Citrus Sinensis ID: 027802

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------22
MQMILSSSSSSLPIPSFPCKCFSTFHALRTFFPQKKHIVRCSSSHNLKDNGFHCKVKLKRRVVPFLLFSSGLFPTLSASGKTKSKNPYDEKRLLEQNKRMQKENSAPEGFPNFIREGFEVKVVTSENYTKRDSGLIYRDFEVGKGDCPKDGQQVIFHYIGYNESGRRIDSTYLQGSPARIRMGTNALVPGFEEGIRDMRPGGKRRIIIPPELGPPVSN
cccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccccHHHHHHcccHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHccccccEEcccccEEEEEEcccccccccccEEEEEEEEEEccccEEcccccccccEEEEcccccccccHHHHHcccccccEEEEEEcccccccccc
ccEEEEcccccccccccccEEEEHEEEHHHHccccccEEEEccccccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEcccccEEEEEEEccccccccccEEEEEEEEEEccccEEEccccccccEEEEcccccccccHHHHHHccccccEEEEEEccHccccccc
mqmilsssssslpipsfpckcfstfhalrtffpqkkhivrcssshnlkdngfhckvklkrRVVPFLlfssglfptlsasgktksknpydeKRLLEQNKRmqkensapegfpnfirEGFEVKVvtsenytkrdsgliyrdfevgkgdcpkdgQQVIFHYIGynesgrridstylqgsparirmgtnalvpgfeegirdmrpggkrriiippelgppvsn
mqmilsssssslpipsFPCKCFSTFHALRTFFPQKKHIVRCSSSHNLKDNGFHCKVKLKRRVVPFLLFSsglfptlsasgktksknpydeKRLLEQNkrmqkensapegfpnfireGFEVKVvtsenytkrdsgliyrDFEVGKGDCPKDGQQVIFHYIgynesgrriDSTYLQGSPARIrmgtnalvpgfeegirdmrpggkrriiippelgppvsn
MQMilsssssslpipsFPCKCFSTFHALRTFFPQKKHIVRCSSSHNLKDNGFHCKVKLKRRVVPFLLFSSGLFPTLSASGKTKSKNPYDEKRLLEQNKRMQKENSAPEGFPNFIREGFEVKVVTSENYTKRDSGLIYRDFEVGKGDCPKDGQQVIFHYIGYNESGRRIDSTYLQGSPARIRMGTNALVPGFEEGIRDMRPGGKRRIIIPPELGPPVSN
**************PSFPCKCFSTFHALRTFFPQKKHIVRCSSSHNLKDNGFHCKVKLKRRVVPFLLFSSGLFPT***********************************PNFIREGFEVKVVTSENYTKRDSGLIYRDFEVGKGDCPKDGQQVIFHYIGYNESGRRIDSTYLQGSPARIRMGTNALVPGF***************************
*********SSLPIPSFPC*************PQKKHIVRCSSSHN***********LKRRVVPFLLFSSG***************************************************V****YTKRDSGLIYRDFEVGKGDCPKDGQQVIFHYIGYNESGRRIDSTYLQGSPARIRMGTNALVPGFEEGIRDMRPGGKRRIIIPPELGPP***
************PIPSFPCKCFSTFHALRTFFPQKKHIVRCSSSHNLKDNGFHCKVKLKRRVVPFLLFSSGLFPTLSAS********YDEKRLLEQNKRMQKENSAPEGFPNFIREGFEVKVVTSENYTKRDSGLIYRDFEVGKGDCPKDGQQVIFHYIGYNESGRRIDSTYLQGSPARIRMGTNALVPGFEEGIRDMRPGGKRRIIIPPELGPPVSN
********SSSLPIPSFPCKCFSTFHALRTFFPQKKHIVRCSSSHNLKDNGFHCKVKLKRRVVPFLLFSSGLFPTLSASGKTKSKNPYDEKRLLEQNKRMQKENSAPEGFPNFIREGFEVKVVTSENYTKRDSGLIYRDFEVGKGDCPKDGQQVIFHYIGYNESGRRIDSTYLQGSPARIRMGTNALVPGFEEGIRDMRPGGKRRIIIPPELGPPV**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQMILSSSSSSLPIPSFPCKCFSTFHALRTFFPQKKHIVRCSSSHNLKDNGFHCKVKLKRRVVPFLLFSSGLFPTLSASGKTKSKNPYDEKRLLEQNKRMQKENSAPEGFPNFIREGFEVKVVTSENYTKRDSGLIYRDFEVGKGDCPKDGQQVIFHYIGYNESGRRIDSTYLQGSPARIRMGTNALVPGFEEGIRDMRPGGKRRIIIPPELGPPVSN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query218 2.2.26 [Sep-21-2011]
Q0WRJ7242 Peptidyl-prolyl cis-trans yes no 0.788 0.710 0.733 2e-65
O22870223 Peptidyl-prolyl cis-trans no no 0.651 0.636 0.319 1e-12
Q9LYR5256 Peptidyl-prolyl cis-trans no no 0.408 0.347 0.36 9e-11
P65764270 FKBP-type peptidyl-prolyl yes no 0.490 0.396 0.350 3e-10
P65765270 FKBP-type peptidyl-prolyl N/A no 0.490 0.396 0.350 3e-10
P45523270 FKBP-type peptidyl-prolyl N/A no 0.490 0.396 0.350 3e-10
P0A0W2109 FK506-binding protein OS= yes no 0.371 0.743 0.358 9e-10
O81864229 Peptidyl-prolyl cis-trans no no 0.366 0.349 0.363 1e-09
Q54NB6364 FK506-binding protein 4 O yes no 0.362 0.217 0.395 2e-09
Q9SCY2208 Peptidyl-prolyl cis-trans no no 0.412 0.432 0.375 3e-09
>sp|Q0WRJ7|FK202_ARATH Peptidyl-prolyl cis-trans isomerase FKBP20-2, chloroplastic OS=Arabidopsis thaliana GN=FKBP20-2 PE=1 SV=1 Back     alignment and function desciption
 Score =  248 bits (634), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 132/180 (73%), Positives = 150/180 (83%), Gaps = 8/180 (4%)

Query: 39  VRCSSSHNLKDNGFHCKVKLKRRVVPFLLFSSG--LFPTLSASGKTKSKNPYDEKRLLEQ 96
           V CS S   KD    C   L RR + ++L +S   L P LS+S KTKSK+PYDE+RLLEQ
Sbjct: 30  VCCSLSEEPKD---QC---LSRRSLVYVLVASPCLLLPALSSSAKTKSKSPYDERRLLEQ 83

Query: 97  NKRMQKENSAPEGFPNFIREGFEVKVVTSENYTKRDSGLIYRDFEVGKGDCPKDGQQVIF 156
           NKR+Q+EN+AP+ FPNF+REGFEVKV+ S+NY K DSGLIYRDF VG+GD PKDGQQV F
Sbjct: 84  NKRIQRENNAPDEFPNFVREGFEVKVLASDNYIKADSGLIYRDFNVGQGDFPKDGQQVTF 143

Query: 157 HYIGYNESGRRIDSTYLQGSPARIRMGTNALVPGFEEGIRDMRPGGKRRIIIPPELGPPV 216
           HYIGYNESGRRIDSTY+QGSPARIRMGTNALVPGFE GIRDM+PGG+RRIIIPPELGPPV
Sbjct: 144 HYIGYNESGRRIDSTYIQGSPARIRMGTNALVPGFEMGIRDMKPGGRRRIIIPPELGPPV 203
PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides (By similarity). Involved in the accumulation of the PSII complex.
Arabidopsis thaliana (taxid: 3702)
EC: 5EC: .EC: 2EC: .EC: 1EC: .EC: 8
>sp|O22870|FK163_ARATH Peptidyl-prolyl cis-trans isomerase FKBP16-3, chloroplastic OS=Arabidopsis thaliana GN=FKBP16-3 PE=1 SV=2 Back     alignment and function description
>sp|Q9LYR5|FKB19_ARATH Peptidyl-prolyl cis-trans isomerase FKBP19, chloroplastic OS=Arabidopsis thaliana GN=FKBP19 PE=1 SV=1 Back     alignment and function description
>sp|P65764|FKBA_ECOL6 FKBP-type peptidyl-prolyl cis-trans isomerase FkpA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fkpA PE=3 SV=1 Back     alignment and function description
>sp|P65765|FKBA_ECO57 FKBP-type peptidyl-prolyl cis-trans isomerase FkpA OS=Escherichia coli O157:H7 GN=fkpA PE=3 SV=1 Back     alignment and function description
>sp|P45523|FKBA_ECOLI FKBP-type peptidyl-prolyl cis-trans isomerase FkpA OS=Escherichia coli (strain K12) GN=fkpA PE=1 SV=1 Back     alignment and function description
>sp|P0A0W2|FKBP_NEIMB FK506-binding protein OS=Neisseria meningitidis serogroup B (strain MC58) GN=fbp PE=1 SV=1 Back     alignment and function description
>sp|O81864|FK171_ARATH Peptidyl-prolyl cis-trans isomerase FKBP17-1, chloroplastic OS=Arabidopsis thaliana GN=FKBP17-1 PE=2 SV=1 Back     alignment and function description
>sp|Q54NB6|FKBP4_DICDI FK506-binding protein 4 OS=Dictyostelium discoideum GN=fkbp4 PE=1 SV=1 Back     alignment and function description
>sp|Q9SCY2|FKB13_ARATH Peptidyl-prolyl cis-trans isomerase FKBP13, chloroplastic OS=Arabidopsis thaliana GN=FKBP13 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query218
225453422258 PREDICTED: FKBP-type peptidyl-prolyl cis 0.981 0.829 0.695 2e-80
255541078265 fk506-binding protein, putative [Ricinus 0.830 0.683 0.763 4e-75
351726032248 uncharacterized protein LOC100305486 [Gl 0.931 0.818 0.651 1e-73
224137178210 predicted protein [Populus trichocarpa] 0.784 0.814 0.748 2e-73
449431986260 PREDICTED: peptidyl-prolyl cis-trans iso 0.981 0.823 0.630 7e-72
388505048246 unknown [Lotus japonicus] 0.880 0.780 0.686 8e-72
356520790248 PREDICTED: FKBP-type peptidyl-prolyl cis 0.894 0.786 0.663 1e-71
297820896244 immunophilin [Arabidopsis lyrata subsp. 0.788 0.704 0.744 2e-65
30695188242 FKBP-type peptidyl-prolyl cis-trans isom 0.788 0.710 0.733 9e-64
115472151258 Os07g0490400 [Oryza sativa Japonica Grou 0.651 0.550 0.781 5e-62
>gi|225453422|ref|XP_002274957.1| PREDICTED: FKBP-type peptidyl-prolyl cis-trans isomerase 6, chloroplastic [Vitis vinifera] gi|297734593|emb|CBI16644.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  304 bits (778), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 153/220 (69%), Positives = 174/220 (79%), Gaps = 6/220 (2%)

Query: 3   MILSSSSSSLPIPSFPCKCFSTFHALRTFFPQKKHIVRCSSSHNLKDNGFH--CKV---- 56
           M+   +   LP P  P +  S    + +FF  KK I+ C SS+NLKD      C +    
Sbjct: 1   MLWLPTHPLLPQPYIPYRYLSACRTVGSFFSLKKPILHCRSSYNLKDYREQKGCVLPYEE 60

Query: 57  KLKRRVVPFLLFSSGLFPTLSASGKTKSKNPYDEKRLLEQNKRMQKENSAPEGFPNFIRE 116
            L+RR++ F L SSG FPTLS+S KTKSKNPYDEKRLL+QNKR+QKEN+APE FPNF+RE
Sbjct: 61  NLRRRLLIFFLVSSGCFPTLSSSAKTKSKNPYDEKRLLQQNKRIQKENNAPEDFPNFVRE 120

Query: 117 GFEVKVVTSENYTKRDSGLIYRDFEVGKGDCPKDGQQVIFHYIGYNESGRRIDSTYLQGS 176
           GFEVKVVT ENY   DSGLIYRDFEVGKGDCPK GQQV FHY+GYNESGRRIDS+Y+QGS
Sbjct: 121 GFEVKVVTPENYITSDSGLIYRDFEVGKGDCPKAGQQVTFHYVGYNESGRRIDSSYMQGS 180

Query: 177 PARIRMGTNALVPGFEEGIRDMRPGGKRRIIIPPELGPPV 216
           PA+IRMGTNALVPGFEEGIRDM+PGGKRRIIIPPELGPPV
Sbjct: 181 PAKIRMGTNALVPGFEEGIRDMKPGGKRRIIIPPELGPPV 220

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255541078|ref|XP_002511603.1| fk506-binding protein, putative [Ricinus communis] gi|223548783|gb|EEF50272.1| fk506-binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|351726032|ref|NP_001236089.1| uncharacterized protein LOC100305486 [Glycine max] gi|255625657|gb|ACU13173.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|224137178|ref|XP_002327057.1| predicted protein [Populus trichocarpa] gi|222835372|gb|EEE73807.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449431986|ref|XP_004133781.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP20-2, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|388505048|gb|AFK40590.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|356520790|ref|XP_003529043.1| PREDICTED: FKBP-type peptidyl-prolyl cis-trans isomerase 6, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|297820896|ref|XP_002878331.1| immunophilin [Arabidopsis lyrata subsp. lyrata] gi|297324169|gb|EFH54590.1| immunophilin [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|30695188|ref|NP_567098.2| FKBP-type peptidyl-prolyl cis-trans isomerase 6 [Arabidopsis thaliana] gi|122236257|sp|Q0WRJ7.1|FK202_ARATH RecName: Full=Peptidyl-prolyl cis-trans isomerase FKBP20-2, chloroplastic; Short=PPIase FKBP20-2; AltName: Full=FK506-binding protein 20-2; Short=AtFKBP20-2; AltName: Full=Immunophilin FKBP20-2; AltName: Full=Rotamase; Flags: Precursor gi|110736573|dbj|BAF00252.1| hypothetical protein [Arabidopsis thaliana] gi|119360117|gb|ABL66787.1| At3g60370 [Arabidopsis thaliana] gi|332646531|gb|AEE80052.1| FKBP-type peptidyl-prolyl cis-trans isomerase 6 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|115472151|ref|NP_001059674.1| Os07g0490400 [Oryza sativa Japonica Group] gi|33146997|dbj|BAC80069.1| putative FKBP-type peptidyl-prolyl cis-trans isomerase; protein [Oryza sativa Japonica Group] gi|113611210|dbj|BAF21588.1| Os07g0490400 [Oryza sativa Japonica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query218
TAIR|locus:2103366242 AT3G60370 "AT3G60370" [Arabido 0.788 0.710 0.733 5.8e-66
UNIPROTKB|Q7XHR0258 P0477A12.35 "Peptidyl-prolyl c 0.724 0.612 0.727 2.1e-61
UNIPROTKB|A8HTG4269 FKB20-2 "Peptidyl-prolyl cis-t 0.577 0.468 0.590 5.5e-38
UNIPROTKB|Q74AS7156 GSU2274 "Peptidyl-prolyl cis-t 0.371 0.519 0.432 3.3e-15
TIGR_CMR|GSU_2274156 GSU_2274 "FKBP-type peptidyl-p 0.371 0.519 0.432 3.3e-15
UNIPROTKB|Q7NMC5161 glr0841 "Peptidyl-prolyl cis-t 0.399 0.540 0.402 5.4e-15
UNIPROTKB|P45523270 fkpA [Escherichia coli K-12 (t 0.490 0.396 0.347 1.4e-14
UNIPROTKB|A9WGZ8 237 Caur_0860 "Peptidyl-prolyl cis 0.371 0.341 0.456 1.8e-14
UNIPROTKB|A8IW09208 FKB16-3 "Peptidyl-prolyl cis-t 0.380 0.399 0.409 1.6e-13
UNIPROTKB|P73037201 ytfC "Peptidyl-prolyl cis-tran 0.403 0.437 0.397 2.1e-13
TAIR|locus:2103366 AT3G60370 "AT3G60370" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 671 (241.3 bits), Expect = 5.8e-66, P = 5.8e-66
 Identities = 132/180 (73%), Positives = 150/180 (83%)

Query:    39 VRCSSSHNLKDNGFHCKVKLKRRVVPFLLFSSG--LFPTLSASGKTKSKNPYDEKRLLEQ 96
             V CS S   KD    C   L RR + ++L +S   L P LS+S KTKSK+PYDE+RLLEQ
Sbjct:    30 VCCSLSEEPKDQ---C---LSRRSLVYVLVASPCLLLPALSSSAKTKSKSPYDERRLLEQ 83

Query:    97 NKRMQKENSAPEGFPNFIREGFEVKVVTSENYTKRDSGLIYRDFEVGKGDCPKDGQQVIF 156
             NKR+Q+EN+AP+ FPNF+REGFEVKV+ S+NY K DSGLIYRDF VG+GD PKDGQQV F
Sbjct:    84 NKRIQRENNAPDEFPNFVREGFEVKVLASDNYIKADSGLIYRDFNVGQGDFPKDGQQVTF 143

Query:   157 HYIGYNESGRRIDSTYLQGSPARIRMGTNALVPGFEEGIRDMRPGGKRRIIIPPELGPPV 216
             HYIGYNESGRRIDSTY+QGSPARIRMGTNALVPGFE GIRDM+PGG+RRIIIPPELGPPV
Sbjct:   144 HYIGYNESGRRIDSTYIQGSPARIRMGTNALVPGFEMGIRDMKPGGRRRIIIPPELGPPV 203
GO:0003755 "peptidyl-prolyl cis-trans isomerase activity" evidence=ISS;IDA
GO:0005528 "FK506 binding" evidence=ISS;IBA
GO:0005576 "extracellular region" evidence=ISM
GO:0006457 "protein folding" evidence=IEA
GO:0016020 "membrane" evidence=IBA
GO:0018208 "peptidyl-proline modification" evidence=IBA
GO:0009543 "chloroplast thylakoid lumen" evidence=IDA
GO:0031977 "thylakoid lumen" evidence=IDA
GO:0009579 "thylakoid" evidence=IDA
GO:0009507 "chloroplast" evidence=IDA
GO:0010207 "photosystem II assembly" evidence=RCA;IMP
GO:0016491 "oxidoreductase activity" evidence=IDA
GO:0006364 "rRNA processing" evidence=RCA
GO:0009902 "chloroplast relocation" evidence=RCA
GO:0010027 "thylakoid membrane organization" evidence=RCA
GO:0019761 "glucosinolate biosynthetic process" evidence=RCA
GO:0035304 "regulation of protein dephosphorylation" evidence=RCA
GO:0042793 "transcription from plastid promoter" evidence=RCA
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=RCA
UNIPROTKB|Q7XHR0 P0477A12.35 "Peptidyl-prolyl cis-trans isomerase" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|A8HTG4 FKB20-2 "Peptidyl-prolyl cis-trans isomerase" [Chlamydomonas reinhardtii (taxid:3055)] Back     alignment and assigned GO terms
UNIPROTKB|Q74AS7 GSU2274 "Peptidyl-prolyl cis-trans isomerase" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_2274 GSU_2274 "FKBP-type peptidyl-prolyl cis-trans isomerase" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
UNIPROTKB|Q7NMC5 glr0841 "Peptidyl-prolyl cis-trans isomerase" [Gloeobacter violaceus PCC 7421 (taxid:251221)] Back     alignment and assigned GO terms
UNIPROTKB|P45523 fkpA [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
UNIPROTKB|A9WGZ8 Caur_0860 "Peptidyl-prolyl cis-trans isomerase" [Chloroflexus aurantiacus J-10-fl (taxid:324602)] Back     alignment and assigned GO terms
UNIPROTKB|A8IW09 FKB16-3 "Peptidyl-prolyl cis-trans isomerase" [Chlamydomonas reinhardtii (taxid:3055)] Back     alignment and assigned GO terms
UNIPROTKB|P73037 ytfC "Peptidyl-prolyl cis-trans isomerase" [Synechocystis sp. PCC 6803 substr. Kazusa (taxid:1111708)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q0WRJ7FK202_ARATH5, ., 2, ., 1, ., 80.73330.78890.7107yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer5.2.10.963
4th Layer5.2.1.80.946

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query218
COG0545205 COG0545, FkpA, FKBP-type peptidyl-prolyl cis-trans 4e-20
pfam0025494 pfam00254, FKBP_C, FKBP-type peptidyl-prolyl cis-t 4e-19
PRK10902269 PRK10902, PRK10902, FKBP-type peptidyl-prolyl cis- 4e-14
COG1047 174 COG1047, SlpA, FKBP-type peptidyl-prolyl cis-trans 1e-10
PRK15095156 PRK15095, PRK15095, FKBP-type peptidyl-prolyl cis- 8e-05
PRK11570206 PRK11570, PRK11570, peptidyl-prolyl cis-trans isom 3e-04
>gnl|CDD|223619 COG0545, FkpA, FKBP-type peptidyl-prolyl cis-trans isomerases 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
 Score = 84.0 bits (208), Expect = 4e-20
 Identities = 43/136 (31%), Positives = 63/136 (46%), Gaps = 11/136 (8%)

Query: 81  KTKSKNPYDEKRLLEQ-NKRMQKENSAPEGFPNFIREGFEVK--VVTSENYTKRDSGLIY 137
                    E+RL +    +  K+ +A         E    +  V T        SGL Y
Sbjct: 52  AALEALQRAEQRLQQAAKAKRAKDAAANAAEGKAFLEKNAKEKGVKTLP------SGLQY 105

Query: 138 RDFEVGKGDCPKDGQQVIFHYIGYNESGRRIDSTYLQGSPARIRMGTNALVPGFEEGIRD 197
           +  + G G  PK G  V  HY G    G   DS+Y +G PA   +G   ++PG++EG++ 
Sbjct: 106 KVLKAGDGAAPKKGDTVTVHYTGTLIDGTVFDSSYDRGQPAEFPLG--GVIPGWDEGLQG 163

Query: 198 MRPGGKRRIIIPPELG 213
           M+ GGKR++ IPPEL 
Sbjct: 164 MKVGGKRKLTIPPELA 179

Length = 205
>gnl|CDD|215821 pfam00254, FKBP_C, FKBP-type peptidyl-prolyl cis-trans isomerase Back     alignment and domain information
>gnl|CDD|236791 PRK10902, PRK10902, FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>gnl|CDD|223976 COG1047, SlpA, FKBP-type peptidyl-prolyl cis-trans isomerases 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|237908 PRK15095, PRK15095, FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>gnl|CDD|183207 PRK11570, PRK11570, peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 218
TIGR03516177 ppisom_GldI peptidyl-prolyl isomerase, gliding mot 99.92
COG0545205 FkpA FKBP-type peptidyl-prolyl cis-trans isomerase 99.92
PRK11570206 peptidyl-prolyl cis-trans isomerase; Provisional 99.86
KOG0544108 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.85
KOG0552226 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.83
PRK10902269 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 99.82
KOG0549188 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.81
PF0025494 FKBP_C: FKBP-type peptidyl-prolyl cis-trans isomer 99.71
PRK15095156 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 99.69
COG1047 174 SlpA FKBP-type peptidyl-prolyl cis-trans isomerase 99.57
PRK10737 196 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 99.51
KOG0543 397 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.25
TIGR00115 408 tig trigger factor. Trigger factor is a ribosome-a 98.82
PRK01490 435 tig trigger factor; Provisional 98.73
COG0544 441 Tig FKBP-type peptidyl-prolyl cis-trans isomerase 98.64
KOG0543 397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.6
KOG0545 329 consensus Aryl-hydrocarbon receptor-interacting pr 98.03
>TIGR03516 ppisom_GldI peptidyl-prolyl isomerase, gliding motility-associated Back     alignment and domain information 
Probab=99.92  E-value=1e-24  Score=175.94  Aligned_cols=135  Identities=20%  Similarity=0.298  Sum_probs=104.7

Q ss_pred             hhhhccCCCCCCCcch------HHHHHHHHHHhhhhcCCCCCCCcccccCcceeeeeccCceeCCCceEEEEeec--CCC
Q 027802           74 PTLSASGKTKSKNPYD------EKRLLEQNKRMQKENSAPEGFPNFIREGFEVKVVTSENYTKRDSGLIYRDFEV--GKG  145 (218)
Q Consensus        74 ~~lssc~~~~~~~~~~------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~y~~~~~--G~G  145 (218)
                      +++.+|+..+.+.|..      -..+.++|++.-+.  +...|..+...+      ...++.++++|++|+++++  |+|
T Consensus        12 ~~~~~c~~~~~~~pv~~~~~~~~~~s~~rnk~l~~~--e~~~I~~~i~~~------~~~~~~~t~sGl~Y~v~~~~~g~g   83 (177)
T TIGR03516        12 LLLLGCKTPEARRPISRSSGTTIKLSAERNKKLIAA--EEAAIKRIISAD------SIVKYETSQNGFWYYYNQKDTGEG   83 (177)
T ss_pred             HHHhhcCCCCCCCCcCCCCcchHHHHHHHHHHHHHH--HHHHHHHHHHhC------CCCCceECCCccEEEEEEecCCCC
Confidence            4578899888887776      23455555533211  111222223222      1245677899999999977  566


Q ss_pred             CCCCCCCeEEEEEEEEeCCCcEEeccccCCCCEEEEeCCCCChHHHHHHHccCCCCcEEEEEeCCCCCCCCC
Q 027802          146 DCPKDGQQVIFHYIGYNESGRRIDSTYLQGSPARIRMGTNALVPGFEEGIRDMRPGGKRRIIIPPELGPPVS  217 (218)
Q Consensus       146 ~~~~~gd~V~v~Y~~~~~dG~~~dss~~~~~p~~f~lG~~~~i~Gle~aL~gmk~Ge~~~~~iP~~layg~~  217 (218)
                      ..|+.||.|++||++++.||++|++++. ..|..|.+|.+++++||+++|.+|++||+++|+|||++|||..
T Consensus        84 ~~p~~gd~V~v~Y~~~~~dG~v~~ss~~-~~P~~f~vg~~~vi~Gl~e~L~~Mk~Ge~~~~~iP~~~AYG~~  154 (177)
T TIGR03516        84 TTPEFGDLVTFEYDIRALDGDVIYSEEE-LGPQTYKVDQQDLFSGLRDGLKLMKEGETATFLFPSHKAYGYY  154 (177)
T ss_pred             CcCCCCCEEEEEEEEEeCCCCEEEeCCC-CCCEEEEeCCcchhHHHHHHHcCCCCCCEEEEEECHHHcCCCC
Confidence            7899999999999999999999999987 4599999999999999999999999999999999999999974

Members of this protein family are exclusive to the Bacteroidetes phylum (previously Cytophaga-Flavobacteria-Bacteroides). GldI is a FKBP-type peptidyl-prolyl cis-trans isomerase (pfam00254) linked to a type of rapid surface gliding motility found in certain Bacteroidetes, such as Flavobacterium johnsoniae and Cytophaga hutchinsonii. Knockout of this gene abolishes the gliding phenotype. Gliding motility appears closely linked to chitin utilization in the model species Flavobacterium johnsoniae. This family is only found in Bacteroidetes containing the suite of genes proposed to confer the gliding motility phenotype.
>COG0545 FkpA FKBP-type peptidyl-prolyl cis-trans isomerases 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11570 peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>KOG0544 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0552 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10902 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>KOG0549 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00254 FKBP_C: FKBP-type peptidyl-prolyl cis-trans isomerase; InterPro: IPR001179 Synonym(s): Peptidylprolyl cis-trans isomerase FKBP-type peptidylprolyl isomerases (5 Back     alignment and domain information
>PRK15095 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>COG1047 SlpA FKBP-type peptidyl-prolyl cis-trans isomerases 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10737 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00115 tig trigger factor Back     alignment and domain information
>PRK01490 tig trigger factor; Provisional Back     alignment and domain information
>COG0544 Tig FKBP-type peptidyl-prolyl cis-trans isomerase (trigger factor) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query218
3uf8_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 3e-12
3uqa_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 3e-12
4ggq_C209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 3e-12
2y78_A133 Crystal Structure Of Bpss1823, A Mip-Like Chaperone 3e-12
3vaw_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 4e-12
2ke0_A117 Solution Structure Of Peptidyl-Prolyl Cis-Trans Iso 9e-12
4dz3_A113 Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Is 1e-11
4dz2_A113 Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Is 2e-11
3uqb_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 3e-11
1q6u_A245 Crystal Structure Of Fkpa From Escherichia Coli Len 5e-11
1q6h_A224 Crystal Structure Of A Truncated Form Of Fkpa From 8e-11
1u79_A129 Crystal Structure Of Atfkbp13 Length = 129 6e-10
1bl4_A107 Fkbp Mutant F36v Complexed With Remodeled Synthetic 1e-06
2dg4_A107 Fk506-Binding Protein Mutant Wf59 Complexed With Ra 1e-06
1eym_A107 Fk506 Binding Protein Mutant, Homodimeric Complex L 2e-06
1c9h_A107 Crystal Structure Of Fkbp12.6 In Complex With Rapam 2e-06
1tco_C107 Ternary Complex Of A Calcineurin A Fragment, Calcin 2e-06
1bkf_A107 Fk506 Binding Protein Fkbp Mutant R42kH87V COMPLEX 2e-06
1fkb_A107 Atomic Structure Of The Rapamycin Human Immunophili 2e-06
2fap_A107 The Structure Of The Immunophilin-Immunosuppressant 3e-06
3h9r_B109 Crystal Structure Of The Kinase Domain Of Type I Ac 3e-06
1fkk_A107 Atomic Structure Of Fkbp12, An Immunophilin Binding 4e-06
2pbc_A102 Fk506-Binding Protein 2 Length = 102 4e-06
1yat_A113 Improved Calcineurin Inhibition By Yeast Fkbp12-Dru 5e-06
2dg9_A107 Fk506-Binding Protein Mutant Wl59 Complexed With Ra 5e-06
3jxv_A 356 Crystal Structure Of The 3 Fkbp Domains Of Wheat Fk 5e-06
3jym_A 377 Crystal Structure Of The 3 Fkbp Domains Of Wheat Fk 5e-06
2ppp_A107 Crystal Structure Of E60q Mutant Of Fkbp12 Length = 6e-06
3uqi_A108 Crystallographic Structure Of Fkbp12 From Aedes Aeg 1e-05
2ppo_A107 Crystal Structure Of E60a Mutant Of Fkbp12 Length = 1e-05
4dip_A125 Crystal Structure Of Human Peptidyl-Prolyl Cis-Tran 1e-04
2lgo_A130 Solution Nmr Structure Of A Fkbp-Type Peptidyl-Prol 2e-04
1fd9_A213 Crystal Structure Of The Macrophage Infectivity Pot 9e-04
>pdb|3UF8|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With A G95a Surface Mutation From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure 
Iteration: 1

 Score = 68.6 bits (166), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 43/128 (33%), Positives = 65/128 (50%), Gaps = 5/128 (3%)
Query: 89  DEKRLLEQNKRMQKENSAPEGFP---NFIREGFEVKVVTSENYTKRDSGLIYRDFEVGKG 145
           D  R L    R+Q + + PE      N I E    ++  S   T  +SGL Y D   G G
Sbjct: 59  DSLRFLYDGIRIQADQT-PEDLDMEDNDIIEAHREQIGGSTVVTT-ESGLKYEDLTEGSG 116
Query: 146 DCPKDGQQVIFHYIGYNESGRRIDSTYLQGSPARIRMGTNALVPGFEEGIRDMRPGGKRR 205
              + GQ V  HY G+   G++ DS+  +  P    +G   ++ G++EG++ M+ GG RR
Sbjct: 117 AEARAGQTVSVHYTGWLTDGQKFDSSKDRNDPFAFVLGGGMVIKGWDEGVQGMKVGGVRR 176
Query: 206 IIIPPELG 213
           + IPP+LG
Sbjct: 177 LTIPPQLG 184
>pdb|3UQA|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation A54e From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|4GGQ|C Chain C, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase From Burkholderia Pseudomallei Complexed With Cj40 Length = 209 Back     alignment and structure
>pdb|2Y78|A Chain A, Crystal Structure Of Bpss1823, A Mip-Like Chaperone From Burkholderia Pseudomallei Length = 133 Back     alignment and structure
>pdb|3VAW|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation V3i From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|2KE0|A Chain A, Solution Structure Of Peptidyl-Prolyl Cis-Trans Isomerase From Burkholderia Pseudomallei Length = 117 Back     alignment and structure
>pdb|4DZ3|A Chain A, Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation M61h From Burkholderia Pseudomallei Complexed With Fk506 Length = 113 Back     alignment and structure
>pdb|4DZ2|A Chain A, Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation R92g From Burkholderia Pseudomallei Complexed With Fk506 Length = 113 Back     alignment and structure
>pdb|3UQB|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation D44g From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|1Q6U|A Chain A, Crystal Structure Of Fkpa From Escherichia Coli Length = 245 Back     alignment and structure
>pdb|1Q6H|A Chain A, Crystal Structure Of A Truncated Form Of Fkpa From Escherichia Coli Length = 224 Back     alignment and structure
>pdb|1U79|A Chain A, Crystal Structure Of Atfkbp13 Length = 129 Back     alignment and structure
>pdb|1BL4|A Chain A, Fkbp Mutant F36v Complexed With Remodeled Synthetic Ligand Length = 107 Back     alignment and structure
>pdb|2DG4|A Chain A, Fk506-Binding Protein Mutant Wf59 Complexed With Rapamycin Length = 107 Back     alignment and structure
>pdb|1EYM|A Chain A, Fk506 Binding Protein Mutant, Homodimeric Complex Length = 107 Back     alignment and structure
>pdb|1C9H|A Chain A, Crystal Structure Of Fkbp12.6 In Complex With Rapamycin Length = 107 Back     alignment and structure
>pdb|1TCO|C Chain C, Ternary Complex Of A Calcineurin A Fragment, Calcineurin B, Fkbp12 And The Immunosuppressant Drug Fk506 (tacrolimus) Length = 107 Back     alignment and structure
>pdb|1BKF|A Chain A, Fk506 Binding Protein Fkbp Mutant R42kH87V COMPLEX WITH Immunosuppressant Fk506 Length = 107 Back     alignment and structure
>pdb|1FKB|A Chain A, Atomic Structure Of The Rapamycin Human Immunophilin Fkbp- 12 Complex Length = 107 Back     alignment and structure
>pdb|2FAP|A Chain A, The Structure Of The Immunophilin-Immunosuppressant Fkbp12- (C16)-Ethoxy Rapamycin Complex Interacting With Huma Length = 107 Back     alignment and structure
>pdb|3H9R|B Chain B, Crystal Structure Of The Kinase Domain Of Type I Activin Receptor (Acvr1) In Complex With Fkbp12 And Dorsomorphin Length = 109 Back     alignment and structure
>pdb|1FKK|A Chain A, Atomic Structure Of Fkbp12, An Immunophilin Binding Protein Length = 107 Back     alignment and structure
>pdb|2PBC|A Chain A, Fk506-Binding Protein 2 Length = 102 Back     alignment and structure
>pdb|1YAT|A Chain A, Improved Calcineurin Inhibition By Yeast Fkbp12-Drug Complexes. Crystallographic And Functional Analysis Length = 113 Back     alignment and structure
>pdb|2DG9|A Chain A, Fk506-Binding Protein Mutant Wl59 Complexed With Rapamycin Length = 107 Back     alignment and structure
>pdb|3JXV|A Chain A, Crystal Structure Of The 3 Fkbp Domains Of Wheat Fkbp73 Length = 356 Back     alignment and structure
>pdb|3JYM|A Chain A, Crystal Structure Of The 3 Fkbp Domains Of Wheat Fkbp73 Length = 377 Back     alignment and structure
>pdb|2PPP|A Chain A, Crystal Structure Of E60q Mutant Of Fkbp12 Length = 107 Back     alignment and structure
>pdb|3UQI|A Chain A, Crystallographic Structure Of Fkbp12 From Aedes Aegypti Length = 108 Back     alignment and structure
>pdb|2PPO|A Chain A, Crystal Structure Of E60a Mutant Of Fkbp12 Length = 107 Back     alignment and structure
>pdb|4DIP|A Chain A, Crystal Structure Of Human Peptidyl-Prolyl Cis-Trans Isomerase Fkbp14 Length = 125 Back     alignment and structure
>pdb|2LGO|A Chain A, Solution Nmr Structure Of A Fkbp-Type Peptidyl-Prolyl Cis-Trans Isomerase From Giardia Lamblia, Seattle Structural Genomics Center For Infectious Disease Target Gilaa.00840.A Length = 130 Back     alignment and structure
>pdb|1FD9|A Chain A, Crystal Structure Of The Macrophage Infectivity Potentiator Protein (Mip) A Major Virulence Factor From Legionella Pneumophila Length = 213 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query218
3uf8_A209 Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- 2e-25
2y78_A133 Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, 1e-23
1u79_A129 FKBP-type peptidyl-prolyl CIS-trans isomerase 3; T 1e-23
3b7x_A134 FK506-binding protein 6; isomerase, repeat, rotama 2e-23
1q1c_A 280 FK506-binding protein 4; rotamase, TPR repeat, nuc 6e-23
1q1c_A280 FK506-binding protein 4; rotamase, TPR repeat, nuc 3e-12
1fd9_A213 Protein (macrophage infectivity potentiator prote; 1e-22
3o5q_A128 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 1e-22
1q6h_A224 FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; 2e-22
2f4e_A180 ATFKBP42; FKBP-like, alpha-beta, signaling protein 2e-22
3jxv_A 356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 2e-22
3jxv_A356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 4e-16
3jxv_A 356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 2e-14
3o5e_A144 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 2e-22
1yat_A113 FK506 binding protein; HET: FK5; 2.50A {Saccharomy 1e-21
2lgo_A130 FKBP; infectious disease, isomerase, giardiasis, s 2e-21
1r9h_A135 FKB-6, FK506 binding protein family; structural ge 3e-21
1jvw_A167 Macrophage infectivity potentiator; chagas disease 3e-21
3oe2_A219 Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, 3e-20
2ppn_A107 FK506-binding protein 1A; high resolution protein 3e-20
2vn1_A129 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR 5e-20
2pbc_A102 FK506-binding protein 2; endoplasmic reticulum, is 3e-19
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 8e-19
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 1e-09
3kz7_A119 FK506-binding protein 3; FKPB ppiase rapamycin, is 1e-18
4dip_A125 Peptidyl-prolyl CIS-trans isomerase FKBP14; struct 1e-18
2awg_A118 38 kDa FK-506 binding protein; FKBP-type, ppiase, 2e-16
2if4_A 338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 3e-16
2d9f_A135 FK506-binding protein 8 variant; FKBP, rapamycin, 2e-15
2jwx_A157 FKBP38NTD, FK506-binding protein 8 variant; apopto 4e-15
4dt4_A169 FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; 7e-15
2k8i_A171 SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, 3e-13
2kfw_A 196 FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD 9e-13
2kr7_A151 FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; 3e-12
1ix5_A151 FKBP; ppiase, isomerase; NMR {Methanothermococcust 3e-12
3pr9_A157 FKBP-type peptidyl-prolyl CIS-trans isomerase; FKB 4e-10
3cgm_A158 SLYD, peptidyl-prolyl CIS-trans isomerase; chapero 5e-10
3prb_A 231 FKBP-type peptidyl-prolyl CIS-trans isomerase; cha 9e-10
1p5q_A 336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 7e-07
>3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 1euv_B 3v60_A 3v61_A 3v62_A* Length = 209 Back     alignment and structure
 Score = 97.6 bits (243), Expect = 2e-25
 Identities = 36/134 (26%), Positives = 60/134 (44%), Gaps = 1/134 (0%)

Query: 81  KTKSKNPYDEKRLLEQNKRMQKENSAPEGFPNFIREG-FEVKVVTSENYTKRDSGLIYRD 139
             +     D  R L    R+Q + +  +             + +        +SGL Y D
Sbjct: 51  AKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGGSTVVTTESGLKYED 110

Query: 140 FEVGKGDCPKDGQQVIFHYIGYNESGRRIDSTYLQGSPARIRMGTNALVPGFEEGIRDMR 199
              G G   + GQ V  HY G+   G++ DS+  +  P    +G   ++ G++EG++ M+
Sbjct: 111 LTEGSGAEARAGQTVSVHYTGWLTDGQKFDSSKDRNDPFAFVLGGGMVIKGWDEGVQGMK 170

Query: 200 PGGKRRIIIPPELG 213
            GG RR+ IPP+LG
Sbjct: 171 VGGVRRLTIPPQLG 184
>2y78_A Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, virulence; HET: SO4 GOL; 0.91A {Burkholderia pseudomallei} PDB: 2ke0_A 2ko7_A* 2l2s_A* 4dz2_A* 4dz3_A* Length = 133 Back     alignment and structure
>1u79_A FKBP-type peptidyl-prolyl CIS-trans isomerase 3; TFKBP13, FK-506 binding protein; 1.85A {Arabidopsis thaliana} SCOP: d.26.1.1 PDB: 1y0o_A Length = 129 Back     alignment and structure
>3b7x_A FK506-binding protein 6; isomerase, repeat, rotamase, TPR repeat, williams-beuren syndrome, structural genomics consortium, SGC; 2.10A {Homo sapiens} Length = 134 Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Length = 280 Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Length = 280 Back     alignment and structure
>1fd9_A Protein (macrophage infectivity potentiator prote; FKBP domain, long alpha helix, dimerisation VIA helical INTE isomerase; 2.41A {Legionella pneumophila} SCOP: d.26.1.1 PDB: 2uz5_A 2vcd_A* Length = 213 Back     alignment and structure
>3o5q_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 0.96A {Homo sapiens} PDB: 3o5m_A 3o5l_A 3o5o_A 3o5p_A 3o5r_A* 4drq_A* 3o5j_A 3o5g_A 3o5i_A 3o5k_A Length = 128 Back     alignment and structure
>1q6h_A FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; chaperone, peptidyl-prolyl isomerase, heat shock protein, FK family; HET: MSE; 1.97A {Escherichia coli} SCOP: d.26.1.1 PDB: 1q6i_A* 1q6u_A Length = 224 Back     alignment and structure
>2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} Length = 180 Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 Back     alignment and structure
>3o5e_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 1.60A {Homo sapiens} PDB: 3o5f_A Length = 144 Back     alignment and structure
>1yat_A FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} SCOP: d.26.1.1 Length = 113 Back     alignment and structure
>2lgo_A FKBP; infectious disease, isomerase, giardiasis, ssgcid, structura genomics, seattle structural genomics center for infectious; NMR {Giardia lamblia} Length = 130 Back     alignment and structure
>1r9h_A FKB-6, FK506 binding protein family; structural genomics, peptidylprolyl isomerase, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: d.26.1.1 Length = 135 Back     alignment and structure
>1jvw_A Macrophage infectivity potentiator; chagas disease, X-RAY rotamase, isomeras; 1.70A {Trypanosoma cruzi} SCOP: d.26.1.1 Length = 167 Back     alignment and structure
>3oe2_A Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, FK506; HET: TAR SRT; 1.60A {Pseudomonas syringae PV} Length = 219 Back     alignment and structure
>2ppn_A FK506-binding protein 1A; high resolution protein structure, isomerase; 0.92A {Homo sapiens} SCOP: d.26.1.1 PDB: 1b6c_A 1a7x_A 1d7h_A 1d7i_A 1d7j_A* 1f40_A* 1fap_A* 1d6o_A* 1fkd_A* 1fkf_A* 1fkg_A* 1fkh_A* 1fki_A* 1fkj_A* 1fkr_A 1fks_A 1fkt_A 1j4h_A* 1j4i_A* 1j4r_A* ... Length = 107 Back     alignment and structure
>2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* 3ni6_A 3pa7_A Length = 129 Back     alignment and structure
>2pbc_A FK506-binding protein 2; endoplasmic reticulum, isomerase, polymorphism, rotamase, structural genomics, structural genomics consortium, SGC; 1.80A {Homo sapiens} Length = 102 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>3kz7_A FK506-binding protein 3; FKPB ppiase rapamycin, isomerase, nucleus, phosphoprotein, R isomerase-inhibitor complex; HET: RAP; 1.95A {Mus musculus} PDB: 1pbk_A* Length = 119 Back     alignment and structure
>4dip_A Peptidyl-prolyl CIS-trans isomerase FKBP14; structural genomics, structural genomics consortium, SGC, PE prolyl CIS-trans isomerase; 1.82A {Homo sapiens} Length = 125 Back     alignment and structure
>2awg_A 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 inhibitor, SHH signalling antagonist, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 2f2d_A 3ey6_A Length = 118 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
>2d9f_A FK506-binding protein 8 variant; FKBP, rapamycin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 135 Back     alignment and structure
>2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens} Length = 157 Back     alignment and structure
>4dt4_A FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; FKBP domain, IF domain, chaperone, peptidyl-prolyl isomerase isomerase; 1.35A {Escherichia coli} Length = 169 Back     alignment and structure
>2k8i_A SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, chaperone, rotamase; NMR {Escherichia coli} Length = 171 Back     alignment and structure
>2kfw_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD; protein, cobalt, copper, cytoplasm, metal- binding, nickel, rotamase, zinc; NMR {Escherichia coli} Length = 196 Back     alignment and structure
>2kr7_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; protein, rotamase; NMR {Helicobacter pylori} Length = 151 Back     alignment and structure
>1ix5_A FKBP; ppiase, isomerase; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.26.1.1 Length = 151 Back     alignment and structure
>3pr9_A FKBP-type peptidyl-prolyl CIS-trans isomerase; FKBP protein, chaperone; 1.95A {Methanocaldococcus jannaschii} PDB: 3pra_A Length = 157 Back     alignment and structure
>3cgm_A SLYD, peptidyl-prolyl CIS-trans isomerase; chaperone function, two domain P rotamase; 2.41A {Thermus thermophilus} PDB: 3cgn_A 3luo_A* Length = 158 Back     alignment and structure
>3prb_A FKBP-type peptidyl-prolyl CIS-trans isomerase; chaperone; 2.20A {Methanocaldococcus jannaschii} PDB: 3prd_A Length = 231 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query218
2lkn_A165 AH receptor-interacting protein; FKBP-type domain, 99.88
2y78_A133 Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, 99.88
1yat_A113 FK506 binding protein; HET: FK5; 2.50A {Saccharomy 99.87
2lgo_A130 FKBP; infectious disease, isomerase, giardiasis, s 99.87
1u79_A129 FKBP-type peptidyl-prolyl CIS-trans isomerase 3; T 99.86
3kz7_A119 FK506-binding protein 3; FKPB ppiase rapamycin, is 99.86
2ppn_A107 FK506-binding protein 1A; high resolution protein 99.86
1jvw_A167 Macrophage infectivity potentiator; chagas disease 99.86
3o5q_A128 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 99.86
3o5e_A144 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 99.86
4dip_A125 Peptidyl-prolyl CIS-trans isomerase FKBP14; struct 99.85
3uf8_A209 Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- 99.85
1r9h_A135 FKB-6, FK506 binding protein family; structural ge 99.85
2f4e_A180 ATFKBP42; FKBP-like, alpha-beta, signaling protein 99.85
3b7x_A134 FK506-binding protein 6; isomerase, repeat, rotama 99.84
1fd9_A213 Protein (macrophage infectivity potentiator prote; 99.84
3oe2_A219 Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, 99.84
1q6h_A224 FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; 99.84
2vn1_A129 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR 99.83
2jwx_A157 FKBP38NTD, FK506-binding protein 8 variant; apopto 99.83
2awg_A118 38 kDa FK-506 binding protein; FKBP-type, ppiase, 99.81
2d9f_A135 FK506-binding protein 8 variant; FKBP, rapamycin, 99.78
1q1c_A 280 FK506-binding protein 4; rotamase, TPR repeat, nuc 99.78
2if4_A 338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.76
2pbc_A102 FK506-binding protein 2; endoplasmic reticulum, is 99.76
3jxv_A356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 99.75
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.74
4dt4_A169 FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; 99.71
3jxv_A 356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 99.71
3pr9_A157 FKBP-type peptidyl-prolyl CIS-trans isomerase; FKB 99.7
1ix5_A151 FKBP; ppiase, isomerase; NMR {Methanothermococcust 99.67
2kr7_A151 FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; 99.66
3prb_A 231 FKBP-type peptidyl-prolyl CIS-trans isomerase; cha 99.64
2kfw_A 196 FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD 99.63
2k8i_A171 SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, 99.63
1q1c_A280 FK506-binding protein 4; rotamase, TPR repeat, nuc 99.63
1hxv_A113 Trigger factor; FKBP fold, ppiase, chaperone; NMR 99.6
3cgm_A158 SLYD, peptidyl-prolyl CIS-trans isomerase; chapero 99.55
1p5q_A 336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.46
1w26_A 432 Trigger factor, TF; chaperone, protein folding, ri 99.25
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.09
1t11_A 392 Trigger factor, TF; helix-turn-helix, four-helix-b 99.07
3gty_X 433 Trigger factor, TF; chaperone-client complex, cell 97.69
>2lkn_A AH receptor-interacting protein; FKBP-type domain, immunophilin homolog, protein binding; NMR {Homo sapiens} Back     alignment and structure
Probab=99.88  E-value=1.4e-23  Score=166.39  Aligned_cols=85  Identities=25%  Similarity=0.472  Sum_probs=80.6

Q ss_pred             CCCceEEEEeecCCCCCC--CCCCeEEEEEEEEeCC--CcEEeccccCCCCEEEEeCCCCChHHHHHHHccCCCCcEEEE
Q 027802          131 RDSGLIYRDFEVGKGDCP--KDGQQVIFHYIGYNES--GRRIDSTYLQGSPARIRMGTNALVPGFEEGIRDMRPGGKRRI  206 (218)
Q Consensus       131 ~~~g~~y~~~~~G~G~~~--~~gd~V~v~Y~~~~~d--G~~~dss~~~~~p~~f~lG~~~~i~Gle~aL~gmk~Ge~~~~  206 (218)
                      +++||+|+++++|+|+.|  ++||.|+|||++++.|  |++||||+++++|+.|.+|.+++|+||+++|.+|++||+++|
T Consensus         8 ~~~Gv~~~vl~~G~G~~p~~~~G~~V~vhY~g~l~d~~G~~FDsS~~rg~P~~f~lG~g~vI~Gwd~gl~~M~~Ge~~~~   87 (165)
T 2lkn_A            8 REDGIQKRVIQEGRGELPDFQDGTKATFHYRTLHSDDEGTVLDDSRARGKPMELIIGKKFKLPVWETIVCTMREGEIAQF   87 (165)
T ss_dssp             HTTSCCCCEEECCSSCCCCCCTTCEEEEECEEECSSSSCCEEEESTTTTCCEEEESSSSCSCSHHHHHHTTCCTTCEEEE
T ss_pred             cCCCeEEEEEECCcCCCCCCCCCCEEEEEEEEEEeCCCccEEEecccCCCCEEEEecCCCccHHHHHHHhcCccCceEEE
Confidence            579999999999999754  6899999999999864  999999999999999999999999999999999999999999


Q ss_pred             EeCCCCCCC
Q 027802          207 IIPPELGPP  215 (218)
Q Consensus       207 ~iP~~layg  215 (218)
                      +|||+++||
T Consensus        88 ~ipp~laYG   96 (165)
T 2lkn_A           88 LCDIKHVVL   96 (165)
T ss_dssp             ECCHHHHSS
T ss_pred             EECHHHhcC
Confidence            999999998
>2y78_A Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, virulence; HET: SO4 GOL; 0.91A {Burkholderia pseudomallei} PDB: 2ke0_A 2ko7_A* 2l2s_A* 4dz2_A* 4dz3_A* Back     alignment and structure
>1yat_A FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} SCOP: d.26.1.1 Back     alignment and structure
>2lgo_A FKBP; infectious disease, isomerase, giardiasis, ssgcid, structura genomics, seattle structural genomics center for infectious; NMR {Giardia lamblia} Back     alignment and structure
>1u79_A FKBP-type peptidyl-prolyl CIS-trans isomerase 3; TFKBP13, FK-506 binding protein; 1.85A {Arabidopsis thaliana} SCOP: d.26.1.1 PDB: 1y0o_A Back     alignment and structure
>3kz7_A FK506-binding protein 3; FKPB ppiase rapamycin, isomerase, nucleus, phosphoprotein, R isomerase-inhibitor complex; HET: RAP; 1.95A {Mus musculus} SCOP: d.26.1.1 PDB: 1pbk_A* Back     alignment and structure
>2ppn_A FK506-binding protein 1A; high resolution protein structure, isomerase; 0.92A {Homo sapiens} SCOP: d.26.1.1 PDB: 1b6c_A 1a7x_A 1d7h_A 1d7i_A 1d7j_A* 1f40_A* 1fap_A* 1d6o_A* 1fkd_A* 1fkf_A* 1fkg_A* 1fkh_A* 1fki_A* 1fkj_A* 1fkr_A 1fks_A 1fkt_A 1j4h_A* 1j4i_A* 1j4r_A* ... Back     alignment and structure
>1jvw_A Macrophage infectivity potentiator; chagas disease, X-RAY rotamase, isomeras; 1.70A {Trypanosoma cruzi} SCOP: d.26.1.1 Back     alignment and structure
>3o5q_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 0.96A {Homo sapiens} PDB: 3o5m_A 3o5l_A 3o5o_A 3o5p_A 3o5r_A* 4drk_A* 4drm_A* 4drn_A* 4dro_A* 4drp_A* 4drq_A* 3o5j_A 3o5g_A 3o5i_A 3o5k_A Back     alignment and structure
>3o5e_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 1.60A {Homo sapiens} PDB: 3o5f_A Back     alignment and structure
>4dip_A Peptidyl-prolyl CIS-trans isomerase FKBP14; structural genomics, structural genomics consortium, SGC, PE prolyl CIS-trans isomerase; 1.82A {Homo sapiens} Back     alignment and structure
>3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 4giv_A* 1euv_B 3v60_A 3v61_A 3v62_A* Back     alignment and structure
>1r9h_A FKB-6, FK506 binding protein family; structural genomics, peptidylprolyl isomerase, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: d.26.1.1 Back     alignment and structure
>2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} Back     alignment and structure
>3b7x_A FK506-binding protein 6; isomerase, repeat, rotamase, TPR repeat, williams-beuren syndrome, structural genomics consortium, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>1fd9_A Protein (macrophage infectivity potentiator prote; FKBP domain, long alpha helix, dimerisation VIA helical INTE isomerase; 2.41A {Legionella pneumophila} SCOP: d.26.1.1 PDB: 2uz5_A 2vcd_A* Back     alignment and structure
>3oe2_A Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, FK506; HET: TAR SRT; 1.60A {Pseudomonas syringae PV} SCOP: d.26.1.0 Back     alignment and structure
>1q6h_A FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; chaperone, peptidyl-prolyl isomerase, heat shock protein, FK family; HET: MSE; 1.97A {Escherichia coli} SCOP: d.26.1.1 PDB: 1q6i_A* 1q6u_A Back     alignment and structure
>2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* 3ni6_A 3pa7_A Back     alignment and structure
>2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens} Back     alignment and structure
>2awg_A 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 inhibitor, SHH signalling antagonist, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 2f2d_A 3ey6_A Back     alignment and structure
>2d9f_A FK506-binding protein 8 variant; FKBP, rapamycin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2pbc_A FK506-binding protein 2; endoplasmic reticulum, isomerase, polymorphism, rotamase, structural genomics, structural genomics consortium, SGC; 1.80A {Homo sapiens} Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>4dt4_A FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; FKBP domain, IF domain, chaperone, peptidyl-prolyl isomerase isomerase; 1.35A {Escherichia coli} Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Back     alignment and structure
>3pr9_A FKBP-type peptidyl-prolyl CIS-trans isomerase; FKBP protein, chaperone; 1.95A {Methanocaldococcus jannaschii} SCOP: d.26.1.0 PDB: 3pra_A Back     alignment and structure
>1ix5_A FKBP; ppiase, isomerase; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.26.1.1 Back     alignment and structure
>2kr7_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; protein, rotamase; NMR {Helicobacter pylori} Back     alignment and structure
>3prb_A FKBP-type peptidyl-prolyl CIS-trans isomerase; chaperone; 2.20A {Methanocaldococcus jannaschii} PDB: 3prd_A Back     alignment and structure
>2kfw_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD; protein, cobalt, copper, cytoplasm, metal- binding, nickel, rotamase, zinc; NMR {Escherichia coli} Back     alignment and structure
>2k8i_A SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, chaperone, rotamase; NMR {Escherichia coli} Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Back     alignment and structure
>1hxv_A Trigger factor; FKBP fold, ppiase, chaperone; NMR {Mycoplasma genitalium} SCOP: d.26.1.1 Back     alignment and structure
>3cgm_A SLYD, peptidyl-prolyl CIS-trans isomerase; chaperone function, two domain P rotamase; 2.41A {Thermus thermophilus} PDB: 3cgn_A 3luo_A* Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1w26_A Trigger factor, TF; chaperone, protein folding, ribosome associated protein, nascent chain, cell division, isomerase; 2.7A {Escherichia coli} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 2vrh_A 1w2b_5 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1t11_A Trigger factor, TF; helix-turn-helix, four-helix-bundle, ppiase, chaperone; 2.50A {Vibrio cholerae} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 1l1p_A Back     alignment and structure
>3gty_X Trigger factor, TF; chaperone-client complex, cell cycle, cell division, chapero isomerase, rotamase, ribonucleoprotein, binding; 3.40A {Thermotoga maritima} PDB: 3gu0_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 218
d1q6ha_210 d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 5e-16
d1r9ha_118 d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabd 7e-15
d1q1ca1120 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Hu 7e-14
d1u79a_125 d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis tha 7e-14
d1fd9a_204 d.26.1.1 (A:) Macrophage infectivity potentiator p 1e-13
d1yata_113 d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeas 2e-13
d1kt1a2111 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Mo 3e-13
d2ppna1107 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12) 2e-12
d1kt1a3115 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {M 8e-12
d1q1ca2117 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {H 1e-11
d1pbka_116 d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 4e-08
d1ix5a_151 d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcu 5e-08
d1hxva_85 d.26.1.1 (A:) Trigger factor PPIase domain {Mycopl 3e-07
>d1q6ha_ d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase FkpA {Escherichia coli [TaxId: 562]} Length = 210 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: FKBP-like
superfamily: FKBP-like
family: FKBP immunophilin/proline isomerase
domain: Peptidyl-prolyl cis-trans isomerase FkpA
species: Escherichia coli [TaxId: 562]

 Score = 71.4 bits (174), Expect = 5e-16
 Identities = 34/126 (26%), Positives = 61/126 (48%), Gaps = 10/126 (7%)

Query: 88  YDEKRLLEQNKRMQKENSAPEGFPNFIREGFEVKVVTSENYTKRDSGLIYRDFEVGKGDC 147
                  +  K      +  + +     +   VK           +GL+Y+  E GKG+ 
Sbjct: 70  VKSSAQAKMEKDAADNEAKGKEYREKFAKEKGVK--------TSSTGLVYQVVEAGKGEA 121

Query: 148 PKDGQQVIFHYIGYNESGRRIDSTYLQGSPARIRMGTNALVPGFEEGIRDMRPGGKRRII 207
           PKD   V+ +Y G    G+  D++Y +G P   R+    ++PG+ EG+++++ GGK +++
Sbjct: 122 PKDSDTVVVNYKGTLIDGKEFDNSYTRGEPLSFRLD--GVIPGWTEGLKNIKKGGKIKLV 179

Query: 208 IPPELG 213
           IPPEL 
Sbjct: 180 IPPELA 185
>d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} Length = 118 Back     information, alignment and structure
>d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 120 Back     information, alignment and structure
>d1u79a_ d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 125 Back     information, alignment and structure
>d1fd9a_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Legionella pneumophila [TaxId: 446]} Length = 204 Back     information, alignment and structure
>d1yata_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 113 Back     information, alignment and structure
>d1kt1a2 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 111 Back     information, alignment and structure
>d2ppna1 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1kt1a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 115 Back     information, alignment and structure
>d1q1ca2 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1pbka_ d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 9606]} Length = 116 Back     information, alignment and structure
>d1ix5a_ d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcus thermolithotrophicus [TaxId: 2186]} Length = 151 Back     information, alignment and structure
>d1hxva_ d.26.1.1 (A:) Trigger factor PPIase domain {Mycoplasma genitalium [TaxId: 2097]} Length = 85 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query218
d1r9ha_118 FKB-6, N-terminal domain {Caenorhabditis elegans [ 99.88
d1q1ca1120 FKBP52, N-terminal domains {Human (Homo sapiens) [ 99.88
d2ppna1107 FK-506 binding protein (FKBP12), an immunophilin { 99.88
d1q6ha_210 Peptidyl-prolyl cis-trans isomerase FkpA {Escheric 99.88
d1yata_113 Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyc 99.88
d1u79a_125 FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 99.87
d1fd9a_204 Macrophage infectivity potentiator protein (MIP) { 99.87
d1kt1a2111 FKBP51, N-terminal domains {Monkey (Saimiri bolivi 99.87
d1pbka_116 FKBP25 {Human (Homo sapiens) [TaxId: 9606]} 99.84
d1jvwa_160 Macrophage infectivity potentiator protein (MIP) { 99.83
d1kt1a3115 FKBP51, N-terminal domains {Monkey (Saimiri bolivi 99.75
d1q1ca2117 FKBP52, N-terminal domains {Human (Homo sapiens) [ 99.69
d1ix5a_151 Archaeal FKBP {Archaeon Methanococcus thermolithot 99.64
d1hxva_85 Trigger factor PPIase domain {Mycoplasma genitaliu 99.44
d1l1pa_106 Trigger factor PPIase domain {Escherichia coli [Ta 98.92
d1t11a3113 Trigger factor PPIase domain {Vibrio cholerae [Tax 98.8
>d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: FKBP-like
superfamily: FKBP-like
family: FKBP immunophilin/proline isomerase
domain: FKB-6, N-terminal domain
species: Caenorhabditis elegans [TaxId: 6239]

Probab=99.88  E-value=3.4e-23  Score=154.11  Aligned_cols=87  Identities=25%  Similarity=0.466  Sum_probs=83.0

Q ss_pred             CCCceEEEEeecCCCC-CCCCCCeEEEEEEEEeCCCcEEeccccCCCCEEEEeCCCCChHHHHHHHccCCCCcEEEEEeC
Q 027802          131 RDSGLIYRDFEVGKGD-CPKDGQQVIFHYIGYNESGRRIDSTYLQGSPARIRMGTNALVPGFEEGIRDMRPGGKRRIIIP  209 (218)
Q Consensus       131 ~~~g~~y~~~~~G~G~-~~~~gd~V~v~Y~~~~~dG~~~dss~~~~~p~~f~lG~~~~i~Gle~aL~gmk~Ge~~~~~iP  209 (218)
                      .++||+|+++++|+|. .|+.||.|++||++++.||++|++|+..++|+.|.+|.+.+++||+++|.+|++||+++++||
T Consensus         8 ~d~Gl~~~il~~G~G~~~p~~gd~V~v~y~~~l~dG~v~dss~~~~~p~~f~~g~~~vi~G~~~~l~~M~~Ge~~~~~ip   87 (118)
T d1r9ha_           8 KDGGVLKLIKKEGQGVVKPTTGTTVKVHYVGTLENGTKFDSSRDRGDQFSFNLGRGNVIKGWDLGVATMTKGEVAEFTIR   87 (118)
T ss_dssp             CCSSEEEEEEECCBSSCCCCTTCEEEEEEEEEETTSCEEEEHHHHTSCEEEETTTTSSCHHHHHHHTTCCBTCEEEEEEC
T ss_pred             CCCCEEEEEEECcCCCCCCCCCCEEEEEEEEEEcCCCEEEEccccceeeeeeccCcceeeeeeeeeeeecCCceEEEEEC
Confidence            5689999999999996 699999999999999999999999998889999999999999999999999999999999999


Q ss_pred             CCCCCCCC
Q 027802          210 PELGPPVS  217 (218)
Q Consensus       210 ~~layg~~  217 (218)
                      |++|||+.
T Consensus        88 p~laYG~~   95 (118)
T d1r9ha_          88 SDYGYGDA   95 (118)
T ss_dssp             GGGTTTTT
T ss_pred             HHHhCCcC
Confidence            99999974
>d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ppna1 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q6ha_ d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase FkpA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yata_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u79a_ d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1fd9a_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1kt1a2 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1pbka_ d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jvwa_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1kt1a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1q1ca2 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ix5a_ d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcus thermolithotrophicus [TaxId: 2186]} Back     information, alignment and structure
>d1hxva_ d.26.1.1 (A:) Trigger factor PPIase domain {Mycoplasma genitalium [TaxId: 2097]} Back     information, alignment and structure
>d1l1pa_ d.26.1.1 (A:) Trigger factor PPIase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t11a3 d.26.1.1 (A:135-247) Trigger factor PPIase domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure