Citrus Sinensis ID: 027839

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------22
MAINLFSTYLLIFSIIAGVLAVDPDTLQDVCVADTSSVKVNGFACKDSANITADDFFFAGLAKPGVVNNSVGSLVTAANVEKIPGLNTLGVSLSRIDYEAGGLNPPHTHPRATEMIFVLEGELDVGFISTADKLISKTVKKGEIYVFPKALVHFQKNNGDKPASVISAFNSQLPGTQSIAATLFTATPPVPDNVLTKAFQVGTKEIEKIKSKLAPKKT
cHHHHHHHHHHHHHHHHHHHccccccccEEEEcccccccccccccccccccccccccccccccccccccccccEEEEEcccccccccccccEEEEEEEcccccccccccccccEEEEEEEEEEEEEEEccccEEEEEEEEcccEEEEcccEEEEEEEcccccEEEEEEEcccccccccHHHHHHHccccccHHHHHHHccccHHHHHHHHHHcccccc
cHHHHHHHHHHHHHHHHHHHHcccccHHHEEEEcccccccccccEccHHHccccccccccccccccccccccEEEEEEcccccHHHcccccEEEEEEEccccEEEEEEcccccEEEEEEEcEEEEEEEccHHcEEEEEEEcccEEEEcccccEEEEEcccccEEEEEEEcccccccEEHHHHHHHccccccHHHHHHHHcccHHHHHHHHHHcccccc
MAINLFSTYLLIFSIIAGvlavdpdtlqdvcvadtssvkvngfackdsanitaddfffaglakpgvvnnsvGSLVTAanvekipglntlgvslsridyeagglnpphthpratEMIFVLEGELDVGFISTADKLISKTVKKGEIYVFPKALVHFQknngdkpaSVISAFnsqlpgtqSIAATlftatppvpdnvltKAFQVGTKEIEKIKSKLAPKKT
MAINLFSTYLLIFSIIAGVLAVDPDTLQDVCVADTSSVKVNGFACKDSANITADDFFFAGLAKPGVVNNSVGSLVTaanvekipglnTLGVSLSRIDYEAGGLNPPHTHPRATEMIFVLEGELDVGFISTADKLISKTVKKGEIYVFPKALVHFQKNNGDKPASVISAFNSQLPGTQSIAATLFTATPPVPDNVLTKafqvgtkeiekiksklapkkt
MAINLFSTYLLIFSIIAGVLAVDPDTLQDVCVADTSSVKVNGFACKDSANITADDFFFAGLAKPGVVNNSVGSLVTAANVEKIPGLNTLGVSLSRIDYEAGGLNPPHTHPRATEMIFVLEGELDVGFISTADKLISKTVKKGEIYVFPKALVHFQKNNGDKPASVISAFNSQLPGTQSIAATLFTATPPVPDNVLTKAFQVGTKEIEKIKSKLAPKKT
**INLFSTYLLIFSIIAGVLAVDPDTLQDVCVADTSSVKVNGFACKDSANITADDFFFAGLAKPGVVNNSVGSLVTAANVEKIPGLNTLGVSLSRIDYEAGGLNPPHTHPRATEMIFVLEGELDVGFISTADKLISKTVKKGEIYVFPKALVHFQKNN*****SVISAFNSQLPGTQSIAATLFTATPPVPDNVLTKAFQVG****************
***NLFSTYLLIFSIIAGVLAVDPDTLQDVCVADTSSVKVNGFACKDSANITADDFFFAGLAKPGVVNNSVGSLVTAANVEKIPGLNTLGVSLSRIDYEAGGLNPPHTHPRATEMIFVLEGELDVGFISTADKLISKTVKKGEIYVFPKALVHFQKNNGDKPASVISAFNSQLPGTQSIAATLFTATPPVPDNVLTKAFQVGTKEIEK***K******
MAINLFSTYLLIFSIIAGVLAVDPDTLQDVCVADTSSVKVNGFACKDSANITADDFFFAGLAKPGVVNNSVGSLVTAANVEKIPGLNTLGVSLSRIDYEAGGLNPPHTHPRATEMIFVLEGELDVGFISTADKLISKTVKKGEIYVFPKALVHFQKNNGDKPASVISAFNSQLPGTQSIAATLFTATPPVPDNVLTKAFQVGTKEIEKI*********
*AINLFSTYLLIFSIIAGVLAVDPDTLQDVCVADTSSVKVNGFACKDSANITADDFFFAGLAKPGVVNNSVGSLVTAANVEKIPGLNTLGVSLSRIDYEAGGLNPPHTHPRATEMIFVLEGELDVGFISTADKLISKTVKKGEIYVFPKALVHFQKNNGDKPASVISAFNSQLPGTQSIAATLFTATPPVPDNVLTKAFQVGTKEIEKIKSKLA****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAINLFSTYLLIFSIIAGVLAVDPDTLQDVCVADTSSVKVNGFACKDSANITADDFFFAGLAKPGVVNNSVGSLVTAANVEKIPGLNTLGVSLSRIDYEAGGLNPPHTHPRATEMIFVLEGELDVGFISTADKLISKTVKKGEIYVFPKALVHFQKNNGDKPASVISAFNSQLPGTQSIAATLFTATPPVPDNVLTKAFQVGTKEIEKIKSKLAPKKT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query218 2.2.26 [Sep-21-2011]
Q9M263220 Germin-like protein subfa yes no 0.995 0.986 0.744 1e-89
Q6I544221 Germin-like protein 5-1 O yes no 0.894 0.882 0.747 2e-83
Q9FZ27219 Germin-like protein subfa no no 0.931 0.926 0.681 1e-80
P94014219 Germin-like protein subfa no no 0.903 0.899 0.696 1e-79
Q9S8P4217 Rhicadhesin receptor OS=P N/A no 0.857 0.861 0.728 2e-77
Q94EG3229 Nectarin-1 OS=Nicotiana l N/A no 0.949 0.903 0.657 3e-76
Q942A8223 Germin-like protein 1-3 O no no 0.995 0.973 0.612 5e-74
Q9SPV5229 Nectarin-1 OS=Nicotiana p N/A no 0.949 0.903 0.638 1e-73
Q7XZY1222 Putative germin-like prot no no 0.990 0.972 0.588 2e-71
O65252213 Probable germin-like prot no no 0.958 0.981 0.582 5e-69
>sp|Q9M263|GL24_ARATH Germin-like protein subfamily 2 member 4 OS=Arabidopsis thaliana GN=GLP10 PE=2 SV=1 Back     alignment and function desciption
 Score =  328 bits (842), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 163/219 (74%), Positives = 184/219 (84%), Gaps = 2/219 (0%)

Query: 1   MAINLFSTYLLIFSIIAGVLAVDPDTLQDVCVAD-TSSVKVNGFACKDSANITADDFFFA 59
           M    F  +  + S+   VLA DPDTLQD+CVAD TS +KVNGF CK  +NITA DFFFA
Sbjct: 1   MDSRCFGFFFTLLSLNVIVLAYDPDTLQDLCVADRTSGIKVNGFTCKPESNITASDFFFA 60

Query: 60  GLAKPGVVNNSVGSLVTAANVEKIPGLNTLGVSLSRIDYEAGGLNPPHTHPRATEMIFVL 119
           G+ KP VVNN+VGS VT ANVEKI GLNTLGVSL+RIDY  GGLNPPHTHPRATE+IFVL
Sbjct: 61  GIGKPAVVNNTVGSAVTGANVEKIAGLNTLGVSLARIDYAPGGLNPPHTHPRATEVIFVL 120

Query: 120 EGELDVGFISTADKLISKTVKKGEIYVFPKALVHFQKNNGD-KPASVISAFNSQLPGTQS 178
           EGELDVGFI+TA+KL +KTVKKGE++VFP+ L+H+QKNN   KPASVISAFNSQLPGTQS
Sbjct: 121 EGELDVGFITTANKLFAKTVKKGEVFVFPRGLIHYQKNNDKAKPASVISAFNSQLPGTQS 180

Query: 179 IAATLFTATPPVPDNVLTKAFQVGTKEIEKIKSKLAPKK 217
           IAATLFTATP +PD+VLT  FQ+GTKEIEKIKSK APKK
Sbjct: 181 IAATLFTATPAIPDHVLTTTFQIGTKEIEKIKSKFAPKK 219
May play a role in plant defense. Probably has no oxalate oxidase activity even if the active site is conserved.
Arabidopsis thaliana (taxid: 3702)
>sp|Q6I544|GL52_ORYSJ Germin-like protein 5-1 OS=Oryza sativa subsp. japonica GN=Os05g0277500 PE=2 SV=1 Back     alignment and function description
>sp|Q9FZ27|GL22_ARATH Germin-like protein subfamily 2 member 2 OS=Arabidopsis thaliana GN=At1g02335 PE=2 SV=1 Back     alignment and function description
>sp|P94014|GL21_ARATH Germin-like protein subfamily 2 member 1 OS=Arabidopsis thaliana GN=GLP4 PE=2 SV=2 Back     alignment and function description
>sp|Q9S8P4|RHRE_PEA Rhicadhesin receptor OS=Pisum sativum GN=GER1 PE=1 SV=2 Back     alignment and function description
>sp|Q94EG3|NEC1_NICLS Nectarin-1 OS=Nicotiana langsdorffii x Nicotiana sanderae GN=NECI PE=1 SV=1 Back     alignment and function description
>sp|Q942A8|GL13_ORYSJ Germin-like protein 1-3 OS=Oryza sativa subsp. japonica GN=GER8 PE=2 SV=1 Back     alignment and function description
>sp|Q9SPV5|NEC1_NICPL Nectarin-1 OS=Nicotiana plumbaginifolia GN=NEC1 PE=1 SV=1 Back     alignment and function description
>sp|Q7XZY1|GL32_ORYSJ Putative germin-like protein 3-2 OS=Oryza sativa subsp. japonica GN=Os03g0651800 PE=3 SV=1 Back     alignment and function description
>sp|O65252|GL25_ARATH Probable germin-like protein subfamily 2 member 5 OS=Arabidopsis thaliana GN=At5g26700 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query218
255548187220 Rhicadhesin receptor precursor, putative 0.963 0.954 0.829 4e-96
224068291217 predicted protein [Populus trichocarpa] 0.967 0.972 0.816 4e-95
224130778217 predicted protein [Populus trichocarpa] 0.967 0.972 0.806 5e-94
118484187217 unknown [Populus trichocarpa] 0.967 0.972 0.801 5e-94
225450411217 PREDICTED: germin-like protein 2 [Vitis 0.958 0.963 0.780 2e-93
225437732217 PREDICTED: germin-like protein subfamily 0.958 0.963 0.757 9e-89
297821088220 hypothetical protein ARALYDRAFT_486710 [ 0.995 0.986 0.744 1e-88
15228673220 germin-like protein subfamily 2 member 4 0.995 0.986 0.744 8e-88
196122036221 germin-like protein 16 [Glycine max] 0.986 0.972 0.726 2e-87
351723805221 uncharacterized protein LOC100499768 pre 0.986 0.972 0.726 4e-87
>gi|255548187|ref|XP_002515150.1| Rhicadhesin receptor precursor, putative [Ricinus communis] gi|223545630|gb|EEF47134.1| Rhicadhesin receptor precursor, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  356 bits (913), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 175/211 (82%), Positives = 191/211 (90%), Gaps = 1/211 (0%)

Query: 9   YLLIFSIIAGVLAVDPDTLQDVCVADTSS-VKVNGFACKDSANITADDFFFAGLAKPGVV 67
           +L+ F++I   LA DPD LQD+CVA+ SS  K+NGF CKD AN+TA+DFFF GLAKPG+V
Sbjct: 10  FLVFFTLIFASLAYDPDMLQDLCVAEKSSGTKLNGFPCKDEANVTANDFFFDGLAKPGIV 69

Query: 68  NNSVGSLVTAANVEKIPGLNTLGVSLSRIDYEAGGLNPPHTHPRATEMIFVLEGELDVGF 127
           NNSVGSLVT ANVEKIPGLNTLGVSLSRIDY   GLNPPHTHPRATEMIFVLEGELDVGF
Sbjct: 70  NNSVGSLVTGANVEKIPGLNTLGVSLSRIDYAPDGLNPPHTHPRATEMIFVLEGELDVGF 129

Query: 128 ISTADKLISKTVKKGEIYVFPKALVHFQKNNGDKPASVISAFNSQLPGTQSIAATLFTAT 187
           I+TA+K+ISKTVKKGEI+VFP+ LVHFQKNNGDK ASVISAFNSQLPGTQSIA TLFTA 
Sbjct: 130 ITTANKVISKTVKKGEIFVFPRGLVHFQKNNGDKAASVISAFNSQLPGTQSIAVTLFTAN 189

Query: 188 PPVPDNVLTKAFQVGTKEIEKIKSKLAPKKT 218
           PPVPDNVLTKAFQVGTKEIEKIKSKLAPKK+
Sbjct: 190 PPVPDNVLTKAFQVGTKEIEKIKSKLAPKKS 220

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224068291|ref|XP_002302696.1| predicted protein [Populus trichocarpa] gi|118482567|gb|ABK93204.1| unknown [Populus trichocarpa] gi|222844422|gb|EEE81969.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224130778|ref|XP_002320924.1| predicted protein [Populus trichocarpa] gi|222861697|gb|EEE99239.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|118484187|gb|ABK93974.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225450411|ref|XP_002278736.1| PREDICTED: germin-like protein 2 [Vitis vinifera] gi|111379986|gb|ABH09468.1| germin-like protein 2 [Vitis vinifera] gi|147838426|emb|CAN76588.1| hypothetical protein VITISV_020289 [Vitis vinifera] gi|296089868|emb|CBI39687.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225437732|ref|XP_002280619.1| PREDICTED: germin-like protein subfamily 2 member 4 [Vitis vinifera] gi|297744062|emb|CBI37032.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|297821088|ref|XP_002878427.1| hypothetical protein ARALYDRAFT_486710 [Arabidopsis lyrata subsp. lyrata] gi|297324265|gb|EFH54686.1| hypothetical protein ARALYDRAFT_486710 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15228673|ref|NP_191761.1| germin-like protein subfamily 2 member 4 [Arabidopsis thaliana] gi|18203246|sp|Q9M263.1|GL24_ARATH RecName: Full=Germin-like protein subfamily 2 member 4; Flags: Precursor gi|6899900|emb|CAB71909.1| germin-like protein (GLP10) [Arabidopsis thaliana] gi|117168221|gb|ABK32193.1| At3g62020 [Arabidopsis thaliana] gi|332646775|gb|AEE80296.1| germin-like protein subfamily 2 member 4 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|196122036|gb|ACG69492.1| germin-like protein 16 [Glycine max] Back     alignment and taxonomy information
>gi|351723805|ref|NP_001235756.1| uncharacterized protein LOC100499768 precursor [Glycine max] gi|255626421|gb|ACU13555.1| unknown [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query218
TAIR|locus:2079582220 GLP10 "germin-like protein 10" 0.972 0.963 0.757 1.9e-83
TAIR|locus:2827077219 GL22 "germin-like protein subf 0.931 0.926 0.681 1.2e-74
TAIR|locus:2012260219 GLP5 "germin-like protein 5" [ 0.963 0.958 0.661 2.5e-74
TAIR|locus:2074489219 GLP8 "germin-like protein 8" [ 0.972 0.968 0.594 4.7e-64
TAIR|locus:2146759213 AT5G26700 [Arabidopsis thalian 0.958 0.981 0.582 4.7e-64
TAIR|locus:2011306220 AT1G18980 [Arabidopsis thalian 0.958 0.95 0.460 8.8e-47
TAIR|locus:2011291220 GLP4 "germin-like protein 4" [ 0.954 0.945 0.462 2.3e-46
TAIR|locus:2152267223 AT5G38940 [Arabidopsis thalian 0.967 0.946 0.479 4.8e-46
TAIR|locus:2130020222 GLP9 "germin-like protein 9" [ 0.949 0.932 0.476 7.9e-46
TAIR|locus:2177167222 AT5G39130 [Arabidopsis thalian 0.944 0.927 0.465 1.6e-45
TAIR|locus:2079582 GLP10 "germin-like protein 10" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 836 (299.3 bits), Expect = 1.9e-83, P = 1.9e-83
 Identities = 162/214 (75%), Positives = 183/214 (85%)

Query:     6 FSTYLLIFSIIAGVLAVDPDTLQDVCVAD-TSSVKVNGFACKDSANITADDFFFAGLAKP 64
             F  +  + S+   VLA DPDTLQD+CVAD TS +KVNGF CK  +NITA DFFFAG+ KP
Sbjct:     6 FGFFFTLLSLNVIVLAYDPDTLQDLCVADRTSGIKVNGFTCKPESNITASDFFFAGIGKP 65

Query:    65 GVVNNSVGSLVTAANVEKIPGLNTLGVSLSRIDYEAGGLNPPHTHPRATEMIFVLEGELD 124
              VVNN+VGS VT ANVEKI GLNTLGVSL+RIDY  GGLNPPHTHPRATE+IFVLEGELD
Sbjct:    66 AVVNNTVGSAVTGANVEKIAGLNTLGVSLARIDYAPGGLNPPHTHPRATEVIFVLEGELD 125

Query:   125 VGFISTADKLISKTVKKGEIYVFPKALVHFQKNNGD-KPASVISAFNSQLPGTQSIAATL 183
             VGFI+TA+KL +KTVKKGE++VFP+ L+H+QKNN   KPASVISAFNSQLPGTQSIAATL
Sbjct:   126 VGFITTANKLFAKTVKKGEVFVFPRGLIHYQKNNDKAKPASVISAFNSQLPGTQSIAATL 185

Query:   184 FTATPPVPDNVLTKAFQVGTKEIEKIKSKLAPKK 217
             FTATP +PD+VLT  FQ+GTKEIEKIKSK APKK
Sbjct:   186 FTATPAIPDHVLTTTFQIGTKEIEKIKSKFAPKK 219
GO:0005576 "extracellular region" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0030145 "manganese ion binding" evidence=IEA
GO:0045735 "nutrient reservoir activity" evidence=IEA
GO:0048046 "apoplast" evidence=IEA
GO:0005618 "cell wall" evidence=IDA
GO:0009505 "plant-type cell wall" evidence=IDA
GO:0010413 "glucuronoxylan metabolic process" evidence=RCA
GO:0045492 "xylan biosynthetic process" evidence=RCA
TAIR|locus:2827077 GL22 "germin-like protein subfamily 2 member 2 precursor" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2012260 GLP5 "germin-like protein 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2074489 GLP8 "germin-like protein 8" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2146759 AT5G26700 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2011306 AT1G18980 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2011291 GLP4 "germin-like protein 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2152267 AT5G38940 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2130020 GLP9 "germin-like protein 9" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2177167 AT5G39130 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9S8P4RHRE_PEANo assigned EC number0.72870.85770.8617N/Ano
Q94EG3NEC1_NICLS1, ., 1, 5, ., 1, ., 10.65710.94950.9039N/Ano
Q9SPV5NEC1_NICPL1, ., 1, 5, ., 1, ., 10.63800.94950.9039N/Ano
Q9M263GL24_ARATHNo assigned EC number0.74420.99540.9863yesno
Q6I544GL52_ORYSJNo assigned EC number0.74740.89440.8823yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query218
smart00835146 smart00835, Cupin_1, Cupin 1e-36
pfam00190139 pfam00190, Cupin_1, Cupin 1e-35
pfam0788370 pfam07883, Cupin_2, Cupin domain 7e-11
COG1917131 COG1917, COG1917, Uncharacterized conserved protei 2e-09
pfam1297391 pfam12973, Cupin_7, ChrR Cupin-like domain 2e-04
COG0662127 COG0662, {ManC}, Mannose-6-phosphate isomerase [Ca 7e-04
COG3837161 COG3837, COG3837, Uncharacterized conserved protei 9e-04
TIGR04366132 TIGR04366, cupin_WbuC, cupin fold metalloprotein, 0.004
>gnl|CDD|214845 smart00835, Cupin_1, Cupin Back     alignment and domain information 
 Score =  125 bits (315), Expect = 1e-36
 Identities = 50/143 (34%), Positives = 79/143 (55%), Gaps = 3/143 (2%)

Query: 66  VVNNSVGSLVTAANVEKIPGLNTLGVSLSRIDYEAGGLNPPHTHPRATEMIFVLEGELDV 125
             +N  G L  A +    P LN LG+S +R++ E GG+ PPH HPRATE+++V+ GE  V
Sbjct: 6   DFSNEGGRLREA-DPTNFPALNGLGISAARVNLEPGGMLPPHYHPRATELLYVVRGEGRV 64

Query: 126 GFIST-ADKLISKTVKKGEIYVFPKALVHFQKNNGDKPASVISAFNSQLPGTQSIAATLF 184
           G +    +K+    +++G+++V P+   HFQ N+GD+      AFN+  P  +   A   
Sbjct: 65  GVVDPNGNKVYDARLREGDVFVVPQGHPHFQVNSGDENL-EFVAFNTNDPNRRFFLAGRN 123

Query: 185 TATPPVPDNVLTKAFQVGTKEIE 207
           +    +P  VL  AF V  +E+ 
Sbjct: 124 SVLRGLPPEVLAAAFGVSAEEVR 146

This family represents the conserved barrel domain of the 'cupin' superfamily ('cupa' is the Latin term for a small barrel). This family contains 11S and 7S plant seed storage proteins, and germins. Plant seed storage proteins provide the major nitrogen source for the developing plant. Length = 146
>gnl|CDD|215780 pfam00190, Cupin_1, Cupin Back     alignment and domain information
>gnl|CDD|219618 pfam07883, Cupin_2, Cupin domain Back     alignment and domain information
>gnl|CDD|224829 COG1917, COG1917, Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] Back     alignment and domain information
>gnl|CDD|193446 pfam12973, Cupin_7, ChrR Cupin-like domain Back     alignment and domain information
>gnl|CDD|223734 COG0662, {ManC}, Mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|226357 COG3837, COG3837, Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] Back     alignment and domain information
>gnl|CDD|213979 TIGR04366, cupin_WbuC, cupin fold metalloprotein, WbuC family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 218
TIGR03404367 bicupin_oxalic bicupin, oxalate decarboxylase fami 99.94
PLN00212493 glutelin; Provisional 99.91
TIGR03404 367 bicupin_oxalic bicupin, oxalate decarboxylase fami 99.88
PF00190144 Cupin_1: Cupin; InterPro: IPR006045 This family re 99.87
smart00835146 Cupin_1 Cupin. This family represents the conserve 99.83
PLN00212 493 glutelin; Provisional 99.8
COG2140209 Thermophilic glucose-6-phosphate isomerase and rel 99.76
PF0788371 Cupin_2: Cupin domain; InterPro: IPR013096 This fa 99.48
COG0662127 {ManC} Mannose-6-phosphate isomerase [Carbohydrate 99.46
COG1917131 Uncharacterized conserved protein, contains double 99.39
PRK13290125 ectC L-ectoine synthase; Reviewed 99.38
PRK04190191 glucose-6-phosphate isomerase; Provisional 99.33
COG3837161 Uncharacterized conserved protein, contains double 99.28
PRK11171266 hypothetical protein; Provisional 99.23
PRK09943185 DNA-binding transcriptional repressor PuuR; Provis 99.2
TIGR01479468 GMP_PMI mannose-1-phosphate guanylyltransferase/ma 99.19
PRK15460478 cpsB mannose-1-phosphate guanyltransferase; Provis 99.18
PF01050151 MannoseP_isomer: Mannose-6-phosphate isomerase; In 99.15
COG4101142 Predicted mannose-6-phosphate isomerase [Carbohydr 99.08
TIGR03214260 ura-cupin putative allantoin catabolism protein. T 99.01
PRK11171266 hypothetical protein; Provisional 98.96
TIGR03214260 ura-cupin putative allantoin catabolism protein. T 98.96
PF02041167 Auxin_BP: Auxin binding protein; InterPro: IPR0005 98.84
PF06560182 GPI: Glucose-6-phosphate isomerase (GPI); InterPro 98.71
PRK13264177 3-hydroxyanthranilate 3,4-dioxygenase; Provisional 98.67
TIGR03037159 anthran_nbaC 3-hydroxyanthranilate 3,4-dioxygenase 98.67
PF02311136 AraC_binding: AraC-like ligand binding domain; Int 98.51
PF1169985 CENP-C_C: Mif2/CENP-C like; PDB: 2VPV_B. 98.5
PF03079157 ARD: ARD/ARD' family; InterPro: IPR004313 The two 98.42
PRK15457233 ethanolamine utilization protein EutQ; Provisional 98.39
TIGR02451215 anti_sig_ChrR anti-sigma factor, putative, ChrR fa 98.38
PF1297391 Cupin_7: ChrR Cupin-like domain; PDB: 3O14_B 2Z2S_ 98.37
PRK10371 302 DNA-binding transcriptional regulator MelR; Provis 98.33
COG1791181 Uncharacterized conserved protein, contains double 98.3
PF14499251 DUF4437: Domain of unknown function (DUF4437); PDB 98.17
COG4297163 Uncharacterized protein containing double-stranded 98.17
PF06339126 Ectoine_synth: Ectoine synthase; InterPro: IPR0104 98.13
TIGR02272 335 gentisate_1_2 gentisate 1,2-dioxygenase. This fami 98.09
PRK10296 278 DNA-binding transcriptional regulator ChbR; Provis 98.02
COG3257264 GlxB Uncharacterized protein, possibly involved in 98.02
PRK13501 290 transcriptional activator RhaR; Provisional 97.99
PF05523131 FdtA: WxcM-like, C-terminal ; InterPro: IPR008894 97.98
TIGR02297 287 HpaA 4-hydroxyphenylacetate catabolism regulatory 97.95
PRK13500 312 transcriptional activator RhaR; Provisional 97.93
PRK13503 278 transcriptional activator RhaS; Provisional 97.88
PF06052151 3-HAO: 3-hydroxyanthranilic acid dioxygenase; Inte 97.8
PRK13502 282 transcriptional activator RhaR; Provisional 97.78
KOG2107179 consensus Uncharacterized conserved protein, conta 97.69
PF0589974 Cupin_3: Protein of unknown function (DUF861); Int 97.67
COG3435 351 Gentisate 1,2-dioxygenase [Secondary metabolites b 97.65
PF05995175 CDO_I: Cysteine dioxygenase type I; InterPro: IPR0 97.64
TIGR02272335 gentisate_1_2 gentisate 1,2-dioxygenase. This fami 97.56
PF06249152 EutQ: Ethanolamine utilisation protein EutQ; Inter 97.48
COG4766176 EutQ Ethanolamine utilization protein [Amino acid 97.35
COG1898173 RfbC dTDP-4-dehydrorhamnose 3,5-epimerase and rela 97.08
TIGR01221176 rmlC dTDP-4-dehydrorhamnose 3,5-epimerase. This en 96.88
COG3450116 Predicted enzyme of the cupin superfamily [General 96.88
PF00908176 dTDP_sugar_isom: dTDP-4-dehydrorhamnose 3,5-epimer 96.83
COG3435351 Gentisate 1,2-dioxygenase [Secondary metabolites b 96.78
PF04209 424 HgmA: homogentisate 1,2-dioxygenase; InterPro: IPR 96.23
PRK05341 438 homogentisate 1,2-dioxygenase; Provisional 96.01
TIGR01015 429 hmgA homogentisate 1,2-dioxygenase. Missing in hum 96.0
PF13621251 Cupin_8: Cupin-like domain; PDB: 3AL6_C 3AL5_C 2XU 95.94
PF14499251 DUF4437: Domain of unknown function (DUF4437); PDB 95.88
PLN02658 435 homogentisate 1,2-dioxygenase 95.88
PF12852186 Cupin_6: Cupin 95.65
PF07385225 DUF1498: Protein of unknown function (DUF1498); In 95.53
PF02678107 Pirin: Pirin; InterPro: IPR003829 This entry repre 95.43
COG3257264 GlxB Uncharacterized protein, possibly involved in 95.41
PF08007319 Cupin_4: Cupin superfamily protein; InterPro: IPR0 95.32
COG3806216 ChrR Transcriptional activator [Transcription] 95.32
PRK10572 290 DNA-binding transcriptional regulator AraC; Provis 95.19
COG3822225 ABC-type sugar transport system, auxiliary compone 94.71
PRK12335 287 tellurite resistance protein TehB; Provisional 94.42
PF07847200 DUF1637: Protein of unknown function (DUF1637); In 94.37
KOG3995 279 consensus 3-hydroxyanthranilate oxygenase HAAO [Am 94.32
COG1741 276 Pirin-related protein [General function prediction 94.13
PRK09685 302 DNA-binding transcriptional activator FeaR; Provis 94.07
PF13759101 2OG-FeII_Oxy_5: Putative 2OG-Fe(II) oxygenase; PDB 93.31
PF02373114 JmjC: JmjC domain, hydroxylase; InterPro: IPR01312 93.0
PF0686594 DUF1255: Protein of unknown function (DUF1255); In 92.82
COG5553191 Predicted metal-dependent enzyme of the double-str 92.65
PF0931382 DUF1971: Domain of unknown function (DUF1971); Int 92.33
COG3508 427 HmgA Homogentisate 1,2-dioxygenase [Secondary meta 92.32
TIGR02466201 conserved hypothetical protein. This family consis 92.24
PF05726104 Pirin_C: Pirin C-terminal cupin domain; InterPro: 92.23
PF05118163 Asp_Arg_Hydrox: Aspartyl/Asparaginyl beta-hydroxyl 92.06
PF14525172 AraC_binding_2: AraC-binding-like domain 91.98
KOG3706 629 consensus Uncharacterized conserved protein [Funct 91.8
PRK1057994 hypothetical protein; Provisional 91.74
PRK00924276 5-keto-4-deoxyuronate isomerase; Provisional 91.67
PRK15131389 mannose-6-phosphate isomerase; Provisional 91.64
TIGR00218302 manA mannose-6-phosphate isomerase, class I. The n 90.85
PLN02288394 mannose-6-phosphate isomerase 90.33
KOG2757411 consensus Mannose-6-phosphate isomerase [Carbohydr 89.68
PF1114263 DUF2917: Protein of unknown function (DUF2917); In 89.09
COG2850 383 Uncharacterized conserved protein [Function unknow 88.66
PF06172139 Cupin_5: Cupin superfamily (DUF985); InterPro: IPR 88.0
PRK03606162 ureidoglycolate hydrolase; Provisional 85.59
PRK09391230 fixK transcriptional regulator FixK; Provisional 85.41
PF0002791 cNMP_binding: Cyclic nucleotide-binding domain; In 84.57
PF04622216 ERG2_Sigma1R: ERG2 and Sigma1 receptor like protei 84.13
PF04115165 Ureidogly_hydro: Ureidoglycolate hydrolase ; Inter 82.88
COG1482312 ManA Phosphomannose isomerase [Carbohydrate transp 82.2
PRK11753211 DNA-binding transcriptional dual regulator Crp; Pr 82.08
PRK13918202 CRP/FNR family transcriptional regulator; Provisio 80.73
>TIGR03404 bicupin_oxalic bicupin, oxalate decarboxylase family Back     alignment and domain information 
Probab=99.94  E-value=1.5e-25  Score=200.25  Aligned_cols=162  Identities=17%  Similarity=0.301  Sum_probs=144.1

Q ss_pred             ccccCCCCcCCCCeeeeccCCCCcccCCCCcEEEEeccCCCCCCCccceEEEEEEEcCCccCCCCCCCCCcEEEEEEEeE
Q 027839           43 FACKDSANITADDFFFAGLAKPGVVNNSVGSLVTAANVEKIPGLNTLGVSLSRIDYEAGGLNPPHTHPRATEMIFVLEGE  122 (218)
Q Consensus        43 ~~c~~p~~~~~~df~~~~~~~~~~~~~~~g~~~~~~~~~~~P~l~~~gis~~~~~l~pg~~~~pH~H~~a~E~~~Vl~G~  122 (218)
                      .+-+.+..-.++.|+|+....++  ....|++++.++..+||+++  ++++++++++||++.++|||++++|++||++|+
T Consensus       201 ~~~~~~~~~~~~~~~~~~~~~~p--~~~~gG~~~~~~~~~~p~~~--~~s~~~~~l~PG~~~~~H~H~~~~E~~yvl~G~  276 (367)
T TIGR03404       201 EAVTGPAGEVPGPFTYHLSEQKP--KQVPGGTVRIADSTNFPVSK--TIAAAIVTVEPGAMRELHWHPNADEWQYFIQGQ  276 (367)
T ss_pred             ccCcCCCCCCCccEEEEhhhCCc--eecCCceEEEEChhhccCcc--eEEEEEEEECCCCccCCeeCcCCCeEEEEEEEE
Confidence            33444555566779999877666  34677888999999999988  579999999999999999999999999999999


Q ss_pred             EEEEEEecCCcEEEEEEeCCCEEEECCCCeEEEEeCCCCCEEEEEEecCCCCccchhchhhhcCCCCCCHHHHHHHcCCC
Q 027839          123 LDVGFISTADKLISKTVKKGEIYVFPKALVHFQKNNGDKPASVISAFNSQLPGTQSIAATLFTATPPVPDNVLTKAFQVG  202 (218)
Q Consensus       123 ~~v~~~~~~~~~~~~~L~~Gd~~~iP~g~~H~~~N~g~~~a~~l~~~~s~~p~~~~~~~~lf~~~~~~~~~vl~~af~~~  202 (218)
                      +++.+.+++++.++..+++||+++||+|..|+++|.|+++++++++|++..++.+.+.+|+ +   .+|++|++++|+++
T Consensus       277 ~~~~v~d~~g~~~~~~l~~GD~~~iP~g~~H~i~N~G~e~l~fL~if~s~~~~~i~l~~~l-~---~~p~~vl~~~~~~~  352 (367)
T TIGR03404       277 ARMTVFAAGGNARTFDYQAGDVGYVPRNMGHYVENTGDETLVFLEVFKADRFADVSLNQWL-A---LTPPQLVAAHLNLD  352 (367)
T ss_pred             EEEEEEecCCcEEEEEECCCCEEEECCCCeEEEEECCCCCEEEEEEECCCCCceeEHHHHH-h---hCCHHHHHHHhCcC
Confidence            9999988777666889999999999999999999999999999999999999999998888 3   59999999999999


Q ss_pred             HHHHHHHHhh
Q 027839          203 TKEIEKIKSK  212 (218)
Q Consensus       203 ~~~v~~l~~~  212 (218)
                      ++++++|++.
T Consensus       353 ~~~~~~l~~~  362 (367)
T TIGR03404       353 DEVIDSLKKE  362 (367)
T ss_pred             HHHHHhcccc
Confidence            9999999865

Members of this protein family are defined as bicupins as they have two copies of the cupin domain (pfam00190). Two different known activities for members of this family are oxalate decarboxylase (EC 4.1.1.2) and oxalate oxidase (EC 1.2.3.4), although the latter activity has more often been found in distantly related monocupin (germin) proteins.
>PLN00212 glutelin; Provisional Back     alignment and domain information
>TIGR03404 bicupin_oxalic bicupin, oxalate decarboxylase family Back     alignment and domain information
>PF00190 Cupin_1: Cupin; InterPro: IPR006045 This family represents the conserved barrel domain of the 'cupin' superfamily ('cupa' is the Latin term for a small barrel) Back     alignment and domain information
>smart00835 Cupin_1 Cupin Back     alignment and domain information
>PLN00212 glutelin; Provisional Back     alignment and domain information
>COG2140 Thermophilic glucose-6-phosphate isomerase and related metalloenzymes [Carbohydrate transport and metabolism / General function prediction only] Back     alignment and domain information
>PF07883 Cupin_2: Cupin domain; InterPro: IPR013096 This family represents the conserved barrel domain of the cupin superfamily [] (cupa is the Latin term for a small barrel) Back     alignment and domain information
>COG0662 {ManC} Mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG1917 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] Back     alignment and domain information
>PRK13290 ectC L-ectoine synthase; Reviewed Back     alignment and domain information
>PRK04190 glucose-6-phosphate isomerase; Provisional Back     alignment and domain information
>COG3837 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] Back     alignment and domain information
>PRK11171 hypothetical protein; Provisional Back     alignment and domain information
>PRK09943 DNA-binding transcriptional repressor PuuR; Provisional Back     alignment and domain information
>TIGR01479 GMP_PMI mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase Back     alignment and domain information
>PRK15460 cpsB mannose-1-phosphate guanyltransferase; Provisional Back     alignment and domain information
>PF01050 MannoseP_isomer: Mannose-6-phosphate isomerase; InterPro: IPR001538 Mannose-6-phosphate isomerase or phosphomannose isomerase (5 Back     alignment and domain information
>COG4101 Predicted mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03214 ura-cupin putative allantoin catabolism protein Back     alignment and domain information
>PRK11171 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03214 ura-cupin putative allantoin catabolism protein Back     alignment and domain information
>PF02041 Auxin_BP: Auxin binding protein; InterPro: IPR000526 Auxin binding protein is located in the lumen of the endoplasmic reticulum (ER) Back     alignment and domain information
>PF06560 GPI: Glucose-6-phosphate isomerase (GPI); InterPro: IPR010551 This entry consists of several bacterial and archaeal glucose-6-phosphate isomerase (GPI) proteins (5 Back     alignment and domain information
>PRK13264 3-hydroxyanthranilate 3,4-dioxygenase; Provisional Back     alignment and domain information
>TIGR03037 anthran_nbaC 3-hydroxyanthranilate 3,4-dioxygenase Back     alignment and domain information
>PF02311 AraC_binding: AraC-like ligand binding domain; InterPro: IPR003313 This entry defines the arabinose-binding and dimerisation domain of the bacterial gene regulatory protein AraC Back     alignment and domain information
>PF11699 CENP-C_C: Mif2/CENP-C like; PDB: 2VPV_B Back     alignment and domain information
>PF03079 ARD: ARD/ARD' family; InterPro: IPR004313 The two acireductone dioxygenase enzymes (ARD and ARD', previously known as E-2 and E-2') from Klebsiella pneumoniae share the same amino acid sequence Q9ZFE7 from SWISSPROT, but bind different metal ions: ARD binds Ni2+, ARD' binds Fe2+ [] Back     alignment and domain information
>PRK15457 ethanolamine utilization protein EutQ; Provisional Back     alignment and domain information
>TIGR02451 anti_sig_ChrR anti-sigma factor, putative, ChrR family Back     alignment and domain information
>PF12973 Cupin_7: ChrR Cupin-like domain; PDB: 3O14_B 2Z2S_F 2Q1Z_B 3EBR_A Back     alignment and domain information
>PRK10371 DNA-binding transcriptional regulator MelR; Provisional Back     alignment and domain information
>COG1791 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] Back     alignment and domain information
>PF14499 DUF4437: Domain of unknown function (DUF4437); PDB: 2QDR_A Back     alignment and domain information
>COG4297 Uncharacterized protein containing double-stranded beta helix domain [Function unknown] Back     alignment and domain information
>PF06339 Ectoine_synth: Ectoine synthase; InterPro: IPR010462 This family consists of several bacterial ectoine synthase proteins Back     alignment and domain information
>TIGR02272 gentisate_1_2 gentisate 1,2-dioxygenase Back     alignment and domain information
>PRK10296 DNA-binding transcriptional regulator ChbR; Provisional Back     alignment and domain information
>COG3257 GlxB Uncharacterized protein, possibly involved in glyoxylate utilization [General function prediction only] Back     alignment and domain information
>PRK13501 transcriptional activator RhaR; Provisional Back     alignment and domain information
>PF05523 FdtA: WxcM-like, C-terminal ; InterPro: IPR008894 This entry includes FdtA (Q6T1W8 from SWISSPROT) from Aneurinibacillus thermoaerophilus, which has been characterised as a dTDP-6-deoxy-3,4-keto-hexulose isomerase [] Back     alignment and domain information
>TIGR02297 HpaA 4-hydroxyphenylacetate catabolism regulatory protein HpaA Back     alignment and domain information
>PRK13500 transcriptional activator RhaR; Provisional Back     alignment and domain information
>PRK13503 transcriptional activator RhaS; Provisional Back     alignment and domain information
>PF06052 3-HAO: 3-hydroxyanthranilic acid dioxygenase; InterPro: IPR010329 Members of this protein family, from both bacteria and eukaryotes, are the enzyme 3-hydroxyanthranilate 3,4-dioxygenase (1 Back     alignment and domain information
>PRK13502 transcriptional activator RhaR; Provisional Back     alignment and domain information
>KOG2107 consensus Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] Back     alignment and domain information
>PF05899 Cupin_3: Protein of unknown function (DUF861); InterPro: IPR008579 The function of the proteins in this entry are unknown Back     alignment and domain information
>COG3435 Gentisate 1,2-dioxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF05995 CDO_I: Cysteine dioxygenase type I; InterPro: IPR010300 Cysteine dioxygenase type I (1 Back     alignment and domain information
>TIGR02272 gentisate_1_2 gentisate 1,2-dioxygenase Back     alignment and domain information
>PF06249 EutQ: Ethanolamine utilisation protein EutQ; InterPro: IPR010424 The eut operon of Salmonella typhimurium encodes proteins involved in the cobalamin-dependent degradation of ethanolamine Back     alignment and domain information
>COG4766 EutQ Ethanolamine utilization protein [Amino acid transport and metabolism] Back     alignment and domain information
>COG1898 RfbC dTDP-4-dehydrorhamnose 3,5-epimerase and related enzymes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR01221 rmlC dTDP-4-dehydrorhamnose 3,5-epimerase Back     alignment and domain information
>COG3450 Predicted enzyme of the cupin superfamily [General function prediction only] Back     alignment and domain information
>PF00908 dTDP_sugar_isom: dTDP-4-dehydrorhamnose 3,5-epimerase; InterPro: IPR000888 Deoxythymidine diphosphate (dTDP)-4-keto-6-deoxy-d-hexulose 3, 5-epimerase (RmlC, 5 Back     alignment and domain information
>COG3435 Gentisate 1,2-dioxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF04209 HgmA: homogentisate 1,2-dioxygenase; InterPro: IPR005708 Alkaptonuria (AKU), a rare hereditary disorder, was the first disease to be interpreted as an inborn error of metabolism Back     alignment and domain information
>PRK05341 homogentisate 1,2-dioxygenase; Provisional Back     alignment and domain information
>TIGR01015 hmgA homogentisate 1,2-dioxygenase Back     alignment and domain information
>PF13621 Cupin_8: Cupin-like domain; PDB: 3AL6_C 3AL5_C 2XUM_A 2Y0I_A 1MZE_A 3KCY_A 1MZF_A 1YCI_A 2ILM_A 1H2L_A Back     alignment and domain information
>PF14499 DUF4437: Domain of unknown function (DUF4437); PDB: 2QDR_A Back     alignment and domain information
>PLN02658 homogentisate 1,2-dioxygenase Back     alignment and domain information
>PF12852 Cupin_6: Cupin Back     alignment and domain information
>PF07385 DUF1498: Protein of unknown function (DUF1498); InterPro: IPR010864 This family consists of several hypothetical bacterial proteins of around 225 residues in length Back     alignment and domain information
>PF02678 Pirin: Pirin; InterPro: IPR003829 This entry represents N-terminal domain of Pirin proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>COG3257 GlxB Uncharacterized protein, possibly involved in glyoxylate utilization [General function prediction only] Back     alignment and domain information
>PF08007 Cupin_4: Cupin superfamily protein; InterPro: IPR022777 This signature represents primarily the cupin fold found in JmjC transcription factors Back     alignment and domain information
>COG3806 ChrR Transcriptional activator [Transcription] Back     alignment and domain information
>PRK10572 DNA-binding transcriptional regulator AraC; Provisional Back     alignment and domain information
>COG3822 ABC-type sugar transport system, auxiliary component [General function prediction only] Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PF07847 DUF1637: Protein of unknown function (DUF1637); InterPro: IPR012864 This entry represents cysteamine dioxygenase, which is a non-heme iron protein that is involved in the biosynthesis of taurine Back     alignment and domain information
>KOG3995 consensus 3-hydroxyanthranilate oxygenase HAAO [Amino acid transport and metabolism] Back     alignment and domain information
>COG1741 Pirin-related protein [General function prediction only] Back     alignment and domain information
>PRK09685 DNA-binding transcriptional activator FeaR; Provisional Back     alignment and domain information
>PF13759 2OG-FeII_Oxy_5: Putative 2OG-Fe(II) oxygenase; PDB: 3BVC_B 2RG4_A Back     alignment and domain information
>PF02373 JmjC: JmjC domain, hydroxylase; InterPro: IPR013129 Jumonji protein is required for neural tube formation in mice [] Back     alignment and domain information
>PF06865 DUF1255: Protein of unknown function (DUF1255); InterPro: IPR009664 This family consists of several conserved hypothetical bacterial proteins of around 95 residues in length Back     alignment and domain information
>COG5553 Predicted metal-dependent enzyme of the double-stranded beta helix superfamily [General function prediction only] Back     alignment and domain information
>PF09313 DUF1971: Domain of unknown function (DUF1971); InterPro: IPR015392 This uncharacterised domain is predominantly found in bacterial Tellurite resistance proteins Back     alignment and domain information
>COG3508 HmgA Homogentisate 1,2-dioxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR02466 conserved hypothetical protein Back     alignment and domain information
>PF05726 Pirin_C: Pirin C-terminal cupin domain; InterPro: IPR008778 This entry represents C-terminal domain of Pirin proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>PF05118 Asp_Arg_Hydrox: Aspartyl/Asparaginyl beta-hydroxylase; InterPro: IPR007803 The alpha-ketoglutarate-dependent dioxygenase aspartyl (asparaginyl) beta-hydroxylase (1 Back     alignment and domain information
>PF14525 AraC_binding_2: AraC-binding-like domain Back     alignment and domain information
>KOG3706 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10579 hypothetical protein; Provisional Back     alignment and domain information
>PRK00924 5-keto-4-deoxyuronate isomerase; Provisional Back     alignment and domain information
>PRK15131 mannose-6-phosphate isomerase; Provisional Back     alignment and domain information
>TIGR00218 manA mannose-6-phosphate isomerase, class I Back     alignment and domain information
>PLN02288 mannose-6-phosphate isomerase Back     alignment and domain information
>KOG2757 consensus Mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF11142 DUF2917: Protein of unknown function (DUF2917); InterPro: IPR021317 This bacterial family of proteins appears to be restricted to Proteobacteria Back     alignment and domain information
>COG2850 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF06172 Cupin_5: Cupin superfamily (DUF985); InterPro: IPR009327 This is a family of uncharacterised proteins found in bacteria and eukaryotes Back     alignment and domain information
>PRK03606 ureidoglycolate hydrolase; Provisional Back     alignment and domain information
>PRK09391 fixK transcriptional regulator FixK; Provisional Back     alignment and domain information
>PF00027 cNMP_binding: Cyclic nucleotide-binding domain; InterPro: IPR000595 Proteins that bind cyclic nucleotides (cAMP or cGMP) share a structural domain of about 120 residues [, , ] Back     alignment and domain information
>PF04622 ERG2_Sigma1R: ERG2 and Sigma1 receptor like protein; InterPro: IPR006716 This family consists of the fungal C-8 sterol isomerase and mammalian sigma1 receptor Back     alignment and domain information
>PF04115 Ureidogly_hydro: Ureidoglycolate hydrolase ; InterPro: IPR007247 Ureidoglycolate hydrolase (3 Back     alignment and domain information
>COG1482 ManA Phosphomannose isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11753 DNA-binding transcriptional dual regulator Crp; Provisional Back     alignment and domain information
>PRK13918 CRP/FNR family transcriptional regulator; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query218
2et7_A201 Structural And Spectroscopic Insights Into The Mech 4e-44
1fi2_A201 Crystal Structure Of Germin (Oxalate Oxidase) Lengt 4e-44
2ete_A201 Recombinant Oxalate Oxidase In Complex With Glycola 5e-44
2vqa_A361 Protein-Folding Location Can Regulate Mn Versus Cu- 2e-09
3ehk_A531 Crystal Structure Of Pru Du Amandin, An Allergenic 1e-04
>pdb|2ET7|A Chain A, Structural And Spectroscopic Insights Into The Mechanism Of Oxalate Oxidase Length = 201 Back     alignment and structure 
Iteration: 1

 Score =  174 bits (440), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 95/198 (47%), Positives = 124/198 (62%), Gaps = 7/198 (3%)
Query: 23  DPDTLQDVCVADTS--SVKVNGFACKDSANITADDFFFAG-LAKPGVVNNSVGSLVTAAN 79
           DPD LQD CVAD    +V VNG  CK  +    DDF F+  L K G  +   GS VT  +
Sbjct: 2   DPDPLQDFCVADLDGKAVSVNGHTCKPMSE-AGDDFLFSSKLTKAGNTSTPNGSAVTELD 60
Query: 80  VEKIPGLNTLGVSLSRIDYEAGGLNPPHTHPRATEMIFVLEGELDVGFISTAD---KLIS 136
           V + PG NTLGVS++R+D+  GG NPPH HPRATE+  V++GEL VG + + D   KL S
Sbjct: 61  VAEWPGTNTLGVSMARVDFAPGGTNPPHIHPRATEIGMVMKGELLVGILGSLDSGNKLYS 120
Query: 137 KTVKKGEIYVFPKALVHFQKNNGDKPASVISAFNSQLPGTQSIAATLFTATPPVPDNVLT 196
           + V+ GE +V P+ L+HFQ N G   A ++ +FNSQ PG   +  TLF + PP+P  VLT
Sbjct: 121 RVVRAGETFVIPRGLMHFQFNVGKTEAYMVVSFNSQNPGIVFVPLTLFGSDPPIPTPVLT 180
Query: 197 KAFQVGTKEIEKIKSKLA 214
           KA +V    +E +KSK A
Sbjct: 181 KALRVEAGVVELLKSKFA 198
>pdb|1FI2|A Chain A, Crystal Structure Of Germin (Oxalate Oxidase) Length = 201 Back     alignment and structure
>pdb|2ETE|A Chain A, Recombinant Oxalate Oxidase In Complex With Glycolate Length = 201 Back     alignment and structure
>pdb|2VQA|A Chain A, Protein-Folding Location Can Regulate Mn Versus Cu- Or Zn- Binding. Crystal Structure Of Mnca. Length = 361 Back     alignment and structure
>pdb|3EHK|A Chain A, Crystal Structure Of Pru Du Amandin, An Allergenic Protein From Prunus Dulcis Length = 531 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query218
1fi2_A201 Oxalate oxidase, germin; beta-jellyroll, oxidoredu 2e-68
2d5f_A493 Glycinin A3B4 subunit; soybean, globulin, 11S,SEED 2e-45
2d5f_A 493 Glycinin A3B4 subunit; soybean, globulin, 11S,SEED 4e-08
1fxz_A476 Glycinin G1; proglycinin, legumin, SEED storage pr 4e-43
1fxz_A 476 Glycinin G1; proglycinin, legumin, SEED storage pr 8e-07
2vqa_A361 SLL1358 protein, MNCA; periplasmic binding protein 4e-43
2vqa_A 361 SLL1358 protein, MNCA; periplasmic binding protein 2e-33
3c3v_A510 Arachin ARAH3 isoform; peanut allergen, allergy, g 7e-43
2ea7_A434 7S globulin-1; beta barrel, cupin superfamily, pla 3e-39
2ea7_A 434 7S globulin-1; beta barrel, cupin superfamily, pla 8e-16
2cav_A445 Protein (canavalin); vicilin, 7S SEED protein, dom 2e-38
2cav_A 445 Protein (canavalin); vicilin, 7S SEED protein, dom 4e-12
1uij_A416 Beta subunit of beta conglycinin; double-stranded 1e-37
1uij_A 416 Beta subunit of beta conglycinin; double-stranded 1e-13
2e9q_A459 11S globulin subunit beta; cucubitin, pumpkin SEED 2e-36
2e9q_A 459 11S globulin subunit beta; cucubitin, pumpkin SEED 5e-07
1j58_A385 YVRK protein; cupin, decarboxyklase, oxalate, mang 3e-35
1j58_A 385 YVRK protein; cupin, decarboxyklase, oxalate, mang 9e-27
3ksc_A496 LEGA class, prolegumin; PEA prolegumin, 11S SEED s 5e-35
3ksc_A 496 LEGA class, prolegumin; PEA prolegumin, 11S SEED s 2e-04
3qac_A465 11S globulin SEED storage protein; 11S SEED storag 1e-33
3kgl_A466 Cruciferin; 11S SEED globulin, rapeseed, SEED stor 4e-32
3s7i_A418 Allergen ARA H 1, clone P41B; bicupin, vicilin, st 1e-20
3s7i_A 418 Allergen ARA H 1, clone P41B; bicupin, vicilin, st 4e-15
2phl_A397 Phaseolin; plant SEED storage protein(vicilin); HE 5e-18
2phl_A 397 Phaseolin; plant SEED storage protein(vicilin); HE 1e-07
1dgw_A178 Canavalin; duplicated swiss-roll beta barrels, loo 8e-18
3fz3_A531 Prunin; TREE NUT allergen, allergy, amandin, almon 2e-12
1v70_A105 Probable antibiotics synthesis protein; structural 1e-11
3ht1_A145 REMF protein; cupin fold, Zn-binding, antibiotic b 2e-11
1lr5_A163 Auxin binding protein 1; beta jellyroll, double st 2e-10
1vj2_A126 Novel manganese-containing cupin TM1459; structura 1e-09
1juh_A 350 Quercetin 2,3-dioxygenase; cupin, glycoprotein, be 2e-09
1juh_A350 Quercetin 2,3-dioxygenase; cupin, glycoprotein, be 2e-04
3kgz_A156 Cupin 2 conserved barrel domain protein; metallopr 2e-09
3cew_A125 Uncharacterized cupin protein; all beta-protein, j 2e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-09
3jzv_A166 Uncharacterized protein RRU_A2000; structural geno 4e-09
1o4t_A133 Putative oxalate decarboxylase; double-stranded be 5e-09
1y3t_A 337 Hypothetical protein YXAG; BI cupin, dioxygenase, 6e-09
1y3t_A337 Hypothetical protein YXAG; BI cupin, dioxygenase, 2e-08
2gu9_A113 Tetracenomycin polyketide synthesis protein; X-RAY 7e-09
3h7j_A243 Bacilysin biosynthesis protein BACB; YWFC, bacilys 1e-08
3h7j_A243 Bacilysin biosynthesis protein BACB; YWFC, bacilys 4e-05
2fqp_A97 Hypothetical protein BP2299; double-stranded beta- 6e-08
2d40_A 354 Z3393, putative gentisate 1,2-dioxygenase; gentisi 1e-07
3ibm_A167 Cupin 2, conserved barrel domain protein; cupin 2 1e-07
3h8u_A125 Uncharacterized conserved protein with double-STR 1e-07
4e2g_A126 Cupin 2 conserved barrel domain protein; MCSG, PSI 1e-07
3i7d_A163 Sugar phosphate isomerase; YP_168127.1, structural 2e-07
3d82_A102 Cupin 2, conserved barrel domain protein; structur 5e-07
1x82_A190 Glucose-6-phosphate isomerase; cupin superfamily, 9e-07
3nw4_A 368 Gentisate 1,2-dioxygenase; beta-barrel, oxidoreduc 2e-06
1yhf_A115 Hypothetical protein SPY1581; structural genomics, 3e-06
2i45_A107 Hypothetical protein; neisseria meningitidis cupin 3e-06
1rc6_A261 Hypothetical protein YLBA; structural genomics, NY 4e-06
2q30_A110 Uncharacterized protein; double-stranded beta-heli 7e-06
1sef_A274 Conserved hypothetical protein; structural genomic 7e-06
1dgw_X79 Canavalin; duplicated swiss-roll beta barrels, loo 7e-06
2ozi_A98 Hypothetical protein RPA4178; APC6210, putative pr 9e-06
2xlg_A239 SLL1785 protein, CUCA; metal binding protein, cupi 1e-05
1sq4_A278 GLXB, glyoxylate-induced protein; structural genom 2e-05
2ozj_A114 Cupin 2, conserved barrel; cupin superfamily prote 3e-05
3rns_A227 Cupin 2 conserved barrel domain protein; structura 4e-05
1y9q_A192 Transcriptional regulator, HTH_3 family; transcrip 5e-05
2pfw_A116 Cupin 2, conserved barrel domain protein; cupin do 6e-05
3l2h_A162 Putative sugar phosphate isomerase; AFE_0303, stru 1e-04
3fjs_A114 Uncharacterized protein with RMLC-like cupin fold; 3e-04
3es1_A172 Cupin 2, conserved barrel domain protein; YP_00116 3e-04
2qdr_A303 Uncharacterized protein; double-stranded beta-heli 9e-04
>1fi2_A Oxalate oxidase, germin; beta-jellyroll, oxidoreductase; 1.60A {Hordeum vulgare} SCOP: b.82.1.2 PDB: 2et1_A 2ete_A* 2et7_A Length = 201 Back     alignment and structure
 Score =  207 bits (527), Expect = 2e-68
 Identities = 92/197 (46%), Positives = 122/197 (61%), Gaps = 5/197 (2%)

Query: 23  DPDTLQDVCVAD--TSSVKVNGFACKDSANITADDFFFAGLAKPGVVNNSVGSLVTAANV 80
           DPD LQD CVAD    +V VNG  CK  +    D  F + L K G  +   GS VT  +V
Sbjct: 2   DPDPLQDFCVADLDGKAVSVNGHTCKPMSEAGDDFLFSSKLTKAGNTSTPNGSAVTELDV 61

Query: 81  EKIPGLNTLGVSLSRIDYEAGGLNPPHTHPRATEMIFVLEGELDVGFIS---TADKLISK 137
            + PG NTLGVS++R+D+  GG NPPH HPRATE+  V++GEL VG +    + +KL S+
Sbjct: 62  AEWPGTNTLGVSMNRVDFAPGGTNPPHIHPRATEIGMVMKGELLVGILGSLDSGNKLYSR 121

Query: 138 TVKKGEIYVFPKALVHFQKNNGDKPASVISAFNSQLPGTQSIAATLFTATPPVPDNVLTK 197
            V+ GE +V P+ L+HFQ N G   A ++ +FNSQ PG   +  TLF + PP+P  VLTK
Sbjct: 122 VVRAGETFVIPRGLMHFQFNVGKTEAYMVVSFNSQNPGIVFVPLTLFGSDPPIPTPVLTK 181

Query: 198 AFQVGTKEIEKIKSKLA 214
           A +V    +E +KSK A
Sbjct: 182 ALRVEAGVVELLKSKFA 198
>2d5f_A Glycinin A3B4 subunit; soybean, globulin, 11S,SEED storage protein, plant; 1.90A {Glycine max} PDB: 2d5h_A 1od5_A Length = 493 Back     alignment and structure
>1fxz_A Glycinin G1; proglycinin, legumin, SEED storage protein, plant protein; 2.80A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ud1_A 1ucx_A Length = 476 Back     alignment and structure
>1fxz_A Glycinin G1; proglycinin, legumin, SEED storage protein, plant protein; 2.80A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ud1_A 1ucx_A Length = 476 Back     alignment and structure
>2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP} Length = 361 Back     alignment and structure
>2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP} Length = 361 Back     alignment and structure
>3c3v_A Arachin ARAH3 isoform; peanut allergen, allergy, glycinin; 1.73A {Arachis hypogaea} Length = 510 Back     alignment and structure
>2ea7_A 7S globulin-1; beta barrel, cupin superfamily, plant protein; 1.80A {Vigna angularis} PDB: 2eaa_A* 2cv6_A 1uik_A Length = 434 Back     alignment and structure
>2ea7_A 7S globulin-1; beta barrel, cupin superfamily, plant protein; 1.80A {Vigna angularis} PDB: 2eaa_A* 2cv6_A 1uik_A Length = 434 Back     alignment and structure
>2cav_A Protein (canavalin); vicilin, 7S SEED protein, domain duplication, swiss roll, PL protein; 2.00A {Canavalia ensiformis} SCOP: b.82.1.2 b.82.1.2 PDB: 2cau_A 1cau_B 1cav_B 1caw_B 1cax_B Length = 445 Back     alignment and structure
>2cav_A Protein (canavalin); vicilin, 7S SEED protein, domain duplication, swiss roll, PL protein; 2.00A {Canavalia ensiformis} SCOP: b.82.1.2 b.82.1.2 PDB: 2cau_A 1cau_B 1cav_B 1caw_B 1cax_B Length = 445 Back     alignment and structure
>1uij_A Beta subunit of beta conglycinin; double-stranded beta helix, SEED storage protein, sugar binding protein; 2.50A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ipk_A 1ipj_A* Length = 416 Back     alignment and structure
>1uij_A Beta subunit of beta conglycinin; double-stranded beta helix, SEED storage protein, sugar binding protein; 2.50A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ipk_A 1ipj_A* Length = 416 Back     alignment and structure
>2e9q_A 11S globulin subunit beta; cucubitin, pumpkin SEED storage globulin, plant protein; 2.20A {Cucurbita maxima} PDB: 2evx_A Length = 459 Back     alignment and structure
>2e9q_A 11S globulin subunit beta; cucubitin, pumpkin SEED storage globulin, plant protein; 2.20A {Cucurbita maxima} PDB: 2evx_A Length = 459 Back     alignment and structure
>1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A Length = 385 Back     alignment and structure
>1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A Length = 385 Back     alignment and structure
>3ksc_A LEGA class, prolegumin; PEA prolegumin, 11S SEED storage protein, pisum sativum L., SEED storage protein, storage protein, plant protein; 2.61A {Pisum sativum} Length = 496 Back     alignment and structure
>3ksc_A LEGA class, prolegumin; PEA prolegumin, 11S SEED storage protein, pisum sativum L., SEED storage protein, storage protein, plant protein; 2.61A {Pisum sativum} Length = 496 Back     alignment and structure
>3qac_A 11S globulin SEED storage protein; 11S SEED storage protein (globulins) family, SEED storage PR plant protein; 2.27A {Amaranthus hypochondriacus} Length = 465 Back     alignment and structure
>3kgl_A Cruciferin; 11S SEED globulin, rapeseed, SEED storage protein, storage protein, plant protein; 2.98A {Brassica napus} Length = 466 Back     alignment and structure
>3s7i_A Allergen ARA H 1, clone P41B; bicupin, vicilin, storage SEED protein; 2.35A {Arachis hypogaea} PDB: 3s7e_A 3smh_A Length = 418 Back     alignment and structure
>3s7i_A Allergen ARA H 1, clone P41B; bicupin, vicilin, storage SEED protein; 2.35A {Arachis hypogaea} PDB: 3s7e_A 3smh_A Length = 418 Back     alignment and structure
>2phl_A Phaseolin; plant SEED storage protein(vicilin); HET: NAG; 2.20A {Phaseolus vulgaris} SCOP: b.82.1.2 b.82.1.2 PDB: 1phs_A* Length = 397 Back     alignment and structure
>2phl_A Phaseolin; plant SEED storage protein(vicilin); HET: NAG; 2.20A {Phaseolus vulgaris} SCOP: b.82.1.2 b.82.1.2 PDB: 1phs_A* Length = 397 Back     alignment and structure
>1dgw_A Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_A 1cau_A 1cav_A 1caw_A 1cax_A Length = 178 Back     alignment and structure
>3fz3_A Prunin; TREE NUT allergen, allergy, amandin, almond, 11S SEED storage protein, allergen; 2.40A {Prunus dulcis} PDB: 3ehk_A Length = 531 Back     alignment and structure
>1v70_A Probable antibiotics synthesis protein; structural genomics, thermus thermophilus HB8, riken structu genomics/proteomics initiative, RSGI; 1.30A {Thermus thermophilus} SCOP: b.82.1.9 PDB: 2dct_A Length = 105 Back     alignment and structure
>3ht1_A REMF protein; cupin fold, Zn-binding, antibiotic biosynthesis, resistomycin, metalloprotein, cyclase, lyase; 1.20A {Streptomyces resistomycificus} PDB: 3ht2_A Length = 145 Back     alignment and structure
>1lr5_A Auxin binding protein 1; beta jellyroll, double stranded beta helix, germin-like PROT protein binding; HET: NAG BMA MAN; 1.90A {Zea mays} SCOP: b.82.1.2 PDB: 1lrh_A* Length = 163 Back     alignment and structure
>1vj2_A Novel manganese-containing cupin TM1459; structural genomics, joint for structural genomics, JCSG; 1.65A {Thermotoga maritima} SCOP: b.82.1.10 Length = 126 Back     alignment and structure
>1juh_A Quercetin 2,3-dioxygenase; cupin, glycoprotein, beta sandwich, oxidoreduct; HET: NAG BMA MAN; 1.60A {Aspergillus japonicus} SCOP: b.82.1.5 PDB: 1gqh_A* 1h1i_A* 1h1m_A* 1gqg_A* Length = 350 Back     alignment and structure
>1juh_A Quercetin 2,3-dioxygenase; cupin, glycoprotein, beta sandwich, oxidoreduct; HET: NAG BMA MAN; 1.60A {Aspergillus japonicus} SCOP: b.82.1.5 PDB: 1gqh_A* 1h1i_A* 1h1m_A* 1gqg_A* Length = 350 Back     alignment and structure
>3kgz_A Cupin 2 conserved barrel domain protein; metalloprotein, structural genomics, PSI-2, protein structur initiative; 1.85A {Rhodopseudomonas palustris} Length = 156 Back     alignment and structure
>3cew_A Uncharacterized cupin protein; all beta-protein, jelly-roll (cupin-2), structural genomics, protein structure initiative; 2.31A {Bacteroides fragilis} Length = 125 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3jzv_A Uncharacterized protein RRU_A2000; structural genomics, cupin-2 fold, unknown function, PSI-2, structure initiative; HET: MSE; 2.30A {Rhodospirillum rubrum} Length = 166 Back     alignment and structure
>1o4t_A Putative oxalate decarboxylase; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; 1.95A {Thermotoga maritima} SCOP: b.82.1.9 Length = 133 Back     alignment and structure
>1y3t_A Hypothetical protein YXAG; BI cupin, dioxygenase, oxidoreductase; 2.40A {Bacillus subtilis} SCOP: b.82.1.5 PDB: 2h0v_A* Length = 337 Back     alignment and structure
>1y3t_A Hypothetical protein YXAG; BI cupin, dioxygenase, oxidoreductase; 2.40A {Bacillus subtilis} SCOP: b.82.1.5 PDB: 2h0v_A* Length = 337 Back     alignment and structure
>2gu9_A Tetracenomycin polyketide synthesis protein; X-RAY diffraction, cupin, immune system; 1.40A {Xanthomonas campestris} PDB: 2ilb_A 3h50_A Length = 113 Back     alignment and structure
>3h7j_A Bacilysin biosynthesis protein BACB; YWFC, bacilysin synthesis, anticapsin synthesis, BI-Cu double stranded beta helix, antibiotic biosynthesis; HET: PPY; 1.87A {Bacillus subtilis} PDB: 3h7y_A* 3h9a_A* Length = 243 Back     alignment and structure
>3h7j_A Bacilysin biosynthesis protein BACB; YWFC, bacilysin synthesis, anticapsin synthesis, BI-Cu double stranded beta helix, antibiotic biosynthesis; HET: PPY; 1.87A {Bacillus subtilis} PDB: 3h7y_A* 3h9a_A* Length = 243 Back     alignment and structure
>2fqp_A Hypothetical protein BP2299; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: 1PE; 1.80A {Bordetella pertussis tohama I} Length = 97 Back     alignment and structure
>2d40_A Z3393, putative gentisate 1,2-dioxygenase; gentisic acid, bicupin, tetramer, montreal- bacterial structural genomics initiative, BSGI; 2.41A {Escherichia coli} SCOP: b.82.1.23 Length = 354 Back     alignment and structure
>3ibm_A Cupin 2, conserved barrel domain protein; cupin 2 family, metal-binding site, beta barrel, PSI-2, NYSG structural genomics; 2.00A {Halorhodospira halophila SL1} Length = 167 Back     alignment and structure
>3h8u_A Uncharacterized conserved protein with double-STR beta-helix domain; YP_001338853.1; HET: 2PE; 1.80A {Klebsiella pneumoniae subsp} Length = 125 Back     alignment and structure
>4e2g_A Cupin 2 conserved barrel domain protein; MCSG, PSI-biology, structural genomics, GEBA, midwest center structural genomics; HET: MSE; 1.86A {Sphaerobacter thermophilus} Length = 126 Back     alignment and structure
>3i7d_A Sugar phosphate isomerase; YP_168127.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.30A {Ruegeria pomeroyi dss-3} Length = 163 Back     alignment and structure
>3d82_A Cupin 2, conserved barrel domain protein; structural genomics, joint center for structural genomics; 2.05A {Shewanella frigidimarina ncimb 400} Length = 102 Back     alignment and structure
>1x82_A Glucose-6-phosphate isomerase; cupin superfamily, hyperthermophIle, phosphoglucose isomerase, extremeophIle; HET: PA5; 1.50A {Pyrococcus furiosus} SCOP: b.82.1.7 PDB: 1x7n_A* 1x8e_A 1qxr_A* 1qxj_A* 1qy4_A* 2gc1_A* 2gc0_A* 2gc2_A* 2gc3_A* 3sxw_A 1j3q_A 1j3p_A 1j3r_A* Length = 190 Back     alignment and structure
>3nw4_A Gentisate 1,2-dioxygenase; beta-barrel, oxidoreductase; HET: GTQ; 2.00A {Pseudaminobacter salicylatoxidans} PDB: 3nvc_A* 3nst_A* 3njz_A* 2phd_A* 3nkt_A* 3nl1_A* Length = 368 Back     alignment and structure
>1yhf_A Hypothetical protein SPY1581; structural genomics, conserved hypothetical protein, PSI, PR structure initiative; 2.00A {Streptococcus pyogenes} SCOP: b.82.1.9 Length = 115 Back     alignment and structure
>2i45_A Hypothetical protein; neisseria meningitidis cupin domain, structural genomics, PS protein structure initiative; 2.50A {Neisseria meningitidis} Length = 107 Back     alignment and structure
>1rc6_A Hypothetical protein YLBA; structural genomics, NYSGXRC, SGX clone NAME 3174C1TCT3B1, T T1521, PSI, protein initiative; 2.60A {Escherichia coli} SCOP: b.82.1.11 Length = 261 Back     alignment and structure
>2q30_A Uncharacterized protein; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: MSE; 1.94A {Desulfovibrio desulfuricans subsp} Length = 110 Back     alignment and structure
>1sef_A Conserved hypothetical protein; structural genomics, nysgxrc target T1582, PSI, protein STRU initiative; 2.05A {Enterococcus faecalis} SCOP: b.82.1.11 Length = 274 Back     alignment and structure
>1dgw_X Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_X Length = 79 Back     alignment and structure
>2xlg_A SLL1785 protein, CUCA; metal binding protein, cupin; 1.80A {Synechocystis SP} PDB: 2xl7_A 2xl9_A 2xlf_A* 2xla_A Length = 239 Back     alignment and structure
>1sq4_A GLXB, glyoxylate-induced protein; structural genomics, double beta barrel protein, PSI, protei structure initiative; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.11 Length = 278 Back     alignment and structure
>2ozj_A Cupin 2, conserved barrel; cupin superfamily protein, struct genomics, joint center for structural genomics, JCSG; HET: MSE; 1.60A {Desulfitobacterium hafniense} Length = 114 Back     alignment and structure
>3rns_A Cupin 2 conserved barrel domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 2.07A {Leptotrichia buccalis} Length = 227 Back     alignment and structure
>1y9q_A Transcriptional regulator, HTH_3 family; transcriptional regulaator, strucutral genomics, protein structure initiative, PSI; 1.90A {Vibrio cholerae} SCOP: a.35.1.8 b.82.1.15 Length = 192 Back     alignment and structure
>2pfw_A Cupin 2, conserved barrel domain protein; cupin domain, struc genomics, joint center for structural genomics, JCSG; 1.90A {Shewanella frigidimarina} Length = 116 Back     alignment and structure
>3l2h_A Putative sugar phosphate isomerase; AFE_0303, structural GEN joint center for structural genomics, JCSG; HET: MSE CXS; 1.85A {Acidithiobacillus ferrooxidans} Length = 162 Back     alignment and structure
>3fjs_A Uncharacterized protein with RMLC-like cupin fold; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.90A {Ralstonia eutropha JMP134} Length = 114 Back     alignment and structure
>3es1_A Cupin 2, conserved barrel domain protein; YP_001165807.1; HET: MSE; 1.91A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} Length = 172 Back     alignment and structure
>2qdr_A Uncharacterized protein; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: MSE EPE; 2.60A {Nostoc punctiforme} Length = 303 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 218
d2et1a1201 b.82.1.2 (A:1-201) Germin {Barley (Hordeum vulgare 3e-76
d1fxza2174 b.82.1.2 (A:297-470) Seed storage 7S protein {Soyb 1e-37
d1j58a_372 b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {B 2e-37
d1j58a_ 372 b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {B 8e-26
d1uika2185 b.82.1.2 (A:351-535) Seed storage 7S protein {Soyb 2e-37
d1od5a2173 b.82.1.2 (A:321-493) Seed storage 7S protein {Soyb 2e-36
g1dgw.1168 b.82.1.2 (X:,Y:) Seed storage 7S protein {Jack bea 7e-36
d2phla2162 b.82.1.2 (A:220-381) Seed storage 7S protein {Fren 7e-30
d1uija1170 b.82.1.2 (A:6-175) Seed storage 7S protein {Soybea 3e-26
d1dgwa_178 b.82.1.2 (A:) Seed storage 7S protein {Jack bean ( 2e-25
d1uika1203 b.82.1.2 (A:148-350) Seed storage 7S protein {Soyb 3e-23
d2phla1200 b.82.1.2 (A:11-210) Seed storage 7S protein {Frenc 7e-19
d1od5a1245 b.82.1.2 (A:7-251) Seed storage 7S protein {Soybea 2e-09
d1v70a_105 b.82.1.9 (A:) Hypothetical protein TTHA0104 {Therm 8e-09
d1o4ta_115 b.82.1.9 (A:) Hypothetical protein TM1287 {Thermot 3e-08
d2d40a1 308 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Es 6e-08
d1juha_ 348 b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergill 1e-07
d1juha_348 b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergill 1e-04
d1y3ta1330 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Baci 2e-07
d1y3ta1 330 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Baci 5e-05
d1fxza1239 b.82.1.2 (A:10-248) Seed storage 7S protein {Soybe 2e-07
d1sq4a_273 b.82.1.11 (A:) Glyoxylate-induced protein PA1140 { 9e-07
d1vj2a_114 b.82.1.10 (A:) Hypothetical protein TM1459 {Thermo 2e-06
d1x82a_190 b.82.1.7 (A:) Glucose-6-phosphate isomerase, GPI { 2e-06
d1sefa_250 b.82.1.11 (A:) Hypothetical protein EF2996 {Entero 2e-06
d1yhfa1112 b.82.1.9 (A:1-112) Hypothetical protein SPy1581 {S 2e-05
d2bnma2122 b.82.1.10 (A:77-198) Hydroxypropylphosphonic acid 1e-04
d1rc6a_253 b.82.1.11 (A:) Hypothetical protein YlbA {Escheric 1e-04
d2phda1 351 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Ps 2e-04
d1sfna_245 b.82.1.11 (A:) Hypothetical protein DR1152 {Deinoc 8e-04
d1sfna_245 b.82.1.11 (A:) Hypothetical protein DR1152 {Deinoc 0.001
d1vr3a1179 b.82.1.6 (A:1-179) Acireductone dioxygenase {Mouse 0.001
>d2et1a1 b.82.1.2 (A:1-201) Germin {Barley (Hordeum vulgare) [TaxId: 4513]} Length = 201 Back     information, alignment and structure

class: All beta proteins
fold: Double-stranded beta-helix
superfamily: RmlC-like cupins
family: Germin/Seed storage 7S protein
domain: Germin
species: Barley (Hordeum vulgare) [TaxId: 4513]

 Score =  226 bits (577), Expect = 3e-76
 Identities = 93/197 (47%), Positives = 122/197 (61%), Gaps = 5/197 (2%)

Query: 23  DPDTLQDVCVADT--SSVKVNGFACKDSANITADDFFFAGLAKPGVVNNSVGSLVTAANV 80
           DPD LQD CVAD    +V VNG  CK  +    D  F + L K G  +   GS VT  +V
Sbjct: 2   DPDPLQDFCVADLDGKAVSVNGHTCKPMSEAGDDFLFSSKLTKAGNTSTPNGSAVTELDV 61

Query: 81  EKIPGLNTLGVSLSRIDYEAGGLNPPHTHPRATEMIFVLEGELDVGFISTAD---KLISK 137
            + PG NTLGVS++R+D+  GG NPPH HPRATE+  V++GEL VG + + D   KL S+
Sbjct: 62  AEWPGTNTLGVSMNRVDFAPGGTNPPHIHPRATEIGMVMKGELLVGILGSLDSGNKLYSR 121

Query: 138 TVKKGEIYVFPKALVHFQKNNGDKPASVISAFNSQLPGTQSIAATLFTATPPVPDNVLTK 197
            V+ GE +V P+ L+HFQ N G   A ++ +FNSQ PG   +  TLF + PP+P  VLTK
Sbjct: 122 VVRAGETFVIPRGLMHFQFNVGKTEAYMVVSFNSQNPGIVFVPLTLFGSDPPIPTPVLTK 181

Query: 198 AFQVGTKEIEKIKSKLA 214
           A +V    +E +KSK A
Sbjct: 182 ALRVEAGVVELLKSKFA 198
>d1fxza2 b.82.1.2 (A:297-470) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} Length = 174 Back     information, alignment and structure
>d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} Length = 372 Back     information, alignment and structure
>d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} Length = 372 Back     information, alignment and structure
>d1uika2 b.82.1.2 (A:351-535) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} Length = 185 Back     information, alignment and structure
>d1od5a2 b.82.1.2 (A:321-493) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} Length = 173 Back     information, alignment and structure
>d2phla2 b.82.1.2 (A:220-381) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} Length = 162 Back     information, alignment and structure
>d1uija1 b.82.1.2 (A:6-175) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin beta subunit [TaxId: 3847]} Length = 170 Back     information, alignment and structure
>d1dgwa_ b.82.1.2 (A:) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId: 3823]} Length = 178 Back     information, alignment and structure
>d1uika1 b.82.1.2 (A:148-350) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} Length = 203 Back     information, alignment and structure
>d2phla1 b.82.1.2 (A:11-210) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} Length = 200 Back     information, alignment and structure
>d1od5a1 b.82.1.2 (A:7-251) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} Length = 245 Back     information, alignment and structure
>d1v70a_ b.82.1.9 (A:) Hypothetical protein TTHA0104 {Thermus thermophilus [TaxId: 274]} Length = 105 Back     information, alignment and structure
>d1o4ta_ b.82.1.9 (A:) Hypothetical protein TM1287 {Thermotoga maritima [TaxId: 2336]} Length = 115 Back     information, alignment and structure
>d2d40a1 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]} Length = 308 Back     information, alignment and structure
>d1juha_ b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId: 34381]} Length = 348 Back     information, alignment and structure
>d1juha_ b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId: 34381]} Length = 348 Back     information, alignment and structure
>d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]} Length = 330 Back     information, alignment and structure
>d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]} Length = 330 Back     information, alignment and structure
>d1fxza1 b.82.1.2 (A:10-248) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} Length = 239 Back     information, alignment and structure
>d1sq4a_ b.82.1.11 (A:) Glyoxylate-induced protein PA1140 {Pseudomonas aeruginosa [TaxId: 287]} Length = 273 Back     information, alignment and structure
>d1vj2a_ b.82.1.10 (A:) Hypothetical protein TM1459 {Thermotoga maritima [TaxId: 2336]} Length = 114 Back     information, alignment and structure
>d1x82a_ b.82.1.7 (A:) Glucose-6-phosphate isomerase, GPI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 190 Back     information, alignment and structure
>d1sefa_ b.82.1.11 (A:) Hypothetical protein EF2996 {Enterococcus faecalis [TaxId: 1351]} Length = 250 Back     information, alignment and structure
>d1yhfa1 b.82.1.9 (A:1-112) Hypothetical protein SPy1581 {Streptococcus pyogenes [TaxId: 1314]} Length = 112 Back     information, alignment and structure
>d2bnma2 b.82.1.10 (A:77-198) Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain {Streptomyces wedmorensis [TaxId: 43759]} Length = 122 Back     information, alignment and structure
>d1rc6a_ b.82.1.11 (A:) Hypothetical protein YlbA {Escherichia coli [TaxId: 562]} Length = 253 Back     information, alignment and structure
>d2phda1 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Pseudaminobacter salicylatoxidans [TaxId: 93369]} Length = 351 Back     information, alignment and structure
>d1sfna_ b.82.1.11 (A:) Hypothetical protein DR1152 {Deinococcus radiodurans [TaxId: 1299]} Length = 245 Back     information, alignment and structure
>d1sfna_ b.82.1.11 (A:) Hypothetical protein DR1152 {Deinococcus radiodurans [TaxId: 1299]} Length = 245 Back     information, alignment and structure
>d1vr3a1 b.82.1.6 (A:1-179) Acireductone dioxygenase {Mouse (Mus musculus) [TaxId: 10090]} Length = 179 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query218
d2et1a1201 Germin {Barley (Hordeum vulgare) [TaxId: 4513]} 100.0
d1fxza2174 Seed storage 7S protein {Soybean (Glycine max), pr 99.97
d1od5a2173 Seed storage 7S protein {Soybean (Glycine max), gl 99.97
d1j58a_372 Oxalate decarboxylase OxdC (YvrK) {Bacillus subtil 99.97
d1uika2185 Seed storage 7S protein {Soybean (Glycine max), be 99.96
g1dgw.1168 Seed storage 7S protein {Jack bean (Canavalia ensi 99.94
d1j58a_ 372 Oxalate decarboxylase OxdC (YvrK) {Bacillus subtil 99.91
d2phla2162 Seed storage 7S protein {French bean (Phaseolus vu 99.9
d1dgwa_178 Seed storage 7S protein {Jack bean (Canavalia ensi 99.86
d1uija1170 Seed storage 7S protein {Soybean (Glycine max), be 99.86
d1uika1203 Seed storage 7S protein {Soybean (Glycine max), be 99.84
d2phla1200 Seed storage 7S protein {French bean (Phaseolus vu 99.79
d1od5a1245 Seed storage 7S protein {Soybean (Glycine max), gl 99.78
d1fxza1239 Seed storage 7S protein {Soybean (Glycine max), pr 99.77
d1lr5a_160 Auxin binding protein {Maize (Zea mays) [TaxId: 45 99.55
d1o4ta_115 Hypothetical protein TM1287 {Thermotoga maritima [ 99.52
d1v70a_105 Hypothetical protein TTHA0104 {Thermus thermophilu 99.44
d2b8ma1108 Hypothetical protein MJ0764 {Archaeon Methanococcu 99.42
d1juha_ 348 Quercetin 2,3-dioxygenase {Aspergillus japonicus [ 99.41
d1y9qa299 Probable transcriptional regulator VC1968, C-termi 99.41
d1vj2a_114 Hypothetical protein TM1459 {Thermotoga maritima [ 99.4
d1sfna_245 Hypothetical protein DR1152 {Deinococcus radiodura 99.34
d1y3ta1330 Hypothetical protein YxaG {Bacillus subtilis [TaxI 99.33
d1sq4a_273 Glyoxylate-induced protein PA1140 {Pseudomonas aer 99.33
d1y3ta1 330 Hypothetical protein YxaG {Bacillus subtilis [TaxI 99.33
d1x82a_190 Glucose-6-phosphate isomerase, GPI {Archaeon Pyroc 99.32
d1sefa_250 Hypothetical protein EF2996 {Enterococcus faecalis 99.32
d2f4pa1134 Hypothetical protein TM1010 {Thermotoga maritima [ 99.31
d2d40a1 308 Gentisate 1,2-dioxygenase {Escherichia coli [TaxId 99.28
d1juha_348 Quercetin 2,3-dioxygenase {Aspergillus japonicus [ 99.27
d1sefa_250 Hypothetical protein EF2996 {Enterococcus faecalis 99.26
d1rc6a_253 Hypothetical protein YlbA {Escherichia coli [TaxId 99.26
d1sq4a_273 Glyoxylate-induced protein PA1140 {Pseudomonas aer 99.25
d3bu7a1355 Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [ 99.17
d2phda1 351 Gentisate 1,2-dioxygenase {Pseudaminobacter salicy 99.17
d1yhfa1112 Hypothetical protein SPy1581 {Streptococcus pyogen 99.16
d1rc6a_253 Hypothetical protein YlbA {Escherichia coli [TaxId 99.15
d2bnma2122 Hydroxypropylphosphonic acid epoxidase Fom4, C-ter 99.15
d1sfna_245 Hypothetical protein DR1152 {Deinococcus radiodura 99.08
d2pyta1128 Ethanolamine utilization protein EutQ {Salmonella 98.98
d3bu7a1 355 Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [ 98.93
d2d40a1308 Gentisate 1,2-dioxygenase {Escherichia coli [TaxId 98.92
d2phda1351 Gentisate 1,2-dioxygenase {Pseudaminobacter salicy 98.91
d1vr3a1179 Acireductone dioxygenase {Mouse (Mus musculus) [Ta 98.6
d1zrra1179 Acireductone dioxygenase {Klebsiella pneumoniae [T 98.54
d2o1qa1144 Putative acetyl/propionyl-CoA carboxylase subunit 98.29
d3elna1186 Cysteine dioxygenase type I {Rattus norvegicus [Ta 98.07
d2pa7a1135 dTDP-6-deoxy-3,4-keto-hexulose isomerase FdtA {Ane 97.95
d2arca_161 Regulatory protein AraC {Escherichia coli [TaxId: 97.88
d2gm6a1192 Cysteine dioxygenase type I {Ralstonia eutropha [T 97.84
d1yfua1174 3-hydroxyanthranilate-3,4-dioxygenase {Ralstonia m 97.74
d1zvfa1175 3-hydroxyanthranilate-3,4-dioxygenase {Baker's yea 97.67
d1eyba_ 439 Homogentisate dioxygenase {Human (Homo sapiens) [T 97.58
d1vrba1319 Putative asparaginyl hydroxylase YxbC {Bacillus su 97.3
d1o5ua_88 Hypothetical protein TM1112 {Thermotoga maritima [ 97.27
d2ixca1198 dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Mycobac 96.92
d1wlta1176 dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeo 96.91
d1dzra_183 dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Salmone 96.81
d1tq5a1231 Hypothetical protein YhhW {Escherichia coli [TaxId 96.65
d2ixha1184 dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Pseudom 96.63
d1oi6a_202 dTDP-4-keto-6-deoxy-glucose-5-epimerase EvaD {Amyc 96.58
d1ep0a_183 dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeo 96.5
d1h2ka_335 Hypoxia-inducible factor HIF ihhibitor (FIH1) {Hum 96.19
d1pmia_440 Phosphomannose isomerase {Yeast (Candida albicans) 96.12
d1j1la_288 Pirin {Human (Homo sapiens) [TaxId: 9606]} 96.01
d2c0za1190 Novobiocin biosynthesis protein NovW {Streptomyces 95.65
d1nxma_194 dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Strepto 95.6
d1qwra_315 Mannose-6-phosphate isomerase ManA {Bacillus subti 94.88
d1j1la_ 288 Pirin {Human (Homo sapiens) [TaxId: 9606]} 94.23
d1e5ra_290 Type II Proline 3-hydroxylase (proline oxidase) {S 91.39
d3dl3a196 Tellurite resistance protein B, TehB {Vibrio fisch 88.9
d1zx5a1299 Putative mannosephosphate isomerase AF0035 {Archae 87.17
d1yuda1158 Hypothetical protein SO0799 {Shewanella oneidensis 85.9
d3bb6a1109 Uncharacterized protein YeaR {Escherichia coli [Ta 85.53
d2oyza193 Uncharacterized protein VPA0057 {Vibrio parahaemol 84.48
>d2et1a1 b.82.1.2 (A:1-201) Germin {Barley (Hordeum vulgare) [TaxId: 4513]} Back     information, alignment and structure
class: All beta proteins
fold: Double-stranded beta-helix
superfamily: RmlC-like cupins
family: Germin/Seed storage 7S protein
domain: Germin
species: Barley (Hordeum vulgare) [TaxId: 4513]

Probab=100.00  E-value=0  Score=349.24  Aligned_cols=196  Identities=47%  Similarity=0.767  Sum_probs=187.7

Q ss_pred             CCCCCCCCEEECCC-C-CCCCCCCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCEEEEECCCCCCCCCCCCEEEEEEEEC
Q ss_conf             59999751661369-9-971158644688886788714415678983137898179992367878877650379999984
Q 027839           22 VDPDTLQDVCVADT-S-SVKVNGFACKDSANITADDFFFAGLAKPGVVNNSVGSLVTAANVEKIPGLNTLGVSLSRIDYE   99 (218)
Q Consensus        22 ~~~~~~~d~cv~~~-~-~~~~~g~~c~~p~~~~~~df~~~~~~~~~~~~~~~g~~~~~~~~~~~P~l~~~gis~~~~~l~   99 (218)
                      +||||||||||||+ + .+++||||||+++.++.+||+|+++..++++.++.|+.++.+++.+||+|+++|++++|+++.
T Consensus         1 sdp~~lqdfcvad~~~~~~~~~g~~ck~~~~~~~~~f~~~~l~~~~~~~~~~g~~vt~~~~~~fP~Ln~lglS~~rv~l~   80 (201)
T d2et1a1           1 TDPDPLQDFCVADLDGKAVSVNGHTCKPMSEAGDDFLFSSKLTKAGNTSTPNGSAVTELDVAEWPGTNTLGVSMNRVDFA   80 (201)
T ss_dssp             CCCCCSSSCCCBCCCTTSCCCSSCCBCCGGGCCSCTTCCCTTSSCCCCCSTTSEEEEEESTTTCGGGTTSSCEEEEEEEC
T ss_pred             CCCCCCCEEEEECCCCCCCCCCCCCCCCHHHCCCCCEEECCCCCCCCCCCCCCCEEEEEEHHCCCCCCCCCEEEEEEEEC
T ss_conf             99760251473158888510188255884545642012024356777668778378996112085514364337998988


Q ss_pred             CCCCCCCCCCCCCCEEEEEEEEEEEEEEEEC---CCCEEEEEEECCCEEEECCCCEEEEEECCCCCEEEEEEECCCCCCC
Q ss_conf             9962899778998389999973999999805---9907999970897999779972799918998899999961899753
Q 027839          100 AGGLNPPHTHPRATEMIFVLEGELDVGFIST---ADKLISKTVKKGEIYVFPKALVHFQKNNGDKPASVISAFNSQLPGT  176 (218)
Q Consensus       100 pg~~~~pH~H~~a~E~~yVl~G~~~v~~~~~---~~~~~~~~L~~Gd~~~iP~g~~H~~~N~g~~~a~~~~~~~~~~pg~  176 (218)
                      ||++.+||||++++|++||++|++++++.++   +++++..+|++||+++||+|.+|+++|.|++++.++++|++++|+.
T Consensus        81 pgg~~~PH~Hp~A~Ei~yV~~G~~~v~~v~~~~~~~~~~~~~l~~GDv~vvP~G~~H~~~N~g~~~a~~i~~f~s~~pg~  160 (201)
T d2et1a1          81 PGGTNPPHIHPRATEIGMVMKGELLVGILGSLDSGNKLYSRVVRAGETFVIPRGLMHFQFNVGKTEAYMVVSFNSQNPGI  160 (201)
T ss_dssp             TTCEEEEEECTTCCEEEEEEESCEEEEEECCGGGTTCEEEEEECTTCEEEECTTCCEEEEECSSSCEEEEEEESSSCCCC
T ss_pred             CCCCCCCCCCCCCCEEEEEECCEEEEEEEECCCCCCEEEEEEECCCCEEEECCCCEEEEEECCCCCEEEEEEECCCCCCC
T ss_conf             99884783659999999998362899998536888636888855997899889973899976999789999966899862


Q ss_pred             CHHCHHHHCCCCCCCHHHHHHHCCCCHHHHHHHHHHCCCCC
Q ss_conf             00000100279999988999870999999999886029999
Q 027839          177 QSIAATLFTATPPVPDNVLTKAFQVGTKEIEKIKSKLAPKK  217 (218)
Q Consensus       177 ~~~~~~lf~~~~~~p~~vl~~af~~~~~~v~~l~~~~~~~~  217 (218)
                      +.++.++|++.+++|+++|+++|++|++++++||++|++++
T Consensus       161 ~~~~~~~f~~~~~~p~eVLa~af~i~~~~v~kLks~f~g~s  201 (201)
T d2et1a1         161 VFVPLTLFGSDPPIPTPVLTKALRVEAGVVELLKSKFAGGS  201 (201)
T ss_dssp             EEHHHHHHHCSSCCCHHHHHHHHTSCHHHHHHHHHTTTTCC
T ss_pred             EEHHHHHHCCCCCCCHHHHHHHHCCCHHHHHHHHHHCCCCC
T ss_conf             33234654367789999999874979999999986525999
>d1fxza2 b.82.1.2 (A:297-470) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} Back     information, alignment and structure
>d1od5a2 b.82.1.2 (A:321-493) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} Back     information, alignment and structure
>d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1uika2 b.82.1.2 (A:351-535) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} Back     information, alignment and structure
>d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2phla2 b.82.1.2 (A:220-381) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} Back     information, alignment and structure
>d1dgwa_ b.82.1.2 (A:) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId: 3823]} Back     information, alignment and structure
>d1uija1 b.82.1.2 (A:6-175) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin beta subunit [TaxId: 3847]} Back     information, alignment and structure
>d1uika1 b.82.1.2 (A:148-350) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} Back     information, alignment and structure
>d2phla1 b.82.1.2 (A:11-210) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} Back     information, alignment and structure
>d1od5a1 b.82.1.2 (A:7-251) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} Back     information, alignment and structure
>d1fxza1 b.82.1.2 (A:10-248) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} Back     information, alignment and structure
>d1lr5a_ b.82.1.2 (A:) Auxin binding protein {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1o4ta_ b.82.1.9 (A:) Hypothetical protein TM1287 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1v70a_ b.82.1.9 (A:) Hypothetical protein TTHA0104 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2b8ma1 b.82.1.18 (A:1-108) Hypothetical protein MJ0764 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1juha_ b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId: 34381]} Back     information, alignment and structure
>d1y9qa2 b.82.1.15 (A:83-181) Probable transcriptional regulator VC1968, C-terminal domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1vj2a_ b.82.1.10 (A:) Hypothetical protein TM1459 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sfna_ b.82.1.11 (A:) Hypothetical protein DR1152 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1sq4a_ b.82.1.11 (A:) Glyoxylate-induced protein PA1140 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1x82a_ b.82.1.7 (A:) Glucose-6-phosphate isomerase, GPI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sefa_ b.82.1.11 (A:) Hypothetical protein EF2996 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2f4pa1 b.82.1.9 (A:2-135) Hypothetical protein TM1010 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2d40a1 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1juha_ b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId: 34381]} Back     information, alignment and structure
>d1sefa_ b.82.1.11 (A:) Hypothetical protein EF2996 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1rc6a_ b.82.1.11 (A:) Hypothetical protein YlbA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sq4a_ b.82.1.11 (A:) Glyoxylate-induced protein PA1140 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d3bu7a1 b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [TaxId: 89184]} Back     information, alignment and structure
>d2phda1 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Pseudaminobacter salicylatoxidans [TaxId: 93369]} Back     information, alignment and structure
>d1yhfa1 b.82.1.9 (A:1-112) Hypothetical protein SPy1581 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1rc6a_ b.82.1.11 (A:) Hypothetical protein YlbA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bnma2 b.82.1.10 (A:77-198) Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain {Streptomyces wedmorensis [TaxId: 43759]} Back     information, alignment and structure
>d1sfna_ b.82.1.11 (A:) Hypothetical protein DR1152 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2pyta1 b.82.1.24 (A:100-227) Ethanolamine utilization protein EutQ {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d3bu7a1 b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [TaxId: 89184]} Back     information, alignment and structure
>d2d40a1 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2phda1 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Pseudaminobacter salicylatoxidans [TaxId: 93369]} Back     information, alignment and structure
>d1vr3a1 b.82.1.6 (A:1-179) Acireductone dioxygenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zrra1 b.82.1.6 (A:1-179) Acireductone dioxygenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2o1qa1 b.82.1.21 (A:1-144) Putative acetyl/propionyl-CoA carboxylase subunit alpha Mpe_A3659 {Rubrivivax gelatinosus [TaxId: 28068]} Back     information, alignment and structure
>d3elna1 b.82.1.19 (A:5-190) Cysteine dioxygenase type I {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d2pa7a1 b.82.1.1 (A:2-136) dTDP-6-deoxy-3,4-keto-hexulose isomerase FdtA {Aneurinibacillus thermoaerophilus [TaxId: 143495]} Back     information, alignment and structure
>d2arca_ b.82.4.1 (A:) Regulatory protein AraC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gm6a1 b.82.1.19 (A:11-202) Cysteine dioxygenase type I {Ralstonia eutropha [TaxId: 106590]} Back     information, alignment and structure
>d1yfua1 b.82.1.20 (A:1-174) 3-hydroxyanthranilate-3,4-dioxygenase {Ralstonia metallidurans [TaxId: 119219]} Back     information, alignment and structure
>d1zvfa1 b.82.1.20 (A:1-175) 3-hydroxyanthranilate-3,4-dioxygenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1eyba_ b.82.1.4 (A:) Homogentisate dioxygenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vrba1 b.82.2.11 (A:8-326) Putative asparaginyl hydroxylase YxbC {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1o5ua_ b.82.1.8 (A:) Hypothetical protein TM1112 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ixca1 b.82.1.1 (A:1-198) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1wlta1 b.82.1.1 (A:1-176) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1dzra_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1tq5a1 b.82.1.12 (A:1-231) Hypothetical protein YhhW {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ixha1 b.82.1.1 (A:1-184) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1oi6a_ b.82.1.1 (A:) dTDP-4-keto-6-deoxy-glucose-5-epimerase EvaD {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1ep0a_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1h2ka_ b.82.2.6 (A:) Hypoxia-inducible factor HIF ihhibitor (FIH1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmia_ b.82.1.3 (A:) Phosphomannose isomerase {Yeast (Candida albicans) [TaxId: 5476]} Back     information, alignment and structure
>d1j1la_ b.82.1.12 (A:) Pirin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c0za1 b.82.1.1 (A:1-190) Novobiocin biosynthesis protein NovW {Streptomyces caeruleus [TaxId: 195949]} Back     information, alignment and structure
>d1nxma_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Streptococcus suis [TaxId: 1307]} Back     information, alignment and structure
>d1qwra_ b.82.1.3 (A:) Mannose-6-phosphate isomerase ManA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1j1la_ b.82.1.12 (A:) Pirin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e5ra_ b.82.2.4 (A:) Type II Proline 3-hydroxylase (proline oxidase) {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d3dl3a1 b.82.2.13 (A:5-100) Tellurite resistance protein B, TehB {Vibrio fischeri [TaxId: 668]} Back     information, alignment and structure
>d1zx5a1 b.82.1.3 (A:1-299) Putative mannosephosphate isomerase AF0035 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1yuda1 b.82.1.16 (A:1-158) Hypothetical protein SO0799 {Shewanella oneidensis [TaxId: 70863]} Back     information, alignment and structure
>d3bb6a1 b.82.2.13 (A:1-109) Uncharacterized protein YeaR {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2oyza1 b.82.1.22 (A:2-94) Uncharacterized protein VPA0057 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure