~~l~R~kgRIIG~~GkTr~~IE~lt~~~I~V~g~tVaiiG~~~~v~iAr~AVemli~G  164 (194)
T COG1094          86 LLE-DDYYLEVIDLKDVVTLSGDHLRRIKGRIIGREGKTRRAIEELTGVYISVYGKTVAIIGGFEQVEIAREAVEMLING  164 (194)
T ss_pred             Hhc-CCcEEEEEEHHHhccCchhhhhHhhceeeCCCchHHHHHHHHhCCeEEEeCcEEEEecChhhhHHHHHHHHHHHcC
Confidence            999 8999999999999988889999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCChhhhHHHHHHHHHHhhc
Q 027782          199 SPAGKVYSKLRAVTARLAER  218 (219)
Q Consensus       199 ~~~~~VY~~l~~~~~~~~~~  218 (219)
                      ++|++||+||++.++++|+|
T Consensus       165 ~~h~~Vy~fLer~~~~lk~~  184 (194)
T COG1094         165 APHGKVYKFLERKERELKER  184 (194)
T ss_pred             CCchhHHHHHHHHHHHHHHH
Confidence            99999999999999999987

>KOG3273 consensus Predicted RNA-binding protein Pno1p interacting with Nob1p and involved in 26S proteasome assembly [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13763 putative RNA-processing protein; Provisional Back     alignment and domain information
>TIGR03665 arCOG04150 arCOG04150 universal archaeal KH domain protein Back     alignment and domain information
>KOG2874 consensus rRNA processing protein [Translation, ribosomal structure and biogenesis; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1676 consensus K-homology type RNA binding proteins [RNA processing and modification] Back     alignment and domain information
>TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF Back     alignment and domain information
>KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>PRK00106 hypothetical protein; Provisional Back     alignment and domain information
>KOG1676 consensus K-homology type RNA binding proteins [RNA processing and modification] Back     alignment and domain information
>PRK12704 phosphodiesterase; Provisional Back     alignment and domain information
>KOG2191 consensus RNA-binding protein NOVA1/PASILLA and related KH domain proteins [RNA processing and modification; General function prediction only] Back     alignment and domain information
>PRK12705 hypothetical protein; Provisional Back     alignment and domain information
>cd02393 PNPase_KH Polynucleotide phosphorylase (PNPase) K homology RNA-binding domain (KH) Back     alignment and domain information
>PF00013 KH_1: KH domain syndrome, contains KH motifs Back     alignment and domain information
>KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>cd02394 vigilin_like_KH K homology RNA-binding domain_vigilin_like Back     alignment and domain information
>smart00322 KH K homology RNA-binding domain Back     alignment and domain information
>cd02395 SF1_like-KH Splicing factor 1 (SF1) K homology RNA-binding domain (KH) Back     alignment and domain information
>cd02393 PNPase_KH Polynucleotide phosphorylase (PNPase) K homology RNA-binding domain (KH) Back     alignment and domain information
>cd00105 KH-I K homology RNA-binding domain, type I Back     alignment and domain information
>PRK13763 putative RNA-processing protein; Provisional Back     alignment and domain information
>cd02396 PCBP_like_KH K homology RNA-binding domain, PCBP_like Back     alignment and domain information
>KOG2190 consensus PolyC-binding proteins alphaCP-1 and related KH domain proteins [RNA processing and modification; General function prediction only] Back     alignment and domain information
>PF00013 KH_1: KH domain syndrome, contains KH motifs Back     alignment and domain information
>cd02394 vigilin_like_KH K homology RNA-binding domain_vigilin_like Back     alignment and domain information
>cd02396 PCBP_like_KH K homology RNA-binding domain, PCBP_like Back     alignment and domain information
>TIGR03665 arCOG04150 arCOG04150 universal archaeal KH domain protein Back     alignment and domain information
>PF13014 KH_3: KH domain Back     alignment and domain information
>cd00105 KH-I K homology RNA-binding domain, type I Back     alignment and domain information
>smart00322 KH K homology RNA-binding domain Back     alignment and domain information
>TIGR02696 pppGpp_PNP guanosine pentaphosphate synthetase I/polynucleotide phosphorylase Back     alignment and domain information
>cd02395 SF1_like-KH Splicing factor 1 (SF1) K homology RNA-binding domain (KH) Back     alignment and domain information
>PRK08406 transcription elongation factor NusA-like protein; Validated Back     alignment and domain information
>TIGR02696 pppGpp_PNP guanosine pentaphosphate synthetase I/polynucleotide phosphorylase Back     alignment and domain information
>TIGR03591 polynuc_phos polyribonucleotide nucleotidyltransferase Back     alignment and domain information
>KOG2190 consensus PolyC-binding proteins alphaCP-1 and related KH domain proteins [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG1588 consensus RNA-binding protein Sam68 and related KH domain proteins [RNA processing and modification] Back     alignment and domain information
>TIGR03591 polynuc_phos polyribonucleotide nucleotidyltransferase Back     alignment and domain information
>KOG0119 consensus Splicing factor 1/branch point binding protein (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PRK04163 exosome complex RNA-binding protein Rrp4; Provisional Back     alignment and domain information
>COG1185 Pnp Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2192 consensus PolyC-binding hnRNP-K protein HRB57A/hnRNP, contains KH domain [RNA processing and modification; General function prediction only] Back     alignment and domain information
>PLN00207 polyribonucleotide nucleotidyltransferase; Provisional Back     alignment and domain information
>TIGR01952 nusA_arch NusA family KH domain protein, archaeal Back     alignment and domain information
>COG1185 Pnp Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF13014 KH_3: KH domain Back     alignment and domain information
>PRK02821 hypothetical protein; Provisional Back     alignment and domain information
>COG0195 NusA Transcription elongation factor [Transcription] Back     alignment and domain information
>cd02134 NusA_KH NusA_K homology RNA-binding domain (KH) Back     alignment and domain information
>PRK11824 polynucleotide phosphorylase/polyadenylase; Provisional Back     alignment and domain information
>PLN00207 polyribonucleotide nucleotidyltransferase; Provisional Back     alignment and domain information
>PRK00468 hypothetical protein; Provisional Back     alignment and domain information
>PRK04163 exosome complex RNA-binding protein Rrp4; Provisional Back     alignment and domain information
>PF13083 KH_4: KH domain; PDB: 3GKU_B Back     alignment and domain information
>COG5176 MSL5 Splicing factor (branch point binding protein) [RNA processing and modification] Back     alignment and domain information
>PRK01064 hypothetical protein; Provisional Back     alignment and domain information
>KOG2191 consensus RNA-binding protein NOVA1/PASILLA and related KH domain proteins [RNA processing and modification; General function prediction only] Back     alignment and domain information
>PF14611 SLS: Mitochondrial inner-membrane-bound regulator Back     alignment and domain information
>COG1094 Predicted RNA-binding protein (contains KH domains) [General function prediction only] Back     alignment and domain information
>KOG2279 consensus Kinase anchor protein AKAP149, contains KH and Tudor RNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>COG1837 Predicted RNA-binding protein (contains KH domain) [General function prediction only] Back     alignment and domain information
>PRK11824 polynucleotide phosphorylase/polyadenylase; Provisional Back     alignment and domain information
>cd02409 KH-II KH-II (K homology RNA-binding domain, type II) Back     alignment and domain information
>cd02414 jag_KH jag_K homology RNA-binding domain Back     alignment and domain information
>KOG2814 consensus Transcription coactivator complex, P50 component (LigT RNA ligase/phosphodiesterase family) [Transcription] Back     alignment and domain information
>COG1097 RRP4 RNA-binding protein Rrp4 and related proteins (contain S1 domain and KH domain) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG2192 consensus PolyC-binding hnRNP-K protein HRB57A/hnRNP, contains KH domain [RNA processing and modification; General function prediction only] Back     alignment and domain information
>COG1702 PhoH Phosphate starvation-inducible protein PhoH, predicted ATPase [Signal transduction mechanisms] Back     alignment and domain information
>cd02134 NusA_KH NusA_K homology RNA-binding domain (KH) Back     alignment and domain information
>COG5176 MSL5 Splicing factor (branch point binding protein) [RNA processing and modification] Back     alignment and domain information
>COG1159 Era GTPase [General function prediction only] Back     alignment and domain information
>COG1847 Jag Predicted RNA-binding protein [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query219
1tua_A191 1.5 A Crystal Structure Of A Protein Of Unknown Fun 4e-09
2e3u_A219 Crystal Structure Analysis Of Dim2p From Pyrococcus 6e-07
>pdb|1TUA|A Chain A, 1.5 A Crystal Structure Of A Protein Of Unknown Function Ape0754 From Aeropyrum Pernix Length = 191 Back     alignment and structure 
Iteration: 1

 Score = 58.2 bits (139), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 61/126 (48%), Gaps = 7/126 (5%)
Query: 96  NLQKCADFVHAFMLGFDVIDAIALLRLDELYVESFEIKDVKTLRGE---HLSRAIGRLSG 152
           NL K A+ V A  LGF    A  LL  D++ V    + D+K + G+   HL R  GR+ G
Sbjct: 59  NLMKAAEVVKAISLGFPPEKAFRLLEEDQILV----VVDLKQVVGDSQNHLKRIKGRIIG 114
Query: 153 KGGKTKFAIENATKTRIVIADTKIHILGSFANIKIARDSLCSLILGSPAGKVYSKLRAVT 212
           +GG+ +  IE  T T I + + ++ I+G +     A+ ++  L  G     VY  L  + 
Sbjct: 115 EGGRARRTIEEMTDTYINVGEYEVAIIGDYERAMAAKQAIEMLAEGRMHSTVYRHLERIM 174
Query: 213 ARLAER 218
             +  R
Sbjct: 175 REIKRR 180
>pdb|2E3U|A Chain A, Crystal Structure Analysis Of Dim2p From Pyrococcus Horikoshii Ot3 Length = 219 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query219
1tua_A191 Hypothetical protein APE0754; structural genomics, 1e-53
2e3u_A219 PH-DIM2P, hypothetical protein PH1566; PRE-ribosom 1e-50
2cte_A94 Vigilin; K homology type I domain, RNA-binding, ce 4e-04
1x4m_A94 FAR upstream element binding protein 1; KH domain, 6e-04
3krm_A163 Insulin-like growth factor 2 mRNA-binding protein 7e-04
>1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 Length = 191 Back     alignment and structure
 Score =  169 bits (430), Expect = 1e-53
 Identities = 45/181 (24%), Positives = 75/181 (41%), Gaps = 1/181 (0%)

Query: 38  GRVQFQKVNVPPHRYSPLKKVWMDIYTPIFEQMKIDIRMNLKARRVELKTRADTPDISNL 97
                  V V P R   +     ++   I  +    I ++ +   V ++  A+     NL
Sbjct: 1   AMKPRIYVKVKPERLGAVIGPRGEVKAEIMRRTGTVITVDTENSMVIVEPEAEGIPPVNL 60

Query: 98  QKCADFVHAFMLGFDVIDAIALLRLDELYVESFEIKDVKTLRGEHLSRAIGRLSGKGGKT 157
            K A+ V A  LGF    A  LL  D++     ++K V      HL R  GR+ G+GG+ 
Sbjct: 61  MKAAEVVKAISLGFPPEKAFRLLEEDQIL-VVVDLKQVVGDSQNHLKRIKGRIIGEGGRA 119

Query: 158 KFAIENATKTRIVIADTKIHILGSFANIKIARDSLCSLILGSPAGKVYSKLRAVTARLAE 217
           +  IE  T T I + + ++ I+G +     A+ ++  L  G     VY  L  +   +  
Sbjct: 120 RRTIEEMTDTYINVGEYEVAIIGDYERAMAAKQAIEMLAEGRMHSTVYRHLERIMREIKR 179

Query: 218 R 218
           R
Sbjct: 180 R 180
>2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B Length = 219 Back     alignment and structure
>2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 94 Back     alignment and structure
>1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Length = 94 Back     alignment and structure
>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query219
1tua_A191 Hypothetical protein APE0754; structural genomics, 100.0
2e3u_A219 PH-DIM2P, hypothetical protein PH1566; PRE-ribosom 100.0
2jvz_A164 KH type-splicing, FAR upstream element-binding pro 99.72
2anr_A178 Neuro-oncological ventral antigen 1; protein-RNA c 99.66
3krm_A163 Insulin-like growth factor 2 mRNA-binding protein 99.65
1j4w_A174 FUSE binding protein; single-stranded DNA binding 99.65
2jzx_A160 Poly(RC)-binding protein 2; PCBP2, KH domains, RNA 99.59
2qnd_A144 FMR1 protein; KH domain, eukaryotic KH domains, ta 99.32
1dtj_A76 RNA-binding neurooncological ventral antigen 2; KH 98.85
1ec6_A87 RNA-binding protein NOVA-2; KH domain, alpha-beta 98.8
2opv_A85 KHSRP protein; KH domain, RNA binding protein, KSR 98.8
1x4n_A92 FAR upstream element binding protein 1; KH domain, 98.79
2p2r_A76 Poly(RC)-binding protein 2; protein-DNA complex, R 98.79
2ctm_A95 Vigilin; K homology type I domain, RNA-binding, ce 98.77
1zzk_A82 Heterogeneous nuclear ribonucleoprotein K; KH domi 98.75
1x4m_A94 FAR upstream element binding protein 1; KH domain, 98.75
2hh2_A107 KH-type splicing regulatory protein; KH-RNA bindin 98.71
2ctk_A104 Vigilin; K homology type I domain, RNA-binding, ce 98.7
1j5k_A89 Heterogeneous nuclear ribonucleoprotein K; single- 98.69
2dgr_A83 Ring finger and KH domain-containing protein 1; st 98.67
1wvn_A82 Poly(RC)-binding protein 1; KH domain, RNA binding 98.67
1we8_A104 Tudor and KH domain containing protein; structural 98.67
1vig_A71 Vigilin; RNA-binding protein, ribonucleoprotein; N 98.67
2hh3_A106 KH-type splicing regulatory protein; KH-RNA bindin 98.63
2axy_A73 Poly(RC)-binding protein 2; protein-DNA complex, D 98.63
3n89_A376 Defective in GERM LINE development protein 3, ISO; 98.61
2ctl_A97 Vigilin; K homology type I domain, RNA-binding, ce 98.58
2cte_A94 Vigilin; K homology type I domain, RNA-binding, ce 98.57
2opv_A85 KHSRP protein; KH domain, RNA binding protein, KSR 98.54
1dtj_A76 RNA-binding neurooncological ventral antigen 2; KH 98.53
1wvn_A82 Poly(RC)-binding protein 1; KH domain, RNA binding 98.43
2yqr_A119 KIAA0907 protein; structure genomics, KH domain, s 98.4
2p2r_A76 Poly(RC)-binding protein 2; protein-DNA complex, R 98.38
1we8_A104 Tudor and KH domain containing protein; structural 98.37
2cte_A94 Vigilin; K homology type I domain, RNA-binding, ce 98.36
1x4m_A94 FAR upstream element binding protein 1; KH domain, 98.33
1zzk_A82 Heterogeneous nuclear ribonucleoprotein K; KH domi 98.33
1ec6_A87 RNA-binding protein NOVA-2; KH domain, alpha-beta 98.32
1k1g_A131 SF1-BO isoform; splicing, branch point sequence, p 98.32
1x4n_A92 FAR upstream element binding protein 1; KH domain, 98.3
2hh2_A107 KH-type splicing regulatory protein; KH-RNA bindin 98.29
1j5k_A89 Heterogeneous nuclear ribonucleoprotein K; single- 98.27
2dgr_A83 Ring finger and KH domain-containing protein 1; st 98.27
1vig_A71 Vigilin; RNA-binding protein, ribonucleoprotein; N 98.24
2hh3_A106 KH-type splicing regulatory protein; KH-RNA bindin 98.23
2ctj_A95 Vigilin; K homology type I domain, RNA-binding, ce 98.19
2jvz_A164 KH type-splicing, FAR upstream element-binding pro 98.18
2anr_A178 Neuro-oncological ventral antigen 1; protein-RNA c 98.17
2jzx_A160 Poly(RC)-binding protein 2; PCBP2, KH domains, RNA 98.13
2cpq_A91 FragIle X mental retardation syndrome related prot 98.13
2axy_A73 Poly(RC)-binding protein 2; protein-DNA complex, D 98.13
2ctk_A104 Vigilin; K homology type I domain, RNA-binding, ce 98.08
2bl5_A140 MGC83862 protein, quaking protein; STAR proteins, 98.05
3krm_A163 Insulin-like growth factor 2 mRNA-binding protein 98.04
2ctl_A97 Vigilin; K homology type I domain, RNA-binding, ce 98.03
2ctm_A95 Vigilin; K homology type I domain, RNA-binding, ce 98.01
2cpq_A91 FragIle X mental retardation syndrome related prot 97.96
1j4w_A174 FUSE binding protein; single-stranded DNA binding 97.84
2ctf_A102 Vigilin; K homology type I domain, RNA-binding, ce 97.75
2ctj_A95 Vigilin; K homology type I domain, RNA-binding, ce 97.66
3u1k_A630 Polyribonucleotide nucleotidyltransferase 1, MITO; 97.57
1k1g_A131 SF1-BO isoform; splicing, branch point sequence, p 97.48
2yqr_A119 KIAA0907 protein; structure genomics, KH domain, s 97.36
2e3u_A219 PH-DIM2P, hypothetical protein PH1566; PRE-ribosom 97.3
2ctf_A102 Vigilin; K homology type I domain, RNA-binding, ce 97.24
3n89_A 376 Defective in GERM LINE development protein 3, ISO; 97.22
3u1k_A630 Polyribonucleotide nucleotidyltransferase 1, MITO; 97.14
2qnd_A144 FMR1 protein; KH domain, eukaryotic KH domains, ta 96.93
1tua_A191 Hypothetical protein APE0754; structural genomics, 96.56
3v69_A140 Protein filia; RNA-binding, embryogenesis, KH doma 96.44
4aid_A726 Polyribonucleotide nucleotidyltransferase; transfe 96.26
2bl5_A140 MGC83862 protein, quaking protein; STAR proteins, 96.25
4aid_A726 Polyribonucleotide nucleotidyltransferase; transfe 96.02
2cxc_A144 NUSA; transcription termination, RNA binding prote 95.12
3v69_A140 Protein filia; RNA-binding, embryogenesis, KH doma 91.32
1e3p_A757 Guanosine pentaphosphate synthetase; polyribonucle 88.25
3cdi_A723 Polynucleotide phosphorylase; mRNA turnover, RNAse 88.09
3cdi_A723 Polynucleotide phosphorylase; mRNA turnover, RNAse 84.9
1e3p_A757 Guanosine pentaphosphate synthetase; polyribonucle 80.2
>1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 Back     alignment and structure
Probab=100.00  E-value=7.4e-55  Score=369.53  Aligned_cols=175  Identities=25%  Similarity=0.374  Sum_probs=170.8

Q ss_pred             EEEeeCCCccccchhcCccchhHHHhhcccEEEEEcCCceEEEEeCCCCCCHHHHHHHHHHHHHHHcCCChHHHHHhhhc
Q 027782           43 QKVNVPPHRYSPLKKVWMDIYTPIFEQMKIDIRMNLKARRVELKTRADTPDISNLQKCADFVHAFMLGFDVIDAIALLRL  122 (219)
Q Consensus        43 ~~I~IP~~Rv~~lig~wg~i~k~i~e~~~~~i~id~~~~~V~I~~~~~t~dp~~i~KA~d~I~Ai~rGF~~e~A~~Ll~~  122 (219)
                      .+++||++|+|+|||+||+++++|++++|++++||+.+++|+|+|+..|+||++++||+|||+||++||++++|++||+ 
T Consensus         6 ~~i~VP~~rvg~liGk~g~~~k~i~e~~g~~i~id~~~~~V~i~t~~~t~dp~~i~KA~dlI~ai~rgf~~e~A~~Ll~-   84 (191)
T 1tua_A            6 IYVKVKPERLGAVIGPRGEVKAEIMRRTGTVITVDTENSMVIVEPEAEGIPPVNLMKAAEVVKAISLGFPPEKAFRLLE-   84 (191)
T ss_dssp             EEEECCGGGHHHHHCGGGHHHHHHHHHHTEEEEEETTTTEEEEEESSTTSCHHHHHHHHHHHHHHHHTCCHHHHGGGGS-
T ss_pred             eEEECCHHHhhHHHhcCHhHHHHHHHHHCcEEEEEcCCCeEEEEeCCCCCCHHHHHHHHHHHHHHHcCCCHHHhhhccc-
Confidence            5899999999999999999999999999999999999999999999999999999999999999999999999999999 


Q ss_pred             CcceeeeEEecccccccchhhhhhhcceecCCCchHHHHHHhhCceEEEcCceEEEeeCCchHHHHHHHHHHHHcCCCCh
Q 027782          123 DELYVESFEIKDVKTLRGEHLSRAIGRLSGKGGKTKFAIENATKTRIVIADTKIHILGSFANIKIARDSLCSLILGSPAG  202 (219)
Q Consensus       123 Dd~~~e~i~I~dv~~~~~~~~~R~~gRIIGk~G~t~~~IE~~Tg~~I~V~~~tV~IiG~~~~i~~Ar~aI~~Li~g~~~~  202 (219)
                      ||+|+++|+|.+++.++++||+|++|||||++|+|+++||++|||+|+|+|++|+|+|+|+++++||++|++||.|++|+
T Consensus        85 Dd~~~e~i~i~~~~~~~~~~~~r~~GrIIGk~G~tik~iE~~Tg~~I~v~~~~v~i~G~~~~i~~Ar~~i~~li~g~~h~  164 (191)
T 1tua_A           85 EDQILVVVDLKQVVGDSQNHLKRIKGRIIGEGGRARRTIEEMTDTYINVGEYEVAIIGDYERAMAAKQAIEMLAEGRMHS  164 (191)
T ss_dssp             TTEEEEEEETHHHHTTCHHHHHHHHHHHHCGGGHHHHHHHHHHTCEEEECSSEEEEEEEHHHHHHHHHHHHHHHTTCCHH
T ss_pred             CcceeEEEEcccccccCchhHHHHhhheeCCCccHHHHHHHHHCceEEEcCCEEEEEeChHHHHHHHHHHHHHHcCCCch
Confidence            99999999999996568899999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhHHHHHHHHHHhhc
Q 027782          203 KVYSKLRAVTARLAER  218 (219)
Q Consensus       203 ~VY~~l~~~~~~~~~~  218 (219)
                      +||++|+++++++|.+
T Consensus       165 ~vy~~~~~~~~~~k~~  180 (191)
T 1tua_A          165 TVYRHLERIMREIKRR  180 (191)
T ss_dssp             HHHHHHHHHHHHHHHH
T ss_pred             hHHHHHHHHHHHHHHH
Confidence            9999999999999874
>2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B Back     alignment and structure
>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Back     alignment and structure
>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Back     alignment and structure
>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Back     alignment and structure
>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Back     alignment and structure
>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Back     alignment and structure
>1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Back     alignment and structure
>1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Back     alignment and structure
>1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Back     alignment and structure
>2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Back     alignment and structure
>2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Back     alignment and structure
>1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Back     alignment and structure
>2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Back     alignment and structure
>2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Back     alignment and structure
>1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A Back     alignment and structure
>2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Back     alignment and structure
>3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans} Back     alignment and structure
>2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Back     alignment and structure
>1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Back     alignment and structure
>1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2yqr_A KIAA0907 protein; structure genomics, KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Back     alignment and structure
>1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Back     alignment and structure
>2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Back     alignment and structure
>1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Back     alignment and structure
>1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>1k1g_A SF1-BO isoform; splicing, branch point sequence, protein/RNA recognition, complex E, KH domain, QUA2 homology; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Back     alignment and structure
>2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Back     alignment and structure
>2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A Back     alignment and structure
>2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ctj_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Back     alignment and structure
>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Back     alignment and structure
>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2cpq_A FragIle X mental retardation syndrome related protein 1, isoform B'; KH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Back     alignment and structure
>2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2bl5_A MGC83862 protein, quaking protein; STAR proteins, GSG proteins, RNA binding; NMR {Xenopus laevis} SCOP: d.51.1.1 Back     alignment and structure
>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Back     alignment and structure
>2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2cpq_A FragIle X mental retardation syndrome related protein 1, isoform B'; KH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Back     alignment and structure
>2ctf_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2ctj_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>3u1k_A Polyribonucleotide nucleotidyltransferase 1, MITO; RNAse PH, KH domain, exoribonuclease; HET: CIT; 2.13A {Homo sapiens} Back     alignment and structure
>1k1g_A SF1-BO isoform; splicing, branch point sequence, protein/RNA recognition, complex E, KH domain, QUA2 homology; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2yqr_A KIAA0907 protein; structure genomics, KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B Back     alignment and structure
>2ctf_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans} Back     alignment and structure
>3u1k_A Polyribonucleotide nucleotidyltransferase 1, MITO; RNAse PH, KH domain, exoribonuclease; HET: CIT; 2.13A {Homo sapiens} Back     alignment and structure
>2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Back     alignment and structure
>1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 Back     alignment and structure
>3v69_A Protein filia; RNA-binding, embryogenesis, KH domain, RNA binding, P binding; 2.20A {Mus musculus} Back     alignment and structure
>4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A Back     alignment and structure
>2bl5_A MGC83862 protein, quaking protein; STAR proteins, GSG proteins, RNA binding; NMR {Xenopus laevis} SCOP: d.51.1.1 Back     alignment and structure
>4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A Back     alignment and structure
>2cxc_A NUSA; transcription termination, RNA binding protein, archaeal NUS domain, structural genomics, NPPSFA; 2.00A {Aeropyrum pernix} PDB: 2cy1_A Back     alignment and structure
>3v69_A Protein filia; RNA-binding, embryogenesis, KH domain, RNA binding, P binding; 2.20A {Mus musculus} Back     alignment and structure
>1e3p_A Guanosine pentaphosphate synthetase; polyribonucleotide transferase, ATP-GTP diphosphotransferase RNA processing, RNA degradation; 2.5A {Streptomyces antibioticus} SCOP: a.4.9.1 b.40.4.5 d.14.1.4 d.14.1.4 d.52.3.1 d.101.1.1 d.101.1.1 PDB: 1e3h_A Back     alignment and structure
>3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A Back     alignment and structure
>3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A Back     alignment and structure
>1e3p_A Guanosine pentaphosphate synthetase; polyribonucleotide transferase, ATP-GTP diphosphotransferase RNA processing, RNA degradation; 2.5A {Streptomyces antibioticus} SCOP: a.4.9.1 b.40.4.5 d.14.1.4 d.14.1.4 d.52.3.1 d.101.1.1 d.101.1.1 PDB: 1e3h_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 219
d1tuaa2104 d.51.1.1 (A:85-188) Hypothetical protein APE0754 { 6e-29
d1x4na179 d.51.1.1 (A:8-86) Far upstream binding element, FB 0.002
d2axya171 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Hum 0.004
>d1tuaa2 d.51.1.1 (A:85-188) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Length = 104 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Eukaryotic type KH-domain (KH-domain type I)
superfamily: Eukaryotic type KH-domain (KH-domain type I)
family: Eukaryotic type KH-domain (KH-domain type I)
domain: Hypothetical protein APE0754
species: Aeropyrum pernix [TaxId: 56636]

 Score =  102 bits (256), Expect = 6e-29
 Identities = 24/95 (25%), Positives = 43/95 (45%)

Query: 124 ELYVESFEIKDVKTLRGEHLSRAIGRLSGKGGKTKFAIENATKTRIVIADTKIHILGSFA 183
           +  +   ++K V      HL R  GR+ G+GG+ +  IE  T T I + + ++ I+G + 
Sbjct: 1   DQILVVVDLKQVVGDSQNHLKRIKGRIIGEGGRARRTIEEMTDTYINVGEYEVAIIGDYE 60

Query: 184 NIKIARDSLCSLILGSPAGKVYSKLRAVTARLAER 218
               A+ ++  L  G     VY  L  +   +  R
Sbjct: 61  RAMAAKQAIEMLAEGRMHSTVYRHLERIMREIKRR 95
>d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 Back     information, alignment and structure
>d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query219
d1tuaa2104 Hypothetical protein APE0754 {Aeropyrum pernix [Ta 99.94
d1tuaa184 Hypothetical protein APE0754 {Aeropyrum pernix [Ta 99.71
d2ba0a384 Exosome complex RNA-binding protein 1, ECR1 {Archa 98.98
d2z0sa287 Exosome complex RNA-binding protein 1, ECR1 {Aerop 98.74
d1j4wa271 Far upstream binding element, FBP {Human (Homo sap 98.69
d2ctma181 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 98.69
d1j4wa174 Far upstream binding element, FBP {Human (Homo sap 98.67
d1dtja_74 Neuro-oncological ventral antigen 2, nova-2, KH3 { 98.65
d1zzka175 HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} 98.64
d1viga_71 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 98.61
d1x4ma181 Far upstream binding element, FBP {Mouse (Mus musc 98.6
d1wvna170 Poly(RC)-binding protein 1 {Human (Homo sapiens) [ 98.58
d2ctla184 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 98.57
d1x4na179 Far upstream binding element, FBP {Mouse (Mus musc 98.56
d2axya171 Poly(RC)-binding protein 2 {Human (Homo sapiens) [ 98.55
d2je6i369 Exosome complex RNA-binding protein 1, ECR1 {Sulfo 98.5
d2ctea181 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 98.49
d1we8a_104 Tudor and KH domain containing protein, Tdrkh {Mou 98.44
d1tuaa184 Hypothetical protein APE0754 {Aeropyrum pernix [Ta 98.43
d2ctka191 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 98.4
d1zzka175 HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} 98.38
d2cpqa178 Fragile X mental retardation syndrome related prot 98.38
d2cpqa178 Fragile X mental retardation syndrome related prot 98.35
d1j4wa271 Far upstream binding element, FBP {Human (Homo sap 98.29
d2ctja182 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 98.29
d1j4wa174 Far upstream binding element, FBP {Human (Homo sap 98.27
d2ctfa190 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 98.27
d2z0sa287 Exosome complex RNA-binding protein 1, ECR1 {Aerop 98.25
d2je6i369 Exosome complex RNA-binding protein 1, ECR1 {Sulfo 98.23
d1wvna170 Poly(RC)-binding protein 1 {Human (Homo sapiens) [ 98.22
d1dtja_74 Neuro-oncological ventral antigen 2, nova-2, KH3 { 98.2
d2ba0a384 Exosome complex RNA-binding protein 1, ECR1 {Archa 98.2
d1viga_71 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 98.19
d1x4ma181 Far upstream binding element, FBP {Mouse (Mus musc 98.06
d2ctma181 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 98.01
d1x4na179 Far upstream binding element, FBP {Mouse (Mus musc 97.98
d2axya171 Poly(RC)-binding protein 2 {Human (Homo sapiens) [ 97.95
d1we8a_104 Tudor and KH domain containing protein, Tdrkh {Mou 97.93
d1k1ga_122 RNA splicing factor 1 {Human (Homo sapiens) [TaxId 97.9
d2ctka191 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 97.88
d2ctla184 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 97.85
d2ctfa190 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 97.85
d2ctea181 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 97.84
d2ctja182 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 97.69
d1e3ha454 Polynucleotide phosphorylase/guanosine pentaphosph 97.64
d2bl5a1134 Quaking protein A (Xqua) {African clawed frog (Xen 97.62
d1e3ha454 Polynucleotide phosphorylase/guanosine pentaphosph 97.44
d1tuaa2104 Hypothetical protein APE0754 {Aeropyrum pernix [Ta 96.95
d1k1ga_122 RNA splicing factor 1 {Human (Homo sapiens) [TaxId 95.34
d2ja9a285 Ribosomal RNA-processing protein 40, RRP40 {Saccha 88.77
d2asba367 Transcription factor NusA, C-terminal domains {Myc 87.55
d1hh2p368 Transcription factor NusA, C-terminal domains {The 86.44
d2bl5a1134 Quaking protein A (Xqua) {African clawed frog (Xen 82.66
>d1tuaa2 d.51.1.1 (A:85-188) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Eukaryotic type KH-domain (KH-domain type I)
superfamily: Eukaryotic type KH-domain (KH-domain type I)
family: Eukaryotic type KH-domain (KH-domain type I)
domain: Hypothetical protein APE0754
species: Aeropyrum pernix [TaxId: 56636]

Probab=99.94  E-value=5.8e-28  Score=185.01  Aligned_cols=95  Identities=25%  Similarity=0.444  Sum_probs=90.5

Q ss_pred             cceeeeEEecccccccchhhhhhhcceecCCCchHHHHHHhhCceEEEcCceEEEeeCCchHHHHHHHHHHHHcCCCChh
Q 027782          124 ELYVESFEIKDVKTLRGEHLSRAIGRLSGKGGKTKFAIENATKTRIVIADTKIHILGSFANIKIARDSLCSLILGSPAGK  203 (219)
Q Consensus       124 d~~~e~i~I~dv~~~~~~~~~R~~gRIIGk~G~t~~~IE~~Tg~~I~V~~~tV~IiG~~~~i~~Ar~aI~~Li~g~~~~~  203 (219)
                      |+++++|||.|+...+++++.|.+|||||++|+|++.||++|||+|.|+|++|+++|++++++.|+++|++|+.|.+||+
T Consensus         1 d~~l~iidi~~~~~~~~~~l~R~~GrIIG~gGktik~Ie~~Tg~~I~I~d~~v~iig~~e~i~~A~~~Ie~li~~~e~g~   80 (104)
T d1tuaa2           1 DQILVVVDLKQVVGDSQNHLKRIKGRIIGEGGRARRTIEEMTDTYINVGEYEVAIIGDYERAMAAKQAIEMLAEGRMHST   80 (104)
T ss_dssp             TEEEEEEETHHHHTTCHHHHHHHHHHHHCGGGHHHHHHHHHHTCEEEECSSEEEEEEEHHHHHHHHHHHHHHHTTCCHHH
T ss_pred             CceEEEEEHHHhhcccHHHHHHHhcceeCCCcHHHHHHHHHHCCeEEEeCCeEEEEECchhHHHHHHHHHHHHcCCCccH
Confidence            67889999999887678999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhHHHHHHHHHHhhc
Q 027782          204 VYSKLRAVTARLAER  218 (219)
Q Consensus       204 VY~~l~~~~~~~~~~  218 (219)
                      ||++|++.+++++++
T Consensus        81 VY~~le~~~~elk~~   95 (104)
T d1tuaa2          81 VYRHLERIMREIKRR   95 (104)
T ss_dssp             HHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHH
Confidence            999999999998864
>d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctfa1 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k1ga_ d.51.1.1 (A:) RNA splicing factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctfa1 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} Back     information, alignment and structure
>d2bl5a1 d.51.1.1 (A:1-134) Quaking protein A (Xqua) {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} Back     information, alignment and structure
>d1tuaa2 d.51.1.1 (A:85-188) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1k1ga_ d.51.1.1 (A:) RNA splicing factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ja9a2 d.51.1.1 (A:152-236) Ribosomal RNA-processing protein 40, RRP40 {Saccharomyces cerevisiae [TaxId: 4932]} Back     information, alignment and structure
>d2asba3 d.52.3.1 (A:263-329) Transcription factor NusA, C-terminal domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1hh2p3 d.52.3.1 (P:277-344) Transcription factor NusA, C-terminal domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bl5a1 d.51.1.1 (A:1-134) Quaking protein A (Xqua) {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure