Citrus Sinensis ID: 027785

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------22

MANSKGGKRSVLLLCGDYMEDYEAMVPFQALLAFGVSVDAACPGKKSGDVCPTAVHQSTGHQTYSETRGHNFALNATFDEIDPTKYDGLVIPGGRAPEYLAMNDSVIDLVRKFSNSGKTIASICHGQLILAAADVVKGRKCTAYPPVKPVLIAAGASWIEPETMAACVVDGNIITGATYEGHPEFIRLFLKALGGTITGSDKRILFLCGVSFCFQNLLE

cccccccccEEEEEEccccHHHHHHHHHHHHHHcccEEEEEccccccccccccEEccccccccccccccCEEECcccccccccccccEEEEccccccHHHccccHHHHHHHHHHHccccEEEEccHHHHHHHHcccccCEECcccccHHHHHHcccEECccccccEEEEcccEECccccccHHHHHHHHHHHHcccccccccEEEEEcccccccccccc

******G**SVLLLCGDYMEDYEAMVPFQALLAFGVSVDAACPGKKSGDVCPTAVHQSTGHQTYSETRGHNFALNATFDEIDPTKYDGLVIPGGRAPEYLAMNDSVIDLVRKFSNSGKTIASICHGQLILAAADVVKGRKCTAYPPVKPVLIAAGASWIEPETMAACVVDGNIITGATYEGHPEFIRLFLKALGGTITGSDKRILFLCGVSFCFQNLLE

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Protein DJ-1 homolog D	May be involved in oxidative stress response.	probable	Q9M8R4

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3UK7, chain A
Confidence level:very confident
Coverage over the Query: 8-208
View the alignment between query and template
View the model in PyMOL