Citrus Sinensis ID: 027843


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------22
MASVSSPMASQLKSSFTSPVSRSLLTPRGISGSPFRVVPSKRSPRFLVKAIQSEKPTYQVIQPINGDPFIGSLETPITSSPLIAWYLSNLPAYRTAVSPLLRGVEVGLAHGFLLVGPFVKAGPLRNTEIAGPAGSLAAGGLVVILSICLTIYGIASFSEGEPSTAPGLTLTGRKKEPDQLQTADGWAKFTGGFFFGGISGVIWAYFLLYVLNLPYFVK
cccccccHHHHHHHcccccccccccccccccccccccccccccccHHHHHHcccccccCEEEccccccccccccccccccHHHHHHHHccccccccccccHHHHHHHHHHccEECccEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccHHHHHccccHHcccHHHHHHHHHHHHHcccccccc
************************L********************FLVKAIQSEKPTYQVIQPINGDPFIGSLETPITSSPLIAWYLSNLPAYRTAVSPLLRGVEVGLAHGFLLVGPFVKAGPLRNTEIAGPAGSLAAGGLVVILSICLTIYGIASFS***************K***DQLQTADGWAKFTGGFFFGGISGVIWAYFLLYVLNLPYFVK
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASVSSPMASQLKSSFTSPVSRSLLTPRGISGSPFRVVPSKRSPRFLVKAIQSEKPTYQVIQPINGDPFIGSLETPITSSPLIAWYLSNLPAYRTAVSPLLRGVEVGLAHGFLLVGPFVKAGPLRNTEIAGPAGSLAAGGLVVILSICLTIYGIASFSEGEPSTAPGLTLTGRKKEPDQLQTADGWAKFTGGFFFGGISGVIWAYFLLYVLNLPYFVK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Photosystem I reaction center subunit XI, chloroplastic confidentQ9SUI4
Photosystem I reaction center subunit XI, chloroplastic probableQ41385
Photosystem I reaction center subunit XI, chloroplastic probableQ39654

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2WSC, chain L
Confidence level:very confident
Coverage over the Query: 55-215
View the alignment between query and template
View the model in PyMOL