Citrus Sinensis ID: 027840

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------22
MDHEDVPSAPSTPATPGTPGAPLFGGFRGDHRGTNGRKSLLKSCKCFSVEEWAIEDGRLPSVSCSLPPPPVSLARKVGAEFVGTLILIFAGTATAIVNQKTQGSETLIGLAGSTGLAVMVVILSTGHISGAHLNPAVTIAFAALKHFPWKHVPVYIGAQIMASLCAAFALKGIFHPIMGGGVTVPSAGYGEAFALEFIISFNLMFVVTAVATDTRAVS
cccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHccccccccc
******************PGAPLFG***************LKSCKCFSVE**********SVSCSLPPPPVSLARKVGAEFVGTLILIFAGTATAIVNQKTQGSETLIGLAGSTGLAVMVVILSTGHISGAHLNPAVTIAFAALKHFPWKHVPVYIGAQIMASLCAAFALKGIFHPIMGGGVTVPSAGYGEAFALEFIISFNLMFVVTAVATDT****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDHEDVPSAPSTPATPGTPGAPLFGGFRGDHRGTNGRKSLLKSCKCFSVEEWAIEDGRLPSVSCSLPPPPVSLARKVGAEFVGTLILIFAGTATAIVNQKTQGSETLIGLAGSTGLAVMVVILSTGHISGAHLNPAVTIAFAALKHFPWKHVPVYIGAQIMASLCAAFALKGIFHPIMGGGVTVPSAGYGEAFALEFIISFNLMFVVTAVATDTRAVS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Aquaporin NIP6-1 Transports glycerol, urea and formamide, in Xenopus laevis oocytes. Very low water transport activity.probableQ9SAI4
Aquaporin NIP3-1 Aquaporins facilitate the transport of water and small neutral solutes across cell membranes.probableQ0IWF3

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3LLQ, chain A
Confidence level:confident
Coverage over the Query: 73-218
View the alignment between query and template
View the model in PyMOL