Citrus Sinensis ID: 027818

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------22

MSSLRNALPRRAHKERAQPQSRKKFGLLEKHKDYVIRAKAYHKKEESIRRLKEKAAFRNPDEFYFKMIKTKTVDGVHRLEGEANKYTQEELMLMKTQDIGYVLQKLQSERNKIEKLTTMLHSLDNNPSSRHVYFAEDREEAKEIKSQSGRKDALPDFDDIPDHIKRKTAASYRELEGRKKRVQELEKLYMDMSLHKELQVSNDLLLPFSIRLLCWTWT

cccccccccccccccccccHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHcccccEEEEccccccccHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEccHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccEEccc

************************FGLLEKHKDYVIRAKAYHKKEES***L*EKAAFRNPDEFYFKMIKTKTVDGVHRLEGEANKYTQEELMLMKTQDIGYVLQKL*************************VYFAEDRE*********************************************LEKLYMDMSLHKELQVSNDLLLPFSIRLLCWTW*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MSSLRNALPRRAHKERAQPQSRKKFGLLEKHKDYVIRAKAYHKKEESIRRLKEKAAFRNPDEFYFKMIKTKTVDGVHRLEGEANKYTQEELMLMKTQDIGYVLQKxxxxxxxxxxxxxxxxxxxxxPSSRHVYFAEDREEAKEIKSQSGRKDALPDFDDIPDHIKRKTAASYRELEGRKKRVQELEKLYMDMSLHKELQVSNDLLLPFSIRLLCWTWT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Probable U3 small nucleolar RNA-associated protein 11	Involved in nucleolar processing of pre-18S ribosomal RNA.	confident	Q8S1Z1
Probable U3 small nucleolar RNA-associated protein 11	Involved in nucleolar processing of pre-18S ribosomal RNA.	probable	Q9M223

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!