Citrus Sinensis ID: 027785


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------22
MANSKGGKRSVLLLCGDYMEDYEAMVPFQALLAFGVSVDAACPGKKSGDVCPTAVHQSTGHQTYSETRGHNFALNATFDEIDPTKYDGLVIPGGRAPEYLAMNDSVIDLVRKFSNSGKTIASICHGQLILAAADVVKGRKCTAYPPVKPVLIAAGASWIEPETMAACVVDGNIITGATYEGHPEFIRLFLKALGGTITGSDKRILFLCGVSFCFQNLLE
cccccccccEEEEEEccccHHHHHHHHHHHHHHcccEEEEEccccccccccccEEccccccccccccccCEEECcccccccccccccEEEEccccccHHHccccHHHHHHHHHHHccccEEEEccHHHHHHHHcccccCEECcccccHHHHHHcccEECccccccEEEEcccEECccccccHHHHHHHHHHHHcccccccccEEEEEcccccccccccc
******G**SVLLLCGDYMEDYEAMVPFQALLAFGVSVDAACPGKKSGDVCPTAVHQSTGHQTYSETRGHNFALNATFDEIDPTKYDGLVIPGGRAPEYLAMNDSVIDLVRKFSNSGKTIASICHGQLILAAADVVKGRKCTAYPPVKPVLIAAGASWIEPETMAACVVDGNIITGATYEGHPEFIRLFLKALGGTITGSDKRILFLCGVSFCFQNLLE
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MANSKGGKRSVLLLCGDYMEDYEAMVPFQALLAFGVSVDAACPGKKSGDVCPTAVHQSTGHQTYSETRGHNFALNATFDEIDPTKYDGLVIPGGRAPEYLAMNDSVIDLVRKFSNSGKTIASICHGQLILAAADVVKGRKCTAYPPVKPVLIAAGASWIEPETMAACVVDGNIITGATYEGHPEFIRLFLKALGGTITGSDKRILFLCGVSFCFQNLLE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein DJ-1 homolog D May be involved in oxidative stress response.probableQ9M8R4

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3UK7, chain A
Confidence level:very confident
Coverage over the Query: 8-208
View the alignment between query and template
View the model in PyMOL