Citrus Sinensis ID: 027860
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 217 | ||||||
| 225425648 | 306 | PREDICTED: methyltransferase-like protei | 0.774 | 0.549 | 0.718 | 2e-68 | |
| 224101379 | 317 | predicted protein [Populus trichocarpa] | 0.935 | 0.640 | 0.610 | 2e-67 | |
| 356499831 | 312 | PREDICTED: methyltransferase-like protei | 0.783 | 0.544 | 0.674 | 2e-64 | |
| 449435332 | 317 | PREDICTED: methyltransferase-like protei | 0.797 | 0.545 | 0.661 | 3e-61 | |
| 449478656 | 317 | PREDICTED: methyltransferase-like protei | 0.797 | 0.545 | 0.661 | 9e-61 | |
| 449434764 | 307 | PREDICTED: methyltransferase-like protei | 0.940 | 0.664 | 0.573 | 1e-60 | |
| 388500316 | 323 | unknown [Lotus japonicus] | 0.783 | 0.526 | 0.644 | 1e-59 | |
| 255562908 | 310 | S-adenosylmethionine-dependent methyltra | 0.751 | 0.525 | 0.703 | 5e-59 | |
| 357487139 | 375 | Methyltransferase-like protein 7A [Medic | 0.783 | 0.453 | 0.626 | 5e-58 | |
| 18409299 | 300 | S-adenosylmethionine-dependent methyltra | 0.824 | 0.596 | 0.572 | 3e-51 |
| >gi|225425648|ref|XP_002272557.1| PREDICTED: methyltransferase-like protein 7A [Vitis vinifera] gi|296086353|emb|CBI31942.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 264 bits (674), Expect = 2e-68, Method: Compositional matrix adjust.
Identities = 125/174 (71%), Positives = 146/174 (83%), Gaps = 6/174 (3%)
Query: 43 CCCGSRRHFIQGASTALFPLVYSSTPSSASSP-SDSMAMLNRLHPPRPDWYEEFYASVMN 101
C CG RRH IQ +TAL P+ +PS A+ SDS AMLNR+HPPRPDWYEE YA+V++
Sbjct: 53 CSCG-RRHLIQACATALLPI----SPSHATPLLSDSTAMLNRVHPPRPDWYEELYAAVLD 107
Query: 102 SSMKSYEAEVAGYKSQLFDNLRGKAKKVLEIGIGTGPNLKYYAADTDVQVLGVDPNRKME 161
M++YEAE+AGYKSQLF NLRGKAKKVLEIGIGTGPNLKYYA TD++V G+DPN KME
Sbjct: 108 KGMEAYEAEIAGYKSQLFSNLRGKAKKVLEIGIGTGPNLKYYANGTDIEVFGIDPNMKME 167
Query: 162 KYAQTAAVAAGLPLTNFKFLQAVGEAIPVSDASVDAVVGTLVLCSVKDVDMTLQ 215
KYA+ AAVA+GLP TNFKF+ AVGEA+P+SDA+VDAVVGTLVLCSVKDVD L+
Sbjct: 168 KYAKAAAVASGLPPTNFKFIHAVGEALPLSDAAVDAVVGTLVLCSVKDVDTALK 221
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224101379|ref|XP_002312254.1| predicted protein [Populus trichocarpa] gi|222852074|gb|EEE89621.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356499831|ref|XP_003518740.1| PREDICTED: methyltransferase-like protein 7A-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449435332|ref|XP_004135449.1| PREDICTED: methyltransferase-like protein 7A-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449478656|ref|XP_004155382.1| PREDICTED: methyltransferase-like protein 7A-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449434764|ref|XP_004135166.1| PREDICTED: methyltransferase-like protein 7A-like [Cucumis sativus] gi|449478387|ref|XP_004155304.1| PREDICTED: methyltransferase-like protein 7A-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|388500316|gb|AFK38224.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|255562908|ref|XP_002522459.1| S-adenosylmethionine-dependent methyltransferase, putative [Ricinus communis] gi|223538344|gb|EEF39951.1| S-adenosylmethionine-dependent methyltransferase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|357487139|ref|XP_003613857.1| Methyltransferase-like protein 7A [Medicago truncatula] gi|355515192|gb|AES96815.1| Methyltransferase-like protein 7A [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|18409299|ref|NP_564969.1| S-adenosylmethionine-dependent methyltransferase domain-containing protein [Arabidopsis thaliana] gi|15450409|gb|AAK96498.1| At1g69520/F10D13_17 [Arabidopsis thaliana] gi|20466111|gb|AAM19977.1| At1g69520/F10D13_17 [Arabidopsis thaliana] gi|332196817|gb|AEE34938.1| S-adenosylmethionine-dependent methyltransferase domain-containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 217 | ||||||
| TAIR|locus:505006213 | 300 | AT1G69523 [Arabidopsis thalian | 0.751 | 0.543 | 0.571 | 1.2e-44 | |
| TAIR|locus:505006214 | 307 | AT1G69526 [Arabidopsis thalian | 0.746 | 0.527 | 0.502 | 1.8e-39 | |
| UNIPROTKB|J9NTA1 | 245 | METTL7A "Uncharacterized prote | 0.543 | 0.481 | 0.389 | 2.7e-13 | |
| RGD|2323731 | 166 | LOC100362962 "methyltransferas | 0.488 | 0.638 | 0.426 | 3.4e-13 | |
| UNIPROTKB|F1N7H2 | 179 | LOC781439 "Uncharacterized pro | 0.488 | 0.592 | 0.408 | 4.4e-13 | |
| UNIPROTKB|Q3MHK8 | 244 | METTL7A "Uncharacterized prote | 0.488 | 0.434 | 0.408 | 4.4e-13 | |
| UNIPROTKB|F8VQX6 | 180 | METTL7A "Methyltransferase-lik | 0.488 | 0.588 | 0.4 | 9.1e-13 | |
| UNIPROTKB|H0YI09 | 244 | METTL7A "Methyltransferase-lik | 0.488 | 0.434 | 0.4 | 9.1e-13 | |
| UNIPROTKB|Q9H8H3 | 244 | METTL7A "Methyltransferase-lik | 0.488 | 0.434 | 0.4 | 9.1e-13 | |
| ZFIN|ZDB-GENE-061027-239 | 242 | mettl7a "methyltransferase lik | 0.562 | 0.504 | 0.351 | 3.1e-12 |
| TAIR|locus:505006213 AT1G69523 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 470 (170.5 bits), Expect = 1.2e-44, P = 1.2e-44
Identities = 96/168 (57%), Positives = 116/168 (69%)
Query: 48 RRHFIQGASTALFPLVYXXXXXXXXXXXXXXXXLNRLHPPRPDWYEEFYASVMNSSMKSY 107
RRHFI A T++ P + L RL PP+PDWYEEF+A MNS ++SY
Sbjct: 52 RRHFIGAAMTSM-PFL----PISPSHASTSTEDLKRLRPPKPDWYEEFFAWSMNSEVESY 106
Query: 108 EAEVAGYKSQLFDNLRGKAKKVLEIGIGTGPNLKYYAADTDVQVLGVDPNRKMEKYAQTA 167
E EV+ YK +LFDNL GKA+KVLEIGIGTGPN KYY +V V+G+DPN KME YA+ +
Sbjct: 107 EKEVSDYKMKLFDNLVGKAEKVLEIGIGTGPNFKYYTDIPNVSVIGIDPNAKMESYARKS 166
Query: 168 AVAAGLPLTNFKFLQAVGEAIPVSDASVDAVVGTLVLCSVKDVDMTLQ 215
A AGL F F+ A+GE+IP+ DASVDAVVGTLVLCSV DV TL+
Sbjct: 167 ATEAGLKPEEFTFVHALGESIPLEDASVDAVVGTLVLCSVTDVTQTLK 214
|
|
| TAIR|locus:505006214 AT1G69526 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9NTA1 METTL7A "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| RGD|2323731 LOC100362962 "methyltransferase like 7A-like" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1N7H2 LOC781439 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q3MHK8 METTL7A "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F8VQX6 METTL7A "Methyltransferase-like protein 7A" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|H0YI09 METTL7A "Methyltransferase-like protein 7A" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9H8H3 METTL7A "Methyltransferase-like protein 7A" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-061027-239 mettl7a "methyltransferase like 7A" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00036939001 | SubName- Full=Chromosome chr1 scaffold_84, whole genome shotgun sequence; (306 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 217 | |||
| pfam08241 | 92 | pfam08241, Methyltransf_11, Methyltransferase doma | 9e-14 | |
| PRK08317 | 241 | PRK08317, PRK08317, hypothetical protein; Provisio | 7e-12 | |
| cd02440 | 107 | cd02440, AdoMet_MTases, S-adenosylmethionine-depen | 1e-08 | |
| COG0500 | 257 | COG0500, SmtA, SAM-dependent methyltransferases [S | 2e-08 | |
| COG2226 | 238 | COG2226, UbiE, Methylase involved in ubiquinone/me | 5e-07 | |
| pfam13847 | 151 | pfam13847, Methyltransf_31, Methyltransferase doma | 1e-06 | |
| pfam13489 | 154 | pfam13489, Methyltransf_23, Methyltransferase doma | 1e-06 | |
| pfam12847 | 104 | pfam12847, Methyltransf_18, Methyltransferase doma | 1e-06 | |
| pfam08242 | 98 | pfam08242, Methyltransf_12, Methyltransferase doma | 4e-06 | |
| COG2230 | 283 | COG2230, Cfa, Cyclopropane fatty acid synthase and | 2e-05 | |
| pfam13649 | 97 | pfam13649, Methyltransf_25, Methyltransferase doma | 4e-05 | |
| TIGR01934 | 223 | TIGR01934, MenG_MenH_UbiE, ubiquinone/menaquinone | 3e-04 | |
| PRK00216 | 239 | PRK00216, ubiE, ubiquinone/menaquinone biosynthesi | 9e-04 | |
| PRK11873 | 272 | PRK11873, arsM, arsenite S-adenosylmethyltransfera | 0.004 |
| >gnl|CDD|219759 pfam08241, Methyltransf_11, Methyltransferase domain | Back alignment and domain information |
|---|
Score = 64.2 bits (157), Expect = 9e-14
Identities = 27/86 (31%), Positives = 40/86 (46%), Gaps = 8/86 (9%)
Query: 130 LEIGIGTGPNLKYYAADTDVQVLGVDPNRKMEKYAQTAAVAAGLPLTNFKFLQAVGEAIP 189
L++G GTG + A +V GVD + +M A+ A KF+ E +P
Sbjct: 1 LDVGCGTGLLAEALARRGGARVTGVDLSPEMLALARKRA--------PRKFVVGDAEDLP 52
Query: 190 VSDASVDAVVGTLVLCSVKDVDMTLQ 215
D S D VV +LVL + D + L+
Sbjct: 53 FPDESFDVVVSSLVLHHLPDPERALR 78
|
Members of this family are SAM dependent methyltransferases. Length = 92 |
| >gnl|CDD|181382 PRK08317, PRK08317, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|100107 cd02440, AdoMet_MTases, S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) | Back alignment and domain information |
|---|
| >gnl|CDD|223574 COG0500, SmtA, SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|225136 COG2226, UbiE, Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|222415 pfam13847, Methyltransf_31, Methyltransferase domain | Back alignment and domain information |
|---|
| >gnl|CDD|222171 pfam13489, Methyltransf_23, Methyltransferase domain | Back alignment and domain information |
|---|
| >gnl|CDD|221804 pfam12847, Methyltransf_18, Methyltransferase domain | Back alignment and domain information |
|---|
| >gnl|CDD|219760 pfam08242, Methyltransf_12, Methyltransferase domain | Back alignment and domain information |
|---|
| >gnl|CDD|225139 COG2230, Cfa, Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|222287 pfam13649, Methyltransf_25, Methyltransferase domain | Back alignment and domain information |
|---|
| >gnl|CDD|233645 TIGR01934, MenG_MenH_UbiE, ubiquinone/menaquinone biosynthesis methyltransferases | Back alignment and domain information |
|---|
| >gnl|CDD|234689 PRK00216, ubiE, ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237007 PRK11873, arsM, arsenite S-adenosylmethyltransferase; Reviewed | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 217 | |||
| COG2226 | 238 | UbiE Methylase involved in ubiquinone/menaquinone | 99.86 | |
| PRK11088 | 272 | rrmA 23S rRNA methyltransferase A; Provisional | 99.84 | |
| PF01209 | 233 | Ubie_methyltran: ubiE/COQ5 methyltransferase famil | 99.82 | |
| KOG4300 | 252 | consensus Predicted methyltransferase [General fun | 99.79 | |
| PLN02244 | 340 | tocopherol O-methyltransferase | 99.78 | |
| PLN02396 | 322 | hexaprenyldihydroxybenzoate methyltransferase | 99.76 | |
| PLN02233 | 261 | ubiquinone biosynthesis methyltransferase | 99.74 | |
| PRK05785 | 226 | hypothetical protein; Provisional | 99.73 | |
| COG2227 | 243 | UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- | 99.72 | |
| TIGR02752 | 231 | MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me | 99.69 | |
| KOG1540 | 296 | consensus Ubiquinone biosynthesis methyltransferas | 99.68 | |
| PRK11036 | 255 | putative S-adenosyl-L-methionine-dependent methylt | 99.68 | |
| PF13847 | 152 | Methyltransf_31: Methyltransferase domain; PDB: 3T | 99.67 | |
| PF08241 | 95 | Methyltransf_11: Methyltransferase domain; InterPr | 99.67 | |
| PRK10258 | 251 | biotin biosynthesis protein BioC; Provisional | 99.64 | |
| PRK14103 | 255 | trans-aconitate 2-methyltransferase; Provisional | 99.62 | |
| TIGR03587 | 204 | Pse_Me-ase pseudaminic acid biosynthesis-associate | 99.6 | |
| PF12847 | 112 | Methyltransf_18: Methyltransferase domain; PDB: 3G | 99.6 | |
| PRK15451 | 247 | tRNA cmo(5)U34 methyltransferase; Provisional | 99.6 | |
| PRK01683 | 258 | trans-aconitate 2-methyltransferase; Provisional | 99.58 | |
| PRK11207 | 197 | tellurite resistance protein TehB; Provisional | 99.57 | |
| PRK15068 | 322 | tRNA mo(5)U34 methyltransferase; Provisional | 99.57 | |
| PF07021 | 193 | MetW: Methionine biosynthesis protein MetW; InterP | 99.56 | |
| PRK06202 | 232 | hypothetical protein; Provisional | 99.56 | |
| PTZ00098 | 263 | phosphoethanolamine N-methyltransferase; Provision | 99.56 | |
| COG2230 | 283 | Cfa Cyclopropane fatty acid synthase and related m | 99.55 | |
| KOG1270 | 282 | consensus Methyltransferases [Coenzyme transport a | 99.55 | |
| PF13649 | 101 | Methyltransf_25: Methyltransferase domain; PDB: 3B | 99.55 | |
| PLN02336 | 475 | phosphoethanolamine N-methyltransferase | 99.54 | |
| TIGR00740 | 239 | methyltransferase, putative. A simple BLAST search | 99.54 | |
| PLN02490 | 340 | MPBQ/MSBQ methyltransferase | 99.53 | |
| TIGR02021 | 219 | BchM-ChlM magnesium protoporphyrin O-methyltransfe | 99.53 | |
| PF02353 | 273 | CMAS: Mycolic acid cyclopropane synthetase; InterP | 99.53 | |
| TIGR02081 | 194 | metW methionine biosynthesis protein MetW. This pr | 99.53 | |
| PRK11873 | 272 | arsM arsenite S-adenosylmethyltransferase; Reviewe | 99.52 | |
| TIGR00452 | 314 | methyltransferase, putative. Known examples to dat | 99.51 | |
| PRK08317 | 241 | hypothetical protein; Provisional | 99.5 | |
| TIGR00477 | 195 | tehB tellurite resistance protein TehB. Part of a | 99.49 | |
| TIGR02072 | 240 | BioC biotin biosynthesis protein BioC. This enzyme | 99.49 | |
| PRK00216 | 239 | ubiE ubiquinone/menaquinone biosynthesis methyltra | 99.47 | |
| PF08242 | 99 | Methyltransf_12: Methyltransferase domain; InterPr | 99.47 | |
| PRK07580 | 230 | Mg-protoporphyrin IX methyl transferase; Validated | 99.47 | |
| PRK12335 | 287 | tellurite resistance protein TehB; Provisional | 99.47 | |
| COG4106 | 257 | Tam Trans-aconitate methyltransferase [General fun | 99.46 | |
| smart00828 | 224 | PKS_MT Methyltransferase in polyketide synthase (P | 99.45 | |
| PF03848 | 192 | TehB: Tellurite resistance protein TehB; InterPro: | 99.44 | |
| PRK00107 | 187 | gidB 16S rRNA methyltransferase GidB; Reviewed | 99.44 | |
| TIGR00138 | 181 | gidB 16S rRNA methyltransferase GidB. GidB (glucos | 99.44 | |
| PRK13944 | 205 | protein-L-isoaspartate O-methyltransferase; Provis | 99.43 | |
| PF05401 | 201 | NodS: Nodulation protein S (NodS); InterPro: IPR00 | 99.42 | |
| PF13489 | 161 | Methyltransf_23: Methyltransferase domain; PDB: 3J | 99.42 | |
| PLN02585 | 315 | magnesium protoporphyrin IX methyltransferase | 99.42 | |
| PRK06922 | 677 | hypothetical protein; Provisional | 99.42 | |
| TIGR01934 | 223 | MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis | 99.42 | |
| PRK13942 | 212 | protein-L-isoaspartate O-methyltransferase; Provis | 99.39 | |
| PRK00121 | 202 | trmB tRNA (guanine-N(7)-)-methyltransferase; Revie | 99.38 | |
| TIGR00080 | 215 | pimt protein-L-isoaspartate(D-aspartate) O-methylt | 99.36 | |
| PLN03075 | 296 | nicotianamine synthase; Provisional | 99.36 | |
| PRK11705 | 383 | cyclopropane fatty acyl phospholipid synthase; Pro | 99.34 | |
| PF08003 | 315 | Methyltransf_9: Protein of unknown function (DUF16 | 99.34 | |
| KOG1271 | 227 | consensus Methyltransferases [General function pre | 99.34 | |
| TIGR02469 | 124 | CbiT precorrin-6Y C5,15-methyltransferase (decarbo | 99.33 | |
| KOG1541 | 270 | consensus Predicted protein carboxyl methylase [Ge | 99.31 | |
| smart00138 | 264 | MeTrc Methyltransferase, chemotaxis proteins. Meth | 99.31 | |
| PLN02336 | 475 | phosphoethanolamine N-methyltransferase | 99.29 | |
| TIGR01983 | 224 | UbiG ubiquinone biosynthesis O-methyltransferase. | 99.28 | |
| PRK05134 | 233 | bifunctional 3-demethylubiquinone-9 3-methyltransf | 99.28 | |
| TIGR00091 | 194 | tRNA (guanine-N(7)-)-methyltransferase. In E. coli | 99.26 | |
| TIGR03840 | 213 | TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d | 99.26 | |
| smart00650 | 169 | rADc Ribosomal RNA adenine dimethylases. | 99.26 | |
| PRK08287 | 187 | cobalt-precorrin-6Y C(15)-methyltransferase; Valid | 99.24 | |
| PF05175 | 170 | MTS: Methyltransferase small domain; InterPro: IPR | 99.24 | |
| KOG1499 | 346 | consensus Protein arginine N-methyltransferase PRM | 99.24 | |
| PF01135 | 209 | PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl | 99.23 | |
| PF13659 | 117 | Methyltransf_26: Methyltransferase domain; PDB: 3G | 99.23 | |
| PRK00312 | 212 | pcm protein-L-isoaspartate O-methyltransferase; Re | 99.22 | |
| PRK14121 | 390 | tRNA (guanine-N(7)-)-methyltransferase; Provisiona | 99.22 | |
| TIGR03534 | 251 | RF_mod_PrmC protein-(glutamine-N5) methyltransfera | 99.21 | |
| PRK13255 | 218 | thiopurine S-methyltransferase; Reviewed | 99.21 | |
| TIGR00537 | 179 | hemK_rel_arch HemK-related putative methylase. The | 99.21 | |
| PRK13943 | 322 | protein-L-isoaspartate O-methyltransferase; Provis | 99.2 | |
| COG4123 | 248 | Predicted O-methyltransferase [General function pr | 99.18 | |
| PRK00377 | 198 | cbiT cobalt-precorrin-6Y C(15)-methyltransferase; | 99.18 | |
| PRK15001 | 378 | SAM-dependent 23S ribosomal RNA mG1835 methyltrans | 99.18 | |
| TIGR00406 | 288 | prmA ribosomal protein L11 methyltransferase. Ribo | 99.18 | |
| TIGR02716 | 306 | C20_methyl_CrtF C-20 methyltransferase BchU. Membe | 99.16 | |
| COG2518 | 209 | Pcm Protein-L-isoaspartate carboxylmethyltransfera | 99.15 | |
| TIGR03533 | 284 | L3_gln_methyl protein-(glutamine-N5) methyltransfe | 99.15 | |
| COG2263 | 198 | Predicted RNA methylase [Translation, ribosomal st | 99.14 | |
| PRK14966 | 423 | unknown domain/N5-glutamine S-adenosyl-L-methionin | 99.13 | |
| PRK14967 | 223 | putative methyltransferase; Provisional | 99.13 | |
| TIGR00536 | 284 | hemK_fam HemK family putative methylases. The gene | 99.11 | |
| PRK03522 | 315 | rumB 23S rRNA methyluridine methyltransferase; Rev | 99.11 | |
| PRK11805 | 307 | N5-glutamine S-adenosyl-L-methionine-dependent met | 99.11 | |
| TIGR01177 | 329 | conserved hypothetical protein TIGR01177. This fam | 99.1 | |
| PRK09489 | 342 | rsmC 16S ribosomal RNA m2G1207 methyltransferase; | 99.09 | |
| COG4976 | 287 | Predicted methyltransferase (contains TPR repeat) | 99.09 | |
| COG2242 | 187 | CobL Precorrin-6B methylase 2 [Coenzyme metabolism | 99.09 | |
| PRK13168 | 443 | rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe | 99.08 | |
| PRK14896 | 258 | ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 | 99.08 | |
| PRK14968 | 188 | putative methyltransferase; Provisional | 99.07 | |
| PRK11188 | 209 | rrmJ 23S rRNA methyltransferase J; Provisional | 99.07 | |
| PF06325 | 295 | PrmA: Ribosomal protein L11 methyltransferase (Prm | 99.06 | |
| COG2264 | 300 | PrmA Ribosomal protein L11 methylase [Translation, | 99.06 | |
| PHA03411 | 279 | putative methyltransferase; Provisional | 99.04 | |
| PRK07402 | 196 | precorrin-6B methylase; Provisional | 99.03 | |
| KOG3010 | 261 | consensus Methyltransferase [General function pred | 99.03 | |
| PRK00274 | 272 | ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 | 99.03 | |
| TIGR03438 | 301 | probable methyltransferase. This model represents | 99.03 | |
| PRK00517 | 250 | prmA ribosomal protein L11 methyltransferase; Revi | 99.03 | |
| cd02440 | 107 | AdoMet_MTases S-adenosylmethionine-dependent methy | 99.03 | |
| PRK13256 | 226 | thiopurine S-methyltransferase; Reviewed | 99.02 | |
| PTZ00338 | 294 | dimethyladenosine transferase-like protein; Provis | 99.02 | |
| PRK10909 | 199 | rsmD 16S rRNA m(2)G966-methyltransferase; Provisio | 99.01 | |
| KOG2940 | 325 | consensus Predicted methyltransferase [General fun | 99.0 | |
| PRK01544 | 506 | bifunctional N5-glutamine S-adenosyl-L-methionine- | 98.97 | |
| PHA03412 | 241 | putative methyltransferase; Provisional | 98.97 | |
| PRK09328 | 275 | N5-glutamine S-adenosyl-L-methionine-dependent met | 98.97 | |
| PF05185 | 448 | PRMT5: PRMT5 arginine-N-methyltransferase; InterPr | 98.96 | |
| COG2813 | 300 | RsmC 16S RNA G1207 methylase RsmC [Translation, ri | 98.95 | |
| COG2890 | 280 | HemK Methylase of polypeptide chain release factor | 98.95 | |
| KOG1500 | 517 | consensus Protein arginine N-methyltransferase CAR | 98.95 | |
| PLN02781 | 234 | Probable caffeoyl-CoA O-methyltransferase | 98.92 | |
| PLN02232 | 160 | ubiquinone biosynthesis methyltransferase | 98.92 | |
| PRK04266 | 226 | fibrillarin; Provisional | 98.9 | |
| TIGR00479 | 431 | rumA 23S rRNA (uracil-5-)-methyltransferase RumA. | 98.9 | |
| PF02390 | 195 | Methyltransf_4: Putative methyltransferase ; Inter | 98.9 | |
| PRK11727 | 321 | 23S rRNA mA1618 methyltransferase; Provisional | 98.89 | |
| KOG3420 | 185 | consensus Predicted RNA methylase [Translation, ri | 98.89 | |
| PRK14904 | 445 | 16S rRNA methyltransferase B; Provisional | 98.88 | |
| PRK15128 | 396 | 23S rRNA m(5)C1962 methyltransferase; Provisional | 98.88 | |
| TIGR03704 | 251 | PrmC_rel_meth putative protein-(glutamine-N5) meth | 98.86 | |
| TIGR00755 | 253 | ksgA dimethyladenosine transferase. Alternate name | 98.86 | |
| TIGR02085 | 374 | meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer | 98.85 | |
| PRK14901 | 434 | 16S rRNA methyltransferase B; Provisional | 98.85 | |
| PRK14903 | 431 | 16S rRNA methyltransferase B; Provisional | 98.84 | |
| TIGR00446 | 264 | nop2p NOL1/NOP2/sun family putative RNA methylase. | 98.84 | |
| PRK04457 | 262 | spermidine synthase; Provisional | 98.83 | |
| PRK11783 | 702 | rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi | 98.82 | |
| PRK10901 | 427 | 16S rRNA methyltransferase B; Provisional | 98.82 | |
| PF01596 | 205 | Methyltransf_3: O-methyltransferase; InterPro: IPR | 98.8 | |
| PF03291 | 331 | Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 | 98.79 | |
| PRK14902 | 444 | 16S rRNA methyltransferase B; Provisional | 98.78 | |
| PF05724 | 218 | TPMT: Thiopurine S-methyltransferase (TPMT); Inter | 98.75 | |
| PLN02476 | 278 | O-methyltransferase | 98.75 | |
| PF01170 | 179 | UPF0020: Putative RNA methylase family UPF0020; In | 98.75 | |
| TIGR00478 | 228 | tly hemolysin TlyA family protein. Hemolysins are | 98.74 | |
| PRK00811 | 283 | spermidine synthase; Provisional | 98.74 | |
| PTZ00146 | 293 | fibrillarin; Provisional | 98.72 | |
| PRK04148 | 134 | hypothetical protein; Provisional | 98.71 | |
| PLN02672 | 1082 | methionine S-methyltransferase | 98.71 | |
| TIGR00563 | 426 | rsmB ribosomal RNA small subunit methyltransferase | 98.71 | |
| TIGR00438 | 188 | rrmJ cell division protein FtsJ. | 98.7 | |
| TIGR00095 | 189 | RNA methyltransferase, RsmD family. This model rep | 98.7 | |
| KOG2904 | 328 | consensus Predicted methyltransferase [General fun | 98.67 | |
| COG4122 | 219 | Predicted O-methyltransferase [General function pr | 98.67 | |
| KOG2361 | 264 | consensus Predicted methyltransferase [General fun | 98.65 | |
| PF00891 | 241 | Methyltransf_2: O-methyltransferase; InterPro: IPR | 98.65 | |
| PRK00050 | 296 | 16S rRNA m(4)C1402 methyltranserfase; Provisional | 98.64 | |
| PF02475 | 200 | Met_10: Met-10+ like-protein; InterPro: IPR003402 | 98.63 | |
| TIGR02143 | 353 | trmA_only tRNA (uracil-5-)-methyltransferase. This | 98.61 | |
| PF08704 | 247 | GCD14: tRNA methyltransferase complex GCD14 subuni | 98.6 | |
| PLN02366 | 308 | spermidine synthase | 98.6 | |
| PRK05031 | 362 | tRNA (uracil-5-)-methyltransferase; Validated | 98.6 | |
| PRK03612 | 521 | spermidine synthase; Provisional | 98.6 | |
| KOG1975 | 389 | consensus mRNA cap methyltransferase [RNA processi | 98.59 | |
| PLN02589 | 247 | caffeoyl-CoA O-methyltransferase | 98.58 | |
| PF05891 | 218 | Methyltransf_PK: AdoMet dependent proline di-methy | 98.57 | |
| COG0220 | 227 | Predicted S-adenosylmethionine-dependent methyltra | 98.56 | |
| PF10294 | 173 | Methyltransf_16: Putative methyltransferase; Inter | 98.55 | |
| COG2519 | 256 | GCD14 tRNA(1-methyladenosine) methyltransferase an | 98.55 | |
| PRK01581 | 374 | speE spermidine synthase; Validated | 98.55 | |
| KOG3191 | 209 | consensus Predicted N6-DNA-methyltransferase [Tran | 98.55 | |
| PF05958 | 352 | tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferas | 98.53 | |
| COG0030 | 259 | KsgA Dimethyladenosine transferase (rRNA methylati | 98.52 | |
| KOG1331 | 293 | consensus Predicted methyltransferase [General fun | 98.51 | |
| PF13679 | 141 | Methyltransf_32: Methyltransferase domain | 98.5 | |
| COG2265 | 432 | TrmA SAM-dependent methyltransferases related to t | 98.49 | |
| KOG0820 | 315 | consensus Ribosomal RNA adenine dimethylase [RNA p | 98.48 | |
| TIGR00417 | 270 | speE spermidine synthase. the SpeE subunit of sper | 98.46 | |
| PF09445 | 163 | Methyltransf_15: RNA cap guanine-N2 methyltransfer | 98.43 | |
| COG1041 | 347 | Predicted DNA modification methylase [DNA replicat | 98.4 | |
| PRK01544 | 506 | bifunctional N5-glutamine S-adenosyl-L-methionine- | 98.38 | |
| COG3963 | 194 | Phospholipid N-methyltransferase [Lipid metabolism | 98.35 | |
| PF05219 | 265 | DREV: DREV methyltransferase; InterPro: IPR007884 | 98.35 | |
| KOG1661 | 237 | consensus Protein-L-isoaspartate(D-aspartate) O-me | 98.35 | |
| PF12147 | 311 | Methyltransf_20: Putative methyltransferase; Inter | 98.31 | |
| PRK04338 | 382 | N(2),N(2)-dimethylguanosine tRNA methyltransferase | 98.29 | |
| PF09243 | 274 | Rsm22: Mitochondrial small ribosomal subunit Rsm22 | 98.26 | |
| COG1092 | 393 | Predicted SAM-dependent methyltransferases [Genera | 98.24 | |
| PF03602 | 183 | Cons_hypoth95: Conserved hypothetical protein 95; | 98.22 | |
| PF06080 | 204 | DUF938: Protein of unknown function (DUF938); Inte | 98.22 | |
| PF01739 | 196 | CheR: CheR methyltransferase, SAM binding domain; | 98.22 | |
| PF00398 | 262 | RrnaAD: Ribosomal RNA adenine dimethylase; InterPr | 98.22 | |
| COG2520 | 341 | Predicted methyltransferase [General function pred | 98.18 | |
| PF10672 | 286 | Methyltrans_SAM: S-adenosylmethionine-dependent me | 98.17 | |
| PF02527 | 184 | GidB: rRNA small subunit methyltransferase G; Inte | 98.16 | |
| KOG1269 | 364 | consensus SAM-dependent methyltransferases [Lipid | 98.16 | |
| PRK11783 | 702 | rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi | 98.15 | |
| COG0116 | 381 | Predicted N6-adenine-specific DNA methylase [DNA r | 98.13 | |
| PF05148 | 219 | Methyltransf_8: Hypothetical methyltransferase; In | 98.12 | |
| PF04816 | 205 | DUF633: Family of unknown function (DUF633) ; Inte | 98.11 | |
| TIGR01444 | 143 | fkbM_fam methyltransferase, FkbM family. Members o | 98.06 | |
| PF08123 | 205 | DOT1: Histone methylation protein DOT1 ; InterPro: | 98.06 | |
| KOG2899 | 288 | consensus Predicted methyltransferase [General fun | 98.05 | |
| KOG2187 | 534 | consensus tRNA uracil-5-methyltransferase and rela | 98.05 | |
| PLN02823 | 336 | spermine synthase | 98.03 | |
| PF02384 | 311 | N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 T | 98.0 | |
| PF07091 | 251 | FmrO: Ribosomal RNA methyltransferase (FmrO); PDB: | 97.99 | |
| KOG2352 | 482 | consensus Predicted spermine/spermidine synthase [ | 97.99 | |
| PRK10611 | 287 | chemotaxis methyltransferase CheR; Provisional | 97.97 | |
| KOG3045 | 325 | consensus Predicted RNA methylase involved in rRNA | 97.94 | |
| COG0357 | 215 | GidB Predicted S-adenosylmethionine-dependent meth | 97.94 | |
| COG4076 | 252 | Predicted RNA methylase [General function predicti | 97.94 | |
| PF03141 | 506 | Methyltransf_29: Putative S-adenosyl-L-methionine- | 97.93 | |
| COG1352 | 268 | CheR Methylase of chemotaxis methyl-accepting prot | 97.91 | |
| COG0742 | 187 | N6-adenine-specific methylase [DNA replication, re | 97.87 | |
| KOG2915 | 314 | consensus tRNA(1-methyladenosine) methyltransferas | 97.83 | |
| TIGR00006 | 305 | S-adenosyl-methyltransferase MraW. Genetics paper | 97.81 | |
| COG2384 | 226 | Predicted SAM-dependent methyltransferase [General | 97.81 | |
| PRK11933 | 470 | yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; | 97.78 | |
| TIGR00308 | 374 | TRM1 tRNA(guanine-26,N2-N2) methyltransferase. Thi | 97.72 | |
| COG0500 | 257 | SmtA SAM-dependent methyltransferases [Secondary m | 97.7 | |
| COG3897 | 218 | Predicted methyltransferase [General function pred | 97.7 | |
| PF05971 | 299 | Methyltransf_10: Protein of unknown function (DUF8 | 97.64 | |
| PRK11760 | 357 | putative 23S rRNA C2498 ribose 2'-O-ribose methylt | 97.62 | |
| COG0293 | 205 | FtsJ 23S rRNA methylase [Translation, ribosomal st | 97.62 | |
| KOG4058 | 199 | consensus Uncharacterized conserved protein [Funct | 97.58 | |
| PF11968 | 219 | DUF3321: Putative methyltransferase (DUF3321); Int | 97.58 | |
| KOG1663 | 237 | consensus O-methyltransferase [Secondary metabolit | 97.56 | |
| COG2521 | 287 | Predicted archaeal methyltransferase [General func | 97.55 | |
| PF01564 | 246 | Spermine_synth: Spermine/spermidine synthase; Inte | 97.52 | |
| COG0421 | 282 | SpeE Spermidine synthase [Amino acid transport and | 97.51 | |
| KOG2730 | 263 | consensus Methylase [General function prediction o | 97.49 | |
| TIGR03439 | 319 | methyl_EasF probable methyltransferase domain, Eas | 97.47 | |
| PRK00536 | 262 | speE spermidine synthase; Provisional | 97.46 | |
| KOG3178 | 342 | consensus Hydroxyindole-O-methyltransferase and re | 97.41 | |
| TIGR02987 | 524 | met_A_Alw26 type II restriction m6 adenine DNA met | 97.4 | |
| PF03059 | 276 | NAS: Nicotianamine synthase protein; InterPro: IPR | 97.31 | |
| PF01728 | 181 | FtsJ: FtsJ-like methyltransferase; InterPro: IPR00 | 97.22 | |
| KOG1501 | 636 | consensus Arginine N-methyltransferase [General fu | 97.19 | |
| COG0144 | 355 | Sun tRNA and rRNA cytosine-C5-methylases [Translat | 97.11 | |
| PF04672 | 267 | Methyltransf_19: S-adenosyl methyltransferase; Int | 96.94 | |
| COG4262 | 508 | Predicted spermidine synthase with an N-terminal m | 96.92 | |
| KOG3987 | 288 | consensus Uncharacterized conserved protein DREV/C | 96.84 | |
| PF01795 | 310 | Methyltransf_5: MraW methylase family; InterPro: I | 96.84 | |
| PRK10742 | 250 | putative methyltransferase; Provisional | 96.83 | |
| PHA01634 | 156 | hypothetical protein | 96.81 | |
| PF01189 | 283 | Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR | 96.81 | |
| PF07942 | 270 | N2227: N2227-like protein; InterPro: IPR012901 Thi | 96.78 | |
| KOG3115 | 249 | consensus Methyltransferase-like protein [General | 96.77 | |
| COG0275 | 314 | Predicted S-adenosylmethionine-dependent methyltra | 96.76 | |
| PF01269 | 229 | Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibr | 96.75 | |
| PF01234 | 256 | NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: I | 96.7 | |
| PLN02668 | 386 | indole-3-acetate carboxyl methyltransferase | 96.66 | |
| PF03492 | 334 | Methyltransf_7: SAM dependent carboxyl methyltrans | 96.64 | |
| COG3129 | 292 | Predicted SAM-dependent methyltransferase [General | 96.54 | |
| COG1189 | 245 | Predicted rRNA methylase [Translation, ribosomal s | 96.45 | |
| PF02636 | 252 | Methyltransf_28: Putative S-adenosyl-L-methionine- | 96.33 | |
| KOG0822 | 649 | consensus Protein kinase inhibitor [Cell cycle con | 96.24 | |
| KOG2651 | 476 | consensus rRNA adenine N-6-methyltransferase [RNA | 96.1 | |
| COG1565 | 370 | Uncharacterized conserved protein [Function unknow | 96.07 | |
| PF13578 | 106 | Methyltransf_24: Methyltransferase domain; PDB: 3S | 95.96 | |
| KOG2671 | 421 | consensus Putative RNA methylase [Replication, rec | 95.84 | |
| PTZ00357 | 1072 | methyltransferase; Provisional | 95.8 | |
| PF01861 | 243 | DUF43: Protein of unknown function DUF43; InterPro | 95.66 | |
| KOG1709 | 271 | consensus Guanidinoacetate methyltransferase and r | 95.66 | |
| PF07757 | 112 | AdoMet_MTase: Predicted AdoMet-dependent methyltra | 95.59 | |
| cd00315 | 275 | Cyt_C5_DNA_methylase Cytosine-C5 specific DNA meth | 95.47 | |
| PRK11524 | 284 | putative methyltransferase; Provisional | 95.44 | |
| KOG4589 | 232 | consensus Cell division protein FtsJ [Cell cycle c | 95.39 | |
| PF01555 | 231 | N6_N4_Mtase: DNA methylase; InterPro: IPR002941 Th | 95.37 | |
| PRK13699 | 227 | putative methylase; Provisional | 95.31 | |
| COG1889 | 231 | NOP1 Fibrillarin-like rRNA methylase [Translation, | 95.24 | |
| KOG1122 | 460 | consensus tRNA and rRNA cytosine-C5-methylase (nuc | 95.17 | |
| PF02005 | 377 | TRM: N2,N2-dimethylguanosine tRNA methyltransferas | 95.05 | |
| PF04445 | 234 | SAM_MT: Putative SAM-dependent methyltransferase; | 95.04 | |
| PF06962 | 140 | rRNA_methylase: Putative rRNA methylase; InterPro: | 94.87 | |
| COG0286 | 489 | HsdM Type I restriction-modification system methyl | 94.48 | |
| KOG2793 | 248 | consensus Putative N2,N2-dimethylguanosine tRNA me | 94.39 | |
| PF11599 | 246 | AviRa: RRNA methyltransferase AviRa; InterPro: IPR | 93.92 | |
| PF04989 | 206 | CmcI: Cephalosporin hydroxylase; InterPro: IPR0070 | 93.75 | |
| KOG1227 | 351 | consensus Putative methyltransferase [General func | 92.63 | |
| COG1064 | 339 | AdhP Zn-dependent alcohol dehydrogenases [General | 92.0 | |
| KOG2920 | 282 | consensus Predicted methyltransferase [General fun | 91.85 | |
| KOG3924 | 419 | consensus Putative protein methyltransferase invol | 91.7 | |
| KOG3201 | 201 | consensus Uncharacterized conserved protein [Funct | 91.64 | |
| COG1867 | 380 | TRM1 N2,N2-dimethylguanosine tRNA methyltransferas | 91.53 | |
| PF00145 | 335 | DNA_methylase: C-5 cytosine-specific DNA methylase | 90.24 | |
| KOG2539 | 491 | consensus Mitochondrial/chloroplast ribosome small | 89.78 | |
| KOG1562 | 337 | consensus Spermidine synthase [Amino acid transpor | 88.77 | |
| KOG1596 | 317 | consensus Fibrillarin and related nucleolar RNA-bi | 88.4 | |
| PF02254 | 116 | TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg | 88.34 | |
| TIGR00675 | 315 | dcm DNA-methyltransferase (dcm). All proteins in t | 87.91 | |
| PF05206 | 259 | TRM13: Methyltransferase TRM13; InterPro: IPR00787 | 87.89 | |
| COG3510 | 237 | CmcI Cephalosporin hydroxylase [Defense mechanisms | 87.38 | |
| KOG2078 | 495 | consensus tRNA modification enzyme [RNA processing | 87.27 | |
| COG5459 | 484 | Predicted rRNA methylase [Translation, ribosomal s | 86.62 | |
| PF03514 | 374 | GRAS: GRAS domain family; InterPro: IPR005202 Sequ | 86.29 | |
| KOG1098 | 780 | consensus Putative SAM-dependent rRNA methyltransf | 85.66 | |
| PF05050 | 167 | Methyltransf_21: Methyltransferase FkbM domain; In | 85.1 | |
| PF03141 | 506 | Methyltransf_29: Putative S-adenosyl-L-methionine- | 83.75 | |
| PF11899 | 380 | DUF3419: Protein of unknown function (DUF3419); In | 83.06 | |
| PF04072 | 183 | LCM: Leucine carboxyl methyltransferase; InterPro: | 82.35 | |
| PRK07904 | 253 | short chain dehydrogenase; Provisional | 81.95 | |
| COG1568 | 354 | Predicted methyltransferases [General function pre | 81.84 | |
| COG0270 | 328 | Dcm Site-specific DNA methylase [DNA replication, | 81.71 | |
| TIGR00497 | 501 | hsdM type I restriction system adenine methylase ( | 81.69 | |
| COG1086 | 588 | Predicted nucleoside-diphosphate sugar epimerases | 81.43 | |
| KOG2912 | 419 | consensus Predicted DNA methylase [Function unknow | 80.56 | |
| PF03686 | 127 | UPF0146: Uncharacterised protein family (UPF0146); | 80.42 |
| >COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
Probab=99.86 E-value=4.9e-21 Score=151.35 Aligned_cols=104 Identities=28% Similarity=0.364 Sum_probs=93.0
Q ss_pred HHHHHHHHHHhc-CCCCeEEEECCCCCcchHHhhh-CCCCeEEEEcCCHHHHHHHHHHHHHcCCCCCCeEEEeccccccC
Q 027860 112 AGYKSQLFDNLR-GKAKKVLEIGIGTGPNLKYYAA-DTDVQVLGVDPNRKMEKYAQTAAVAAGLPLTNFKFLQAVGEAIP 189 (217)
Q Consensus 112 ~~~~~~~~~~l~-~~~~~VLDiGcG~G~~~~~la~-~~~~~v~giD~S~~~l~~a~~~~~~~~~~~~~i~~~~~d~~~lp 189 (217)
..|++.+...+. .++.+|||||||||..+..+++ .+..+++|+|+|+.||+.|++++.+.++. +++|+++|+++||
T Consensus 37 ~~Wr~~~i~~~~~~~g~~vLDva~GTGd~a~~~~k~~g~g~v~~~D~s~~ML~~a~~k~~~~~~~--~i~fv~~dAe~LP 114 (238)
T COG2226 37 RLWRRALISLLGIKPGDKVLDVACGTGDMALLLAKSVGTGEVVGLDISESMLEVAREKLKKKGVQ--NVEFVVGDAENLP 114 (238)
T ss_pred HHHHHHHHHhhCCCCCCEEEEecCCccHHHHHHHHhcCCceEEEEECCHHHHHHHHHHhhccCcc--ceEEEEechhhCC
Confidence 346666676665 5789999999999999999987 34679999999999999999999988874 4999999999999
Q ss_pred CCCCcccEEEeccccccccChhhhccCC
Q 027860 190 VSDASVDAVVGTLVLCSVKDVDMTLQGK 217 (217)
Q Consensus 190 ~~~~sfD~Vi~~~~l~~~~d~~~~L~e~ 217 (217)
|+|++||+|++.++|++++|++.+|+|+
T Consensus 115 f~D~sFD~vt~~fglrnv~d~~~aL~E~ 142 (238)
T COG2226 115 FPDNSFDAVTISFGLRNVTDIDKALKEM 142 (238)
T ss_pred CCCCccCEEEeeehhhcCCCHHHHHHHH
Confidence 9999999999999999999999999984
|
|
| >PRK11088 rrmA 23S rRNA methyltransferase A; Provisional | Back alignment and domain information |
|---|
| >PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] | Back alignment and domain information |
|---|
| >KOG4300 consensus Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02244 tocopherol O-methyltransferase | Back alignment and domain information |
|---|
| >PLN02396 hexaprenyldihydroxybenzoate methyltransferase | Back alignment and domain information |
|---|
| >PLN02233 ubiquinone biosynthesis methyltransferase | Back alignment and domain information |
|---|
| >PRK05785 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase | Back alignment and domain information |
|---|
| >KOG1540 consensus Ubiquinone biosynthesis methyltransferase COQ5 [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A | Back alignment and domain information |
|---|
| >PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >PRK10258 biotin biosynthesis protein BioC; Provisional | Back alignment and domain information |
|---|
| >PRK14103 trans-aconitate 2-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase | Back alignment and domain information |
|---|
| >PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A | Back alignment and domain information |
|---|
| >PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK01683 trans-aconitate 2-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK11207 tellurite resistance protein TehB; Provisional | Back alignment and domain information |
|---|
| >PRK15068 tRNA mo(5)U34 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins | Back alignment and domain information |
|---|
| >PRK06202 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00098 phosphoethanolamine N-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >KOG1270 consensus Methyltransferases [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A | Back alignment and domain information |
|---|
| >PLN02336 phosphoethanolamine N-methyltransferase | Back alignment and domain information |
|---|
| >TIGR00740 methyltransferase, putative | Back alignment and domain information |
|---|
| >PLN02490 MPBQ/MSBQ methyltransferase | Back alignment and domain information |
|---|
| >TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase | Back alignment and domain information |
|---|
| >PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) | Back alignment and domain information |
|---|
| >TIGR02081 metW methionine biosynthesis protein MetW | Back alignment and domain information |
|---|
| >PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00452 methyltransferase, putative | Back alignment and domain information |
|---|
| >PRK08317 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00477 tehB tellurite resistance protein TehB | Back alignment and domain information |
|---|
| >TIGR02072 BioC biotin biosynthesis protein BioC | Back alignment and domain information |
|---|
| >PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >PRK07580 Mg-protoporphyrin IX methyl transferase; Validated | Back alignment and domain information |
|---|
| >PRK12335 tellurite resistance protein TehB; Provisional | Back alignment and domain information |
|---|
| >COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes | Back alignment and domain information |
|---|
| >PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB | Back alignment and domain information |
|---|
| >PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed | Back alignment and domain information |
|---|
| >TIGR00138 gidB 16S rRNA methyltransferase GidB | Back alignment and domain information |
|---|
| >PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins | Back alignment and domain information |
|---|
| >PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C | Back alignment and domain information |
|---|
| >PLN02585 magnesium protoporphyrin IX methyltransferase | Back alignment and domain information |
|---|
| >PRK06922 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases | Back alignment and domain information |
|---|
| >PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase | Back alignment and domain information |
|---|
| >PLN03075 nicotianamine synthase; Provisional | Back alignment and domain information |
|---|
| >PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional | Back alignment and domain information |
|---|
| >PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >KOG1271 consensus Methyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit | Back alignment and domain information |
|---|
| >KOG1541 consensus Predicted protein carboxyl methylase [General function prediction only] | Back alignment and domain information |
|---|
| >smart00138 MeTrc Methyltransferase, chemotaxis proteins | Back alignment and domain information |
|---|
| >PLN02336 phosphoethanolamine N-methyltransferase | Back alignment and domain information |
|---|
| >TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase | Back alignment and domain information |
|---|
| >PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional | Back alignment and domain information |
|---|
| >TIGR00091 tRNA (guanine-N(7)-)-methyltransferase | Back alignment and domain information |
|---|
| >TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family | Back alignment and domain information |
|---|
| >smart00650 rADc Ribosomal RNA adenine dimethylases | Back alignment and domain information |
|---|
| >PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated | Back alignment and domain information |
|---|
| >PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases | Back alignment and domain information |
|---|
| >KOG1499 consensus Protein arginine N-methyltransferase PRMT1 and related enzymes [Posttranslational modification, protein turnover, chaperones; Transcription; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 | Back alignment and domain information |
|---|
| >PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A | Back alignment and domain information |
|---|
| >PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific | Back alignment and domain information |
|---|
| >PRK13255 thiopurine S-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00537 hemK_rel_arch HemK-related putative methylase | Back alignment and domain information |
|---|
| >PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG4123 Predicted O-methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00406 prmA ribosomal protein L11 methyltransferase | Back alignment and domain information |
|---|
| >TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU | Back alignment and domain information |
|---|
| >COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific | Back alignment and domain information |
|---|
| >COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional | Back alignment and domain information |
|---|
| >PRK14967 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00536 hemK_fam HemK family putative methylases | Back alignment and domain information |
|---|
| >PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01177 conserved hypothetical protein TIGR01177 | Back alignment and domain information |
|---|
| >PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] | Back alignment and domain information |
|---|
| >COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional | Back alignment and domain information |
|---|
| >PRK14968 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional | Back alignment and domain information |
|---|
| >PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences | Back alignment and domain information |
|---|
| >COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PHA03411 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07402 precorrin-6B methylase; Provisional | Back alignment and domain information |
|---|
| >KOG3010 consensus Methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR03438 probable methyltransferase | Back alignment and domain information |
|---|
| >PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) | Back alignment and domain information |
|---|
| >PRK13256 thiopurine S-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PTZ00338 dimethyladenosine transferase-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG2940 consensus Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PHA03412 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF05185 PRMT5: PRMT5 arginine-N-methyltransferase; InterPro: IPR007857 The human homologue of Saccharomyces cerevisiae Skb1 (Shk1 kinase-binding protein 1) is a protein methyltransferase [] | Back alignment and domain information |
|---|
| >COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG1500 consensus Protein arginine N-methyltransferase CARM1 [Posttranslational modification, protein turnover, chaperones; Transcription] | Back alignment and domain information |
|---|
| >PLN02781 Probable caffeoyl-CoA O-methyltransferase | Back alignment and domain information |
|---|
| >PLN02232 ubiquinone biosynthesis methyltransferase | Back alignment and domain information |
|---|
| >PRK04266 fibrillarin; Provisional | Back alignment and domain information |
|---|
| >TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA | Back alignment and domain information |
|---|
| >PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2 | Back alignment and domain information |
|---|
| >PRK11727 23S rRNA mA1618 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG3420 consensus Predicted RNA methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK14904 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific | Back alignment and domain information |
|---|
| >TIGR00755 ksgA dimethyladenosine transferase | Back alignment and domain information |
|---|
| >TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB | Back alignment and domain information |
|---|
| >PRK14901 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >PRK14903 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase | Back alignment and domain information |
|---|
| >PRK04457 spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK10901 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases | Back alignment and domain information |
|---|
| >PF03291 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 This is a family of viral mRNA capping enzymes | Back alignment and domain information |
|---|
| >PRK14902 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >PF05724 TPMT: Thiopurine S-methyltransferase (TPMT); InterPro: IPR008854 This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes | Back alignment and domain information |
|---|
| >PLN02476 O-methyltransferase | Back alignment and domain information |
|---|
| >PF01170 UPF0020: Putative RNA methylase family UPF0020; InterPro: IPR000241 This domain is probably a methylase | Back alignment and domain information |
|---|
| >TIGR00478 tly hemolysin TlyA family protein | Back alignment and domain information |
|---|
| >PRK00811 spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >PTZ00146 fibrillarin; Provisional | Back alignment and domain information |
|---|
| >PRK04148 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN02672 methionine S-methyltransferase | Back alignment and domain information |
|---|
| >TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB | Back alignment and domain information |
|---|
| >TIGR00438 rrmJ cell division protein FtsJ | Back alignment and domain information |
|---|
| >TIGR00095 RNA methyltransferase, RsmD family | Back alignment and domain information |
|---|
| >KOG2904 consensus Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG4122 Predicted O-methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2361 consensus Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >PRK00050 16S rRNA m(4)C1402 methyltranserfase; Provisional | Back alignment and domain information |
|---|
| >PF02475 Met_10: Met-10+ like-protein; InterPro: IPR003402 This entry represents the Trm5 family | Back alignment and domain information |
|---|
| >TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase | Back alignment and domain information |
|---|
| >PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [] | Back alignment and domain information |
|---|
| >PLN02366 spermidine synthase | Back alignment and domain information |
|---|
| >PRK05031 tRNA (uracil-5-)-methyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK03612 spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >KOG1975 consensus mRNA cap methyltransferase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PLN02589 caffeoyl-CoA O-methyltransferase | Back alignment and domain information |
|---|
| >PF05891 Methyltransf_PK: AdoMet dependent proline di-methyltransferase; InterPro: IPR008576 This family consists of several eukaryotic proteins of unknown function that are S-adenosyl-L-methionine-dependent methyltransferase-like | Back alignment and domain information |
|---|
| >COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF10294 Methyltransf_16: Putative methyltransferase; InterPro: IPR019410 There are a number of unidentified genes that have a high probability of coding for methyltransferases | Back alignment and domain information |
|---|
| >COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK01581 speE spermidine synthase; Validated | Back alignment and domain information |
|---|
| >KOG3191 consensus Predicted N6-DNA-methyltransferase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF05958 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferase; InterPro: IPR010280 This family consists of (uracil-5-)-methyltransferases 2 | Back alignment and domain information |
|---|
| >COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG1331 consensus Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF13679 Methyltransf_32: Methyltransferase domain | Back alignment and domain information |
|---|
| >COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG0820 consensus Ribosomal RNA adenine dimethylase [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR00417 speE spermidine synthase | Back alignment and domain information |
|---|
| >PF09445 Methyltransf_15: RNA cap guanine-N2 methyltransferase; InterPro: IPR019012 RNA cap guanine-N2 methyltransferases such as Schizosaccharomyces pombe (Fission yeast) trimethylguanosine synthase (Tgs1) and Giardia lamblia (Giardia intestinalis) Tgs2, catalyse the methylation step(s) for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure [, , ] | Back alignment and domain information |
|---|
| >COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >COG3963 Phospholipid N-methyltransferase [Lipid metabolism] | Back alignment and domain information |
|---|
| >PF05219 DREV: DREV methyltransferase; InterPro: IPR007884 This family contains DREV protein homologues from several eukaryotes | Back alignment and domain information |
|---|
| >KOG1661 consensus Protein-L-isoaspartate(D-aspartate) O-methyltransferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12147 Methyltransf_20: Putative methyltransferase; InterPro: IPR022744 This C-terminal region is found in bacteria and eukaryotes and is approximately 110 amino acids in length | Back alignment and domain information |
|---|
| >PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF09243 Rsm22: Mitochondrial small ribosomal subunit Rsm22; InterPro: IPR015324 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms | Back alignment and domain information |
|---|
| >COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >PF03602 Cons_hypoth95: Conserved hypothetical protein 95; InterPro: IPR004398 This entry contains Ribosomal RNA small subunit methyltransferase D as well as the putative rRNA methyltransferase YlbH | Back alignment and domain information |
|---|
| >PF06080 DUF938: Protein of unknown function (DUF938); InterPro: IPR010342 This family consists of several hypothetical proteins from both prokaryotes and eukaryotes | Back alignment and domain information |
|---|
| >PF01739 CheR: CheR methyltransferase, SAM binding domain; InterPro: IPR022642 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >PF00398 RrnaAD: Ribosomal RNA adenine dimethylase; InterPro: IPR001737 This family of proteins include rRNA adenine dimethylases (e | Back alignment and domain information |
|---|
| >COG2520 Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF10672 Methyltrans_SAM: S-adenosylmethionine-dependent methyltransferase; InterPro: IPR019614 Members of this entry are S-adenosylmethionine-dependent methyltransferases from gamma-proteobacterial species | Back alignment and domain information |
|---|
| >PF02527 GidB: rRNA small subunit methyltransferase G; InterPro: IPR003682 This entry represents a rRNA small subunit methyltransferase G | Back alignment and domain information |
|---|
| >KOG1269 consensus SAM-dependent methyltransferases [Lipid transport and metabolism; General function prediction only] | Back alignment and domain information |
|---|
| >PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG0116 Predicted N6-adenine-specific DNA methylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF05148 Methyltransf_8: Hypothetical methyltransferase; InterPro: IPR007823 This family consists of uncharacterised eukaryotic proteins which are related to S-adenosyl-L-methionine-dependent methyltransferases | Back alignment and domain information |
|---|
| >PF04816 DUF633: Family of unknown function (DUF633) ; InterPro: IPR006901 This is a family of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >TIGR01444 fkbM_fam methyltransferase, FkbM family | Back alignment and domain information |
|---|
| >PF08123 DOT1: Histone methylation protein DOT1 ; InterPro: IPR013110 The DOT1 domain regulates gene expression by methylating histone H3 [] | Back alignment and domain information |
|---|
| >KOG2899 consensus Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2187 consensus tRNA uracil-5-methyltransferase and related tRNA-modifying enzymes [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PLN02823 spermine synthase | Back alignment and domain information |
|---|
| >PF02384 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 This domain is fpound in N-6 adenine-specific DNA methylase (2 | Back alignment and domain information |
|---|
| >PF07091 FmrO: Ribosomal RNA methyltransferase (FmrO); PDB: 3LCU_A 3LCV_B 3FRH_A 3FRI_A 3B89_A 3FZG_A | Back alignment and domain information |
|---|
| >KOG2352 consensus Predicted spermine/spermidine synthase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10611 chemotaxis methyltransferase CheR; Provisional | Back alignment and domain information |
|---|
| >KOG3045 consensus Predicted RNA methylase involved in rRNA processing [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG0357 GidB Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >COG4076 Predicted RNA methylase [General function prediction only] | Back alignment and domain information |
|---|
| >PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases | Back alignment and domain information |
|---|
| >COG1352 CheR Methylase of chemotaxis methyl-accepting proteins [Cell motility and secretion / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG2915 consensus tRNA(1-methyladenosine) methyltransferase, subunit GCD14 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR00006 S-adenosyl-methyltransferase MraW | Back alignment and domain information |
|---|
| >COG2384 Predicted SAM-dependent methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed | Back alignment and domain information |
|---|
| >TIGR00308 TRM1 tRNA(guanine-26,N2-N2) methyltransferase | Back alignment and domain information |
|---|
| >COG0500 SmtA SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] | Back alignment and domain information |
|---|
| >COG3897 Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF05971 Methyltransf_10: Protein of unknown function (DUF890); InterPro: IPR010286 This family consists of several conserved hypothetical proteins from both eukaryotes and prokaryotes | Back alignment and domain information |
|---|
| >PRK11760 putative 23S rRNA C2498 ribose 2'-O-ribose methyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG0293 FtsJ 23S rRNA methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG4058 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF11968 DUF3321: Putative methyltransferase (DUF3321); InterPro: IPR021867 This family is conserved in fungi and is annotated as being a nucleolar protein | Back alignment and domain information |
|---|
| >KOG1663 consensus O-methyltransferase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >COG2521 Predicted archaeal methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2 | Back alignment and domain information |
|---|
| >COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2730 consensus Methylase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03439 methyl_EasF probable methyltransferase domain, EasF family | Back alignment and domain information |
|---|
| >PRK00536 speE spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >KOG3178 consensus Hydroxyindole-O-methyltransferase and related SAM-dependent methyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02987 met_A_Alw26 type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family | Back alignment and domain information |
|---|
| >PF03059 NAS: Nicotianamine synthase protein; InterPro: IPR004298 Nicotianamine synthase 2 | Back alignment and domain information |
|---|
| >PF01728 FtsJ: FtsJ-like methyltransferase; InterPro: IPR002877 RrmJ (FtsJ) is a well conserved heat shock protein present in prokaryotes, archaea, and eukaryotes | Back alignment and domain information |
|---|
| >KOG1501 consensus Arginine N-methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF04672 Methyltransf_19: S-adenosyl methyltransferase; InterPro: IPR006764 This is a family of uncharacterised proteins | Back alignment and domain information |
|---|
| >COG4262 Predicted spermidine synthase with an N-terminal membrane domain [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3987 consensus Uncharacterized conserved protein DREV/CGI-81 [Function unknown] | Back alignment and domain information |
|---|
| >PF01795 Methyltransf_5: MraW methylase family; InterPro: IPR002903 This is a family of S-adenosyl-L-methionine-dependent methyltransferases, which are found primarily, though not exclusively, in bacteria | Back alignment and domain information |
|---|
| >PRK10742 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PHA01634 hypothetical protein | Back alignment and domain information |
|---|
| >PF01189 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR001678 This domain is found in archaeal, bacterial and eukaryotic proteins | Back alignment and domain information |
|---|
| >PF07942 N2227: N2227-like protein; InterPro: IPR012901 This family features sequences that are similar to a region of hypothetical yeast gene product N2227 (P53934 from SWISSPROT) | Back alignment and domain information |
|---|
| >KOG3115 consensus Methyltransferase-like protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG0275 Predicted S-adenosylmethionine-dependent methyltransferase involved in cell envelope biogenesis [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PF01269 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibrillarin is a component of a nucleolar small nuclear ribonucleoprotein (SnRNP), functioning in vivo in ribosomal RNA processing [, ] | Back alignment and domain information |
|---|
| >PF01234 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: IPR000940 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >PLN02668 indole-3-acetate carboxyl methyltransferase | Back alignment and domain information |
|---|
| >PF03492 Methyltransf_7: SAM dependent carboxyl methyltransferase; InterPro: IPR005299 This family of plant methyltransferases contains enzymes that act on a variety of substrates including salicylic acid, jasmonic acid and 7-Methylxanthine | Back alignment and domain information |
|---|
| >COG3129 Predicted SAM-dependent methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG1189 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF02636 Methyltransf_28: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR003788 This entry describes proteins of unknown function | Back alignment and domain information |
|---|
| >KOG0822 consensus Protein kinase inhibitor [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG2651 consensus rRNA adenine N-6-methyltransferase [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG1565 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13578 Methyltransf_24: Methyltransferase domain; PDB: 3SSO_A 3SSN_C 3SSM_D | Back alignment and domain information |
|---|
| >KOG2671 consensus Putative RNA methylase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PTZ00357 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF01861 DUF43: Protein of unknown function DUF43; InterPro: IPR002723 This family of prokaryotic proteins have not been characterised | Back alignment and domain information |
|---|
| >KOG1709 consensus Guanidinoacetate methyltransferase and related proteins [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF07757 AdoMet_MTase: Predicted AdoMet-dependent methyltransferase; InterPro: IPR011671 tRNA (uracil-O(2)-)-methyltransferase catalyses the formation of O(2)-methyl-uracil at position 44 (m2U44) in tRNA(Ser) [] | Back alignment and domain information |
|---|
| >cd00315 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA methylases; Methyl transfer reactions play an important role in many aspects of biology | Back alignment and domain information |
|---|
| >PRK11524 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG4589 consensus Cell division protein FtsJ [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF01555 N6_N4_Mtase: DNA methylase; InterPro: IPR002941 This domain is found in DNA methylases | Back alignment and domain information |
|---|
| >PRK13699 putative methylase; Provisional | Back alignment and domain information |
|---|
| >COG1889 NOP1 Fibrillarin-like rRNA methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG1122 consensus tRNA and rRNA cytosine-C5-methylase (nucleolar protein NOL1/NOP2) [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF02005 TRM: N2,N2-dimethylguanosine tRNA methyltransferase; InterPro: IPR002905 This enzyme 2 | Back alignment and domain information |
|---|
| >PF04445 SAM_MT: Putative SAM-dependent methyltransferase; InterPro: IPR007536 This family of proteins is functionally uncharacterised | Back alignment and domain information |
|---|
| >PF06962 rRNA_methylase: Putative rRNA methylase; InterPro: IPR010719 This family contains a number of putative rRNA methylases | Back alignment and domain information |
|---|
| >COG0286 HsdM Type I restriction-modification system methyltransferase subunit [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG2793 consensus Putative N2,N2-dimethylguanosine tRNA methyltransferase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF11599 AviRa: RRNA methyltransferase AviRa; InterPro: IPR024268 This family of proteins includes the methyltransferase AviRa from Streptomyces viridochromogenes | Back alignment and domain information |
|---|
| >PF04989 CmcI: Cephalosporin hydroxylase; InterPro: IPR007072 This entry contains Rhamnosyl O-methyltransferase which catalyses the O-methylation of the hydroxyl group located on C-2 of the first rhamnosyl residue linked to the phenolic group of glycosylated phenolphthiocerol dimycocerosates (PGL) and p-hydroxybenzoic acid derivatives (p-HBAD) [] | Back alignment and domain information |
|---|
| >KOG1227 consensus Putative methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2920 consensus Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3924 consensus Putative protein methyltransferase involved in meiosis and transcriptional silencing (Dot1) [Cell cycle control, cell division, chromosome partitioning; Transcription] | Back alignment and domain information |
|---|
| >KOG3201 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG1867 TRM1 N2,N2-dimethylguanosine tRNA methyltransferase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF00145 DNA_methylase: C-5 cytosine-specific DNA methylase; InterPro: IPR001525 C-5 cytosine-specific DNA methylases (2 | Back alignment and domain information |
|---|
| >KOG2539 consensus Mitochondrial/chloroplast ribosome small subunit component [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG1562 consensus Spermidine synthase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1596 consensus Fibrillarin and related nucleolar RNA-binding proteins [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus | Back alignment and domain information |
|---|
| >TIGR00675 dcm DNA-methyltransferase (dcm) | Back alignment and domain information |
|---|
| >PF05206 TRM13: Methyltransferase TRM13; InterPro: IPR007871 This entry consists of eukaryotic and bacterial proteins that specifically methylates guanosine-4 in various tRNAs with a Gly(CCG), His or Pro signatures [] | Back alignment and domain information |
|---|
| >COG3510 CmcI Cephalosporin hydroxylase [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG2078 consensus tRNA modification enzyme [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG5459 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF03514 GRAS: GRAS domain family; InterPro: IPR005202 Sequence analysis of the products of the GRAS (GAI, RGA, SCR) gene family indicates that they share a variable N terminus and a highly conserved C terminus that contains five recognizable motifs [] | Back alignment and domain information |
|---|
| >KOG1098 consensus Putative SAM-dependent rRNA methyltransferase SPB1 [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >PF05050 Methyltransf_21: Methyltransferase FkbM domain; InterPro: IPR007744 This entry contains proteins of unknown function | Back alignment and domain information |
|---|
| >PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases | Back alignment and domain information |
|---|
| >PF11899 DUF3419: Protein of unknown function (DUF3419); InterPro: IPR021829 This family of proteins are functionally uncharacterised | Back alignment and domain information |
|---|
| >PF04072 LCM: Leucine carboxyl methyltransferase; InterPro: IPR007213 This entry represents a group of leucine carboxymethyltransferases which methylate the carboxyl group of leucine residues to form alpha-leucine ester residues | Back alignment and domain information |
|---|
| >PRK07904 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG1568 Predicted methyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >COG0270 Dcm Site-specific DNA methylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR00497 hsdM type I restriction system adenine methylase (hsdM) | Back alignment and domain information |
|---|
| >COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2912 consensus Predicted DNA methylase [Function unknown] | Back alignment and domain information |
|---|
| >PF03686 UPF0146: Uncharacterised protein family (UPF0146); InterPro: IPR005353 The function of this family of proteins is unknown | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 217 | |||
| 3bkw_A | 243 | MLL3908 protein, S-adenosylmethionine dependent me | 5e-15 | |
| 2p8j_A | 209 | S-adenosylmethionine-dependent methyltransferase; | 9e-15 | |
| 1ve3_A | 227 | Hypothetical protein PH0226; dimer, riken structur | 2e-14 | |
| 2yqz_A | 263 | Hypothetical protein TTHA0223; RNA methyltransfera | 2e-14 | |
| 1vlm_A | 219 | SAM-dependent methyltransferase; possible histamin | 6e-14 | |
| 3dlc_A | 219 | Putative S-adenosyl-L-methionine-dependent methylt | 1e-13 | |
| 2gs9_A | 211 | Hypothetical protein TT1324; methyl transferase, s | 3e-13 | |
| 3hnr_A | 220 | Probable methyltransferase BT9727_4108; structural | 3e-13 | |
| 1wzn_A | 252 | SAM-dependent methyltransferase; structural genomi | 1e-12 | |
| 3g5l_A | 253 | Putative S-adenosylmethionine dependent methyltran | 2e-12 | |
| 3ege_A | 261 | Putative methyltransferase from antibiotic biosyn | 2e-12 | |
| 3mgg_A | 276 | Methyltransferase; NYSGXRC, PSI-II, protein struct | 2e-12 | |
| 1xxl_A | 239 | YCGJ protein; structural genomics, protein structu | 3e-12 | |
| 3i9f_A | 170 | Putative type 11 methyltransferase; structural gen | 4e-12 | |
| 3dh0_A | 219 | SAM dependent methyltransferase; cystal structure, | 9e-12 | |
| 3l8d_A | 242 | Methyltransferase; structural genomics, PSI, nysgr | 1e-11 | |
| 3g5t_A | 299 | Trans-aconitate 3-methyltransferase; structural ge | 2e-10 | |
| 3cgg_A | 195 | SAM-dependent methyltransferase; NP_600671.1, meth | 2e-10 | |
| 2o57_A | 297 | Putative sarcosine dimethylglycine methyltransfera | 3e-10 | |
| 2avn_A | 260 | Ubiquinone/menaquinone biosynthesis methyltransfe | 3e-10 | |
| 3g2m_A | 299 | PCZA361.24; SAM-dependent methyltransferase, glyco | 5e-10 | |
| 3f4k_A | 257 | Putative methyltransferase; structural genomics, P | 7e-10 | |
| 3bxo_A | 239 | N,N-dimethyltransferase; desosamine, sugar, carboh | 1e-09 | |
| 3gu3_A | 284 | Methyltransferase; alpha-beta protein, structural | 1e-09 | |
| 1vl5_A | 260 | Unknown conserved protein BH2331; putative methylt | 1e-09 | |
| 3kkz_A | 267 | Uncharacterized protein Q5LES9; putative methyltra | 2e-09 | |
| 3pfg_A | 263 | N-methyltransferase; N,N-dimethyltransferase, SAM | 4e-09 | |
| 3bus_A | 273 | REBM, methyltransferase; rebeccamycin synthesis; H | 4e-09 | |
| 3d2l_A | 243 | SAM-dependent methyltransferase; ZP_00538691.1, st | 1e-08 | |
| 3ocj_A | 305 | Putative exported protein; structural genomics, PS | 3e-08 | |
| 3ujc_A | 266 | Phosphoethanolamine N-methyltransferase; parasite; | 5e-08 | |
| 2aot_A | 292 | HMT, histamine N-methyltransferase; classic methyl | 5e-08 | |
| 1y8c_A | 246 | S-adenosylmethionine-dependent methyltransferase; | 5e-08 | |
| 3cc8_A | 230 | Putative methyltransferase; structural genomics, j | 7e-08 | |
| 3jwg_A | 219 | HEN1, methyltransferase type 12; 1.90A {Clostridiu | 1e-07 | |
| 3thr_A | 293 | Glycine N-methyltransferase; GNMT, folate, methylt | 1e-07 | |
| 3e8s_A | 227 | Putative SAM dependent methyltransferase; NP_74470 | 1e-07 | |
| 1nkv_A | 256 | Hypothetical protein YJHP; structural genomics, PS | 1e-07 | |
| 3sm3_A | 235 | SAM-dependent methyltransferases; NESG, structural | 1e-07 | |
| 1xtp_A | 254 | LMAJ004091AAA; SGPP, structural genomics, PSI, pro | 4e-07 | |
| 4fsd_A | 383 | Arsenic methyltransferase; rossmann fold; 1.75A {C | 6e-07 | |
| 3ou2_A | 218 | SAM-dependent methyltransferase; O-methyltransfera | 6e-07 | |
| 3h2b_A | 203 | SAM-dependent methyltransferase; alpha-beta protei | 9e-07 | |
| 3bkx_A | 275 | SAM-dependent methyltransferase; YP_807781.1, cycl | 9e-07 | |
| 3jwh_A | 217 | HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena | 1e-06 | |
| 3vc1_A | 312 | Geranyl diphosphate 2-C-methyltransferase; rossman | 2e-06 | |
| 3ggd_A | 245 | SAM-dependent methyltransferase; YP_325210.1, stru | 2e-06 | |
| 2ex4_A | 241 | Adrenal gland protein AD-003; methyltransferase, s | 3e-06 | |
| 3dli_A | 240 | Methyltransferase; PSI-II, NYSGXRC, structural gen | 4e-06 | |
| 2pxx_A | 215 | Uncharacterized protein MGC2408; structural genomi | 5e-06 | |
| 3p2e_A | 225 | 16S rRNA methylase; methyltransferase, transferase | 7e-06 | |
| 1ri5_A | 298 | MRNA capping enzyme; methyltransferase, M7G, messe | 9e-06 | |
| 2xvm_A | 199 | Tellurite resistance protein TEHB; antibiotic resi | 1e-05 | |
| 3dtn_A | 234 | Putative methyltransferase MM_2633; structural gen | 1e-05 | |
| 1p91_A | 269 | Ribosomal RNA large subunit methyltransferase A; R | 2e-05 | |
| 3mq2_A | 218 | 16S rRNA methyltransferase; methyltranferase, ribo | 3e-05 | |
| 3fpf_A | 298 | Mtnas, putative uncharacterized protein; thermonic | 4e-05 | |
| 1yzh_A | 214 | TRNA (guanine-N(7)-)-methyltransferase; alpha-beta | 1e-04 | |
| 3htx_A | 950 | HEN1; HEN1, small RNA methyltransferase, protein-R | 2e-04 | |
| 2fca_A | 213 | TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac | 4e-04 | |
| 3m33_A | 226 | Uncharacterized protein; structural genomics, PSI- | 4e-04 | |
| 3ofk_A | 216 | Nodulation protein S; NODS, N-methyltransferase, S | 5e-04 | |
| 2p7i_A | 250 | Hypothetical protein; putative methyltransferase, | 5e-04 | |
| 3dxy_A | 218 | TRNA (guanine-N(7)-)-methyltransferase; rossmann f | 7e-04 | |
| 3ckk_A | 235 | TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- | 8e-04 |
| >3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Length = 243 | Back alignment and structure |
|---|
Score = 70.6 bits (173), Expect = 5e-15
Identities = 25/128 (19%), Positives = 53/128 (41%), Gaps = 10/128 (7%)
Query: 89 PDWYEEFYASVMNSSMKSYEAEVAG-YKSQLFDNLRGKAKKVLEIGIGTGPNLKYYAADT 147
PD++ Y+ + S++ + + + G +++++G G G ++
Sbjct: 10 PDFFAG-YSQ-LGRSIEGLDGAAEWPALRAMLPEVGGL--RIVDLGCGFGWFCRWAHEHG 65
Query: 148 DVQVLGVDPNRKMEKYAQTAAVAAGLPLTNFKFLQAVGEAIPVSDASVDAVVGTLVLCSV 207
VLG+D + KM A+ A G+ + +A + + + S D +L L V
Sbjct: 66 ASYVLGLDLSEKMLARARAAGPDTGIT-----YERADLDKLHLPQDSFDLAYSSLALHYV 120
Query: 208 KDVDMTLQ 215
+DV +
Sbjct: 121 EDVARLFR 128
|
| >2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Length = 209 | Back alignment and structure |
|---|
| >1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Length = 227 | Back alignment and structure |
|---|
| >2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Length = 263 | Back alignment and structure |
|---|
| >1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Length = 219 | Back alignment and structure |
|---|
| >3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Length = 219 | Back alignment and structure |
|---|
| >2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Length = 211 | Back alignment and structure |
|---|
| >3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Length = 220 | Back alignment and structure |
|---|
| >1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Length = 252 | Back alignment and structure |
|---|
| >3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Length = 253 | Back alignment and structure |
|---|
| >3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Length = 261 | Back alignment and structure |
|---|
| >3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Length = 276 | Back alignment and structure |
|---|
| >1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Length = 239 | Back alignment and structure |
|---|
| >3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Length = 170 | Back alignment and structure |
|---|
| >3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Length = 219 | Back alignment and structure |
|---|
| >3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for structural genomics; 1.70A {Bacillus thuringiensis} Length = 242 | Back alignment and structure |
|---|
| >3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Length = 299 | Back alignment and structure |
|---|
| >3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Length = 195 | Back alignment and structure |
|---|
| >2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Length = 297 | Back alignment and structure |
|---|
| >2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Length = 260 | Back alignment and structure |
|---|
| >3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Length = 299 | Back alignment and structure |
|---|
| >3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Length = 257 | Back alignment and structure |
|---|
| >3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Length = 239 | Back alignment and structure |
|---|
| >3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} PDB: 2gh1_A Length = 284 | Back alignment and structure |
|---|
| >1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Length = 260 | Back alignment and structure |
|---|
| >3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Length = 267 | Back alignment and structure |
|---|
| >3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Length = 263 | Back alignment and structure |
|---|
| >3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Length = 273 | Back alignment and structure |
|---|
| >3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Length = 243 | Back alignment and structure |
|---|
| >3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Length = 305 | Back alignment and structure |
|---|
| >3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Length = 266 | Back alignment and structure |
|---|
| >2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* Length = 292 | Back alignment and structure |
|---|
| >1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Length = 246 | Back alignment and structure |
|---|
| >3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Length = 230 | Back alignment and structure |
|---|
| >3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Length = 219 | Back alignment and structure |
|---|
| >3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Length = 293 | Back alignment and structure |
|---|
| >3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Length = 227 | Back alignment and structure |
|---|
| >1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Length = 256 | Back alignment and structure |
|---|
| >3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Length = 235 | Back alignment and structure |
|---|
| >1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Length = 254 | Back alignment and structure |
|---|
| >4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Length = 383 | Back alignment and structure |
|---|
| >3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Length = 218 | Back alignment and structure |
|---|
| >3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Length = 203 | Back alignment and structure |
|---|
| >3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Length = 275 | Back alignment and structure |
|---|
| >3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Length = 217 | Back alignment and structure |
|---|
| >3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* Length = 312 | Back alignment and structure |
|---|
| >3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Length = 245 | Back alignment and structure |
|---|
| >2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Length = 241 | Back alignment and structure |
|---|
| >3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Length = 240 | Back alignment and structure |
|---|
| >2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Length = 215 | Back alignment and structure |
|---|
| >3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* Length = 225 | Back alignment and structure |
|---|
| >1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Length = 298 | Back alignment and structure |
|---|
| >2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Length = 199 | Back alignment and structure |
|---|
| >3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Length = 234 | Back alignment and structure |
|---|
| >1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Length = 269 | Back alignment and structure |
|---|
| >3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} Length = 218 | Back alignment and structure |
|---|
| >3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Length = 298 | Back alignment and structure |
|---|
| >1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Length = 214 | Back alignment and structure |
|---|
| >3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Length = 950 | Back alignment and structure |
|---|
| >2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Length = 213 | Back alignment and structure |
|---|
| >3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Length = 226 | Back alignment and structure |
|---|
| >3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Length = 216 | Back alignment and structure |
|---|
| >2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Length = 250 | Back alignment and structure |
|---|
| >3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* Length = 218 | Back alignment and structure |
|---|
| >3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} Length = 235 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 217 | |||
| 4gek_A | 261 | TRNA (CMO5U34)-methyltransferase; structural genom | 99.75 | |
| 3dlc_A | 219 | Putative S-adenosyl-L-methionine-dependent methylt | 99.75 | |
| 1vl5_A | 260 | Unknown conserved protein BH2331; putative methylt | 99.71 | |
| 4hg2_A | 257 | Methyltransferase type 11; structural genomics, PS | 99.71 | |
| 3bus_A | 273 | REBM, methyltransferase; rebeccamycin synthesis; H | 99.71 | |
| 1nkv_A | 256 | Hypothetical protein YJHP; structural genomics, PS | 99.7 | |
| 2o57_A | 297 | Putative sarcosine dimethylglycine methyltransfera | 99.7 | |
| 3kkz_A | 267 | Uncharacterized protein Q5LES9; putative methyltra | 99.69 | |
| 4htf_A | 285 | S-adenosylmethionine-dependent methyltransferase; | 99.69 | |
| 1p91_A | 269 | Ribosomal RNA large subunit methyltransferase A; R | 99.68 | |
| 3f4k_A | 257 | Putative methyltransferase; structural genomics, P | 99.66 | |
| 1xxl_A | 239 | YCGJ protein; structural genomics, protein structu | 99.66 | |
| 3hem_A | 302 | Cyclopropane-fatty-acyl-phospholipid synthase 2; p | 99.65 | |
| 3dh0_A | 219 | SAM dependent methyltransferase; cystal structure, | 99.65 | |
| 3mgg_A | 276 | Methyltransferase; NYSGXRC, PSI-II, protein struct | 99.65 | |
| 3g5t_A | 299 | Trans-aconitate 3-methyltransferase; structural ge | 99.64 | |
| 2yqz_A | 263 | Hypothetical protein TTHA0223; RNA methyltransfera | 99.64 | |
| 3ege_A | 261 | Putative methyltransferase from antibiotic biosyn | 99.64 | |
| 3jwg_A | 219 | HEN1, methyltransferase type 12; 1.90A {Clostridiu | 99.64 | |
| 3jwh_A | 217 | HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena | 99.64 | |
| 3vc1_A | 312 | Geranyl diphosphate 2-C-methyltransferase; rossman | 99.63 | |
| 3ou2_A | 218 | SAM-dependent methyltransferase; O-methyltransfera | 99.63 | |
| 3l8d_A | 242 | Methyltransferase; structural genomics, PSI, nysgr | 99.63 | |
| 2gb4_A | 252 | Thiopurine S-methyltransferase; 18204406, thiopuri | 99.63 | |
| 4fsd_A | 383 | Arsenic methyltransferase; rossmann fold; 1.75A {C | 99.63 | |
| 3g5l_A | 253 | Putative S-adenosylmethionine dependent methyltran | 99.63 | |
| 1pjz_A | 203 | Thiopurine S-methyltransferase; polymorphism, S-ad | 99.63 | |
| 2gs9_A | 211 | Hypothetical protein TT1324; methyl transferase, s | 99.62 | |
| 2ex4_A | 241 | Adrenal gland protein AD-003; methyltransferase, s | 99.62 | |
| 2p7i_A | 250 | Hypothetical protein; putative methyltransferase, | 99.62 | |
| 3pfg_A | 263 | N-methyltransferase; N,N-dimethyltransferase, SAM | 99.61 | |
| 1kpg_A | 287 | CFA synthase;, cyclopropane-fatty-acyl-phospholipi | 99.61 | |
| 3ofk_A | 216 | Nodulation protein S; NODS, N-methyltransferase, S | 99.61 | |
| 2p8j_A | 209 | S-adenosylmethionine-dependent methyltransferase; | 99.61 | |
| 2xvm_A | 199 | Tellurite resistance protein TEHB; antibiotic resi | 99.6 | |
| 2aot_A | 292 | HMT, histamine N-methyltransferase; classic methyl | 99.6 | |
| 3bkx_A | 275 | SAM-dependent methyltransferase; YP_807781.1, cycl | 99.6 | |
| 3hnr_A | 220 | Probable methyltransferase BT9727_4108; structural | 99.6 | |
| 3ujc_A | 266 | Phosphoethanolamine N-methyltransferase; parasite; | 99.6 | |
| 3dtn_A | 234 | Putative methyltransferase MM_2633; structural gen | 99.59 | |
| 1ri5_A | 298 | MRNA capping enzyme; methyltransferase, M7G, messe | 99.59 | |
| 3h2b_A | 203 | SAM-dependent methyltransferase; alpha-beta protei | 99.59 | |
| 3thr_A | 293 | Glycine N-methyltransferase; GNMT, folate, methylt | 99.59 | |
| 1y8c_A | 246 | S-adenosylmethionine-dependent methyltransferase; | 99.59 | |
| 4azs_A | 569 | Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 | 99.59 | |
| 3ccf_A | 279 | Cyclopropane-fatty-acyl-phospholipid synthase; YP_ | 99.59 | |
| 1xtp_A | 254 | LMAJ004091AAA; SGPP, structural genomics, PSI, pro | 99.58 | |
| 1ve3_A | 227 | Hypothetical protein PH0226; dimer, riken structur | 99.58 | |
| 3gu3_A | 284 | Methyltransferase; alpha-beta protein, structural | 99.57 | |
| 3lcc_A | 235 | Putative methyl chloride transferase; halide methy | 99.57 | |
| 1zx0_A | 236 | Guanidinoacetate N-methyltransferase; structural g | 99.57 | |
| 2fk8_A | 318 | Methoxy mycolic acid synthase 4; S-adenosylmethion | 99.57 | |
| 2fyt_A | 340 | Protein arginine N-methyltransferase 3; structural | 99.57 | |
| 3q7e_A | 349 | Protein arginine N-methyltransferase 1; HET: SAH; | 99.57 | |
| 3e23_A | 211 | Uncharacterized protein RPA2492; alpha-beta protei | 99.56 | |
| 3ocj_A | 305 | Putative exported protein; structural genomics, PS | 99.56 | |
| 2p35_A | 259 | Trans-aconitate 2-methyltransferase; SAM dependent | 99.56 | |
| 3dli_A | 240 | Methyltransferase; PSI-II, NYSGXRC, structural gen | 99.55 | |
| 3sm3_A | 235 | SAM-dependent methyltransferases; NESG, structural | 99.55 | |
| 1wzn_A | 252 | SAM-dependent methyltransferase; structural genomi | 99.55 | |
| 3bkw_A | 243 | MLL3908 protein, S-adenosylmethionine dependent me | 99.54 | |
| 3mti_A | 185 | RRNA methylase; SAM-dependent, PSI, MCSG, structur | 99.54 | |
| 3m70_A | 286 | Tellurite resistance protein TEHB homolog; structu | 99.54 | |
| 3orh_A | 236 | Guanidinoacetate N-methyltransferase; structura ge | 99.54 | |
| 3i9f_A | 170 | Putative type 11 methyltransferase; structural gen | 99.54 | |
| 3bxo_A | 239 | N,N-dimethyltransferase; desosamine, sugar, carboh | 99.54 | |
| 3htx_A | 950 | HEN1; HEN1, small RNA methyltransferase, protein-R | 99.54 | |
| 3d2l_A | 243 | SAM-dependent methyltransferase; ZP_00538691.1, st | 99.53 | |
| 3fpf_A | 298 | Mtnas, putative uncharacterized protein; thermonic | 99.53 | |
| 2a14_A | 263 | Indolethylamine N-methyltransferase; SGC,INMT, str | 99.53 | |
| 3lbf_A | 210 | Protein-L-isoaspartate O-methyltransferase; modifi | 99.53 | |
| 1g6q_1 | 328 | HnRNP arginine N-methyltransferase; SAM-binding do | 99.52 | |
| 3r0q_C | 376 | Probable protein arginine N-methyltransferase 4.2; | 99.52 | |
| 3gdh_A | 241 | Trimethylguanosine synthase homolog; M7G, CAP, dim | 99.52 | |
| 3p9n_A | 189 | Possible methyltransferase (methylase); RV2966C, a | 99.52 | |
| 2vdw_A | 302 | Vaccinia virus capping enzyme D1 subunit; nucleoti | 99.52 | |
| 1vlm_A | 219 | SAM-dependent methyltransferase; possible histamin | 99.52 | |
| 2pxx_A | 215 | Uncharacterized protein MGC2408; structural genomi | 99.51 | |
| 2g72_A | 289 | Phenylethanolamine N-methyltransferase; HET: SAM F | 99.5 | |
| 2yxd_A | 183 | Probable cobalt-precorrin-6Y C(15)-methyltransfer | 99.49 | |
| 4e2x_A | 416 | TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s | 99.49 | |
| 2avn_A | 260 | Ubiquinone/menaquinone biosynthesis methyltransfe | 99.49 | |
| 3fzg_A | 200 | 16S rRNA methylase; methyltransferase, plasmid, tr | 99.48 | |
| 2kw5_A | 202 | SLR1183 protein; structural genomics, northeast st | 99.48 | |
| 2y1w_A | 348 | Histone-arginine methyltransferase CARM1; histone | 99.48 | |
| 3bgv_A | 313 | MRNA CAP guanine-N7 methyltransferase; alternative | 99.48 | |
| 2i62_A | 265 | Nicotinamide N-methyltransferase; structural genom | 99.48 | |
| 3hm2_A | 178 | Precorrin-6Y C5,15-methyltransferase; alpha-beta-s | 99.48 | |
| 3e8s_A | 227 | Putative SAM dependent methyltransferase; NP_74470 | 99.48 | |
| 3g2m_A | 299 | PCZA361.24; SAM-dependent methyltransferase, glyco | 99.47 | |
| 3g07_A | 292 | 7SK snRNA methylphosphate capping enzyme; structur | 99.47 | |
| 3cc8_A | 230 | Putative methyltransferase; structural genomics, j | 99.47 | |
| 3e05_A | 204 | Precorrin-6Y C5,15-methyltransferase (decarboxyla; | 99.47 | |
| 3njr_A | 204 | Precorrin-6Y methylase; methyltransferase, decarbo | 99.47 | |
| 3uwp_A | 438 | Histone-lysine N-methyltransferase, H3 lysine-79; | 99.47 | |
| 2fpo_A | 202 | Methylase YHHF; structural genomics, putative meth | 99.46 | |
| 3eey_A | 197 | Putative rRNA methylase; rRNA methylation, S-adeno | 99.46 | |
| 3m33_A | 226 | Uncharacterized protein; structural genomics, PSI- | 99.46 | |
| 1dus_A | 194 | MJ0882; hypothetical protein, methanococcus jannas | 99.46 | |
| 2ift_A | 201 | Putative methylase HI0767; NESG, Y767_haein, struc | 99.46 | |
| 1yzh_A | 214 | TRNA (guanine-N(7)-)-methyltransferase; alpha-beta | 99.45 | |
| 4hc4_A | 376 | Protein arginine N-methyltransferase 6; HRMT1L6, S | 99.45 | |
| 3cgg_A | 195 | SAM-dependent methyltransferase; NP_600671.1, meth | 99.45 | |
| 2fca_A | 213 | TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac | 99.44 | |
| 3dxy_A | 218 | TRNA (guanine-N(7)-)-methyltransferase; rossmann f | 99.44 | |
| 1xdz_A | 240 | Methyltransferase GIDB; MCSG, protein structure in | 99.44 | |
| 2qe6_A | 274 | Uncharacterized protein TFU_2867; putative methylt | 99.44 | |
| 3grz_A | 205 | L11 mtase, ribosomal protein L11 methyltransferase | 99.43 | |
| 2esr_A | 177 | Methyltransferase; structural genomics, hypothetic | 99.42 | |
| 3ggd_A | 245 | SAM-dependent methyltransferase; YP_325210.1, stru | 99.42 | |
| 2fhp_A | 187 | Methylase, putative; alpha-beta-alpha sandwich, st | 99.41 | |
| 3i53_A | 332 | O-methyltransferase; CO-complex, rossmann-like fol | 99.41 | |
| 1dl5_A | 317 | Protein-L-isoaspartate O-methyltransferase; isoasp | 99.41 | |
| 3gwz_A | 369 | MMCR; methyltransferase, mitomycin, S-adenosyl met | 99.41 | |
| 2yxe_A | 215 | Protein-L-isoaspartate O-methyltransferase; rossma | 99.4 | |
| 3ntv_A | 232 | MW1564 protein; rossmann fold, putative methyltran | 99.4 | |
| 3iv6_A | 261 | Putative Zn-dependent alcohol dehydrogenase; alpha | 99.4 | |
| 3u81_A | 221 | Catechol O-methyltransferase; neurotransmitter deg | 99.4 | |
| 3b3j_A | 480 | Histone-arginine methyltransferase CARM1; protein | 99.39 | |
| 3dmg_A | 381 | Probable ribosomal RNA small subunit methyltransf; | 99.39 | |
| 1vbf_A | 231 | 231AA long hypothetical protein-L-isoaspartate O- | 99.39 | |
| 1x19_A | 359 | CRTF-related protein; methyltransferase, bacterioc | 99.38 | |
| 1qzz_A | 374 | RDMB, aclacinomycin-10-hydroxylase; anthracycline, | 99.37 | |
| 1jsx_A | 207 | Glucose-inhibited division protein B; methyltransf | 99.37 | |
| 3mq2_A | 218 | 16S rRNA methyltransferase; methyltranferase, ribo | 99.37 | |
| 2r3s_A | 335 | Uncharacterized protein; methyltransferase domain, | 99.37 | |
| 3ckk_A | 235 | TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- | 99.36 | |
| 3lpm_A | 259 | Putative methyltransferase; structural genomics, p | 99.36 | |
| 1zq9_A | 285 | Probable dimethyladenosine transferase; SGC, struc | 99.36 | |
| 1jg1_A | 235 | PIMT;, protein-L-isoaspartate O-methyltransferase; | 99.36 | |
| 3g89_A | 249 | Ribosomal RNA small subunit methyltransferase G; 1 | 99.36 | |
| 3dp7_A | 363 | SAM-dependent methyltransferase; structural genomi | 99.35 | |
| 2gpy_A | 233 | O-methyltransferase; structural genomics, PSI, pro | 99.35 | |
| 3q87_B | 170 | N6 adenine specific DNA methylase; SAM-methyltrans | 99.35 | |
| 1l3i_A | 192 | Precorrin-6Y methyltransferase/putative decarboxyl | 99.35 | |
| 3gnl_A | 244 | Uncharacterized protein, DUF633, LMOF2365_1472; st | 99.34 | |
| 1ne2_A | 200 | Hypothetical protein TA1320; structural genomics, | 99.34 | |
| 3mb5_A | 255 | SAM-dependent methyltransferase; RNA methyltransfe | 99.34 | |
| 2h00_A | 254 | Methyltransferase 10 domain containing protein; st | 99.34 | |
| 3gru_A | 295 | Dimethyladenosine transferase; rossman fold, ribos | 99.33 | |
| 3lec_A | 230 | NADB-rossmann superfamily protein; PSI, MCSG, stru | 99.33 | |
| 3evz_A | 230 | Methyltransferase; NYSGXRC, NEW YORK SGX research | 99.33 | |
| 1yb2_A | 275 | Hypothetical protein TA0852; structural genomics, | 99.33 | |
| 3mcz_A | 352 | O-methyltransferase; adomet_mtases, S-adenosylmeth | 99.33 | |
| 3c3p_A | 210 | Methyltransferase; NP_951602.1, structural genomic | 99.32 | |
| 2pwy_A | 258 | TRNA (adenine-N(1)-)-methyltransferase; mtase, ado | 99.32 | |
| 2b3t_A | 276 | Protein methyltransferase HEMK; translation termin | 99.32 | |
| 2frn_A | 278 | Hypothetical protein PH0793; structural genomics, | 99.32 | |
| 3dr5_A | 221 | Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 | 99.32 | |
| 1i9g_A | 280 | Hypothetical protein RV2118C; mtase, adoMet, cryst | 99.32 | |
| 3p2e_A | 225 | 16S rRNA methylase; methyltransferase, transferase | 99.31 | |
| 3tfw_A | 248 | Putative O-methyltransferase; PSI-biology, nysgrc, | 99.31 | |
| 4dcm_A | 375 | Ribosomal RNA large subunit methyltransferase G; 2 | 99.31 | |
| 1tw3_A | 360 | COMT, carminomycin 4-O-methyltransferase; anthracy | 99.31 | |
| 1u2z_A | 433 | Histone-lysine N-methyltransferase, H3 lysine-79 s | 99.31 | |
| 3frh_A | 253 | 16S rRNA methylase; methyltransferase domain, heli | 99.31 | |
| 2h1r_A | 299 | Dimethyladenosine transferase, putative; SGC toron | 99.3 | |
| 1wy7_A | 207 | Hypothetical protein PH1948; seven-stranded beta s | 99.3 | |
| 2pbf_A | 227 | Protein-L-isoaspartate O-methyltransferase beta-A | 99.3 | |
| 1ws6_A | 171 | Methyltransferase; structural genomics, riken stru | 99.3 | |
| 1fbn_A | 230 | MJ fibrillarin homologue; MJ proteins, ribosomal R | 99.29 | |
| 2ip2_A | 334 | Probable phenazine-specific methyltransferase; pyo | 99.29 | |
| 4dzr_A | 215 | Protein-(glutamine-N5) methyltransferase, release | 99.29 | |
| 1uwv_A | 433 | 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m | 99.28 | |
| 1i1n_A | 226 | Protein-L-isoaspartate O-methyltransferase; S-aden | 99.27 | |
| 2yvl_A | 248 | TRMI protein, hypothetical protein; tRNA, methyltr | 99.27 | |
| 2vdv_E | 246 | TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl | 99.27 | |
| 2zfu_A | 215 | Nucleomethylin, cerebral protein 1; nucleolar prot | 99.27 | |
| 3bzb_A | 281 | Uncharacterized protein; RED ALGA, protein structu | 99.27 | |
| 1nt2_A | 210 | Fibrillarin-like PRE-rRNA processing protein; adeM | 99.27 | |
| 3tr6_A | 225 | O-methyltransferase; cellular processes; HET: SAH; | 99.26 | |
| 3kr9_A | 225 | SAM-dependent methyltransferase; class I rossmann- | 99.26 | |
| 3tm4_A | 373 | TRNA (guanine N2-)-methyltransferase TRM14; rossma | 99.26 | |
| 2ozv_A | 260 | Hypothetical protein ATU0636; structural genomics, | 99.26 | |
| 1r18_A | 227 | Protein-L-isoaspartate(D-aspartate)-O-methyltrans; | 99.26 | |
| 2hnk_A | 239 | SAM-dependent O-methyltransferase; modified rossma | 99.26 | |
| 3duw_A | 223 | OMT, O-methyltransferase, putative; alternating of | 99.25 | |
| 1nv8_A | 284 | HEMK protein; class I adoMet-dependent methyltrans | 99.25 | |
| 4df3_A | 233 | Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; | 99.25 | |
| 1af7_A | 274 | Chemotaxis receptor methyltransferase CHER; chemot | 99.24 | |
| 1o54_A | 277 | SAM-dependent O-methyltransferase; TM0748, structu | 99.24 | |
| 3lcv_B | 281 | Sisomicin-gentamicin resistance methylase SGM; ant | 99.24 | |
| 3tqs_A | 255 | Ribosomal RNA small subunit methyltransferase A; p | 99.23 | |
| 3giw_A | 277 | Protein of unknown function DUF574; rossmann-fold | 99.22 | |
| 3a27_A | 272 | TYW2, uncharacterized protein MJ1557; wybutosine m | 99.22 | |
| 2pjd_A | 343 | Ribosomal RNA small subunit methyltransferase C; g | 99.21 | |
| 1fp2_A | 352 | Isoflavone O-methyltransferase; protein-product co | 99.21 | |
| 1fp1_D | 372 | Isoliquiritigenin 2'-O-methyltransferase; protein- | 99.21 | |
| 2nxc_A | 254 | L11 mtase, ribosomal protein L11 methyltransferase | 99.2 | |
| 3tma_A | 354 | Methyltransferase; thump domain; 2.05A {Thermus th | 99.2 | |
| 2ipx_A | 233 | RRNA 2'-O-methyltransferase fibrillarin; FBL, stru | 99.2 | |
| 3cbg_A | 232 | O-methyltransferase; cyanobacterium; HET: SAH FER | 99.2 | |
| 3r3h_A | 242 | O-methyltransferase, SAM-dependent; structural gen | 99.19 | |
| 3k6r_A | 278 | Putative transferase PH0793; structural genomics, | 99.18 | |
| 2b25_A | 336 | Hypothetical protein; structural genomics, methyl | 99.17 | |
| 1sui_A | 247 | Caffeoyl-COA O-methyltransferase; rossmann fold, p | 99.17 | |
| 3lst_A | 348 | CALO1 methyltransferase; calicheamicin, enediyne, | 99.17 | |
| 2avd_A | 229 | Catechol-O-methyltransferase; structural genomics, | 99.16 | |
| 1o9g_A | 250 | RRNA methyltransferase; antibiotic resistance, Se- | 99.15 | |
| 3fut_A | 271 | Dimethyladenosine transferase; methyltransferase, | 99.15 | |
| 1ixk_A | 315 | Methyltransferase; open beta sheet; 1.90A {Pyrococ | 99.14 | |
| 2igt_A | 332 | SAM dependent methyltransferase; alpha-beta sandwi | 99.14 | |
| 3reo_A | 368 | (ISO)eugenol O-methyltransferase; directed evoluti | 99.14 | |
| 3c3y_A | 237 | Pfomt, O-methyltransferase; plant secondary metabo | 99.13 | |
| 1ej0_A | 180 | FTSJ; methyltransferase, adoMet, adenosyl methioni | 99.13 | |
| 3id6_C | 232 | Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; | 99.12 | |
| 1qam_A | 244 | ERMC' methyltransferase; rRNA methyltransferase ER | 99.11 | |
| 2bm8_A | 236 | Cephalosporin hydroxylase CMCI; cephamycin biosynt | 99.11 | |
| 3p9c_A | 364 | Caffeic acid O-methyltransferase; S-adenosylmethio | 99.11 | |
| 1m6y_A | 301 | S-adenosyl-methyltransferase MRAW; SAM-dependent m | 99.1 | |
| 3sso_A | 419 | Methyltransferase; macrolide, natural product, ros | 99.1 | |
| 3ftd_A | 249 | Dimethyladenosine transferase; KSGA, rossmann-like | 99.09 | |
| 3hp7_A | 291 | Hemolysin, putative; structural genomics, APC64019 | 99.09 | |
| 2qm3_A | 373 | Predicted methyltransferase; putative methyltransf | 99.09 | |
| 1zg3_A | 358 | Isoflavanone 4'-O-methyltransferase; rossman fold, | 99.08 | |
| 3adn_A | 294 | Spermidine synthase; aminopropyltransferase, polya | 99.07 | |
| 3bwc_A | 304 | Spermidine synthase; SAM, SGPP, structura genomics | 99.06 | |
| 1xj5_A | 334 | Spermidine synthase 1; structural genomics, protei | 99.04 | |
| 3ajd_A | 274 | Putative methyltransferase MJ0026; tRNA, M5C, ross | 99.04 | |
| 1inl_A | 296 | Spermidine synthase; beta-barrel, rossman fold, st | 99.04 | |
| 1iy9_A | 275 | Spermidine synthase; rossmann fold, structural gen | 99.04 | |
| 2yx1_A | 336 | Hypothetical protein MJ0883; methyl transferase, t | 99.04 | |
| 2ld4_A | 176 | Anamorsin; methyltransferase-like fold, alpha/beta | 99.04 | |
| 3gjy_A | 317 | Spermidine synthase; APC62791, structural genomics | 99.03 | |
| 1g8a_A | 227 | Fibrillarin-like PRE-rRNA processing protein; rRNA | 99.03 | |
| 2r6z_A | 258 | UPF0341 protein in RSP 3' region; alpha-beta prote | 99.03 | |
| 2o07_A | 304 | Spermidine synthase; structural genomics, structur | 99.03 | |
| 1uir_A | 314 | Polyamine aminopropyltransferase; spermidien synth | 99.02 | |
| 3v97_A | 703 | Ribosomal RNA large subunit methyltransferase L; Y | 99.02 | |
| 3uzu_A | 279 | Ribosomal RNA small subunit methyltransferase A; s | 99.02 | |
| 2as0_A | 396 | Hypothetical protein PH1915; RNA methyltransferase | 99.02 | |
| 3bt7_A | 369 | TRNA (uracil-5-)-methyltransferase; methyluridine, | 99.01 | |
| 2b78_A | 385 | Hypothetical protein SMU.776; structure genomics, | 99.01 | |
| 2jjq_A | 425 | Uncharacterized RNA methyltransferase pyrab10780; | 99.01 | |
| 2plw_A | 201 | Ribosomal RNA methyltransferase, putative; malaria | 99.01 | |
| 1qyr_A | 252 | KSGA, high level kasugamycin resistance protein, S | 99.0 | |
| 3c0k_A | 396 | UPF0064 protein YCCW; PUA domain, adoMet dependent | 99.0 | |
| 2pt6_A | 321 | Spermidine synthase; transferase, structural genom | 98.99 | |
| 3k0b_A | 393 | Predicted N6-adenine-specific DNA methylase; methy | 98.99 | |
| 1mjf_A | 281 | Spermidine synthase; spermidine synthetase, struct | 98.98 | |
| 3ldu_A | 385 | Putative methylase; structural genomics, PSI-2, pr | 98.98 | |
| 2wa2_A | 276 | Non-structural protein 5; transferase, S-adenosyl- | 98.98 | |
| 2b2c_A | 314 | Spermidine synthase; beta-alpha, transferase; 2.50 | 98.97 | |
| 2yxl_A | 450 | PH0851 protein, 450AA long hypothetical FMU protei | 98.96 | |
| 3ldg_A | 384 | Putative uncharacterized protein SMU.472; YPSC, me | 98.96 | |
| 4a6d_A | 353 | Hydroxyindole O-methyltransferase; melatonin, circ | 98.96 | |
| 3ll7_A | 410 | Putative methyltransferase; methytransferase, stru | 98.95 | |
| 2oxt_A | 265 | Nucleoside-2'-O-methyltransferase; flavivirus, vir | 98.95 | |
| 3opn_A | 232 | Putative hemolysin; structural genomics, PSI-2, pr | 98.94 | |
| 1yub_A | 245 | Ermam, rRNA methyltransferase; MLS antibiotics; NM | 98.93 | |
| 1wxx_A | 382 | TT1595, hypothetical protein TTHA1280; thermus the | 98.92 | |
| 3dou_A | 191 | Ribosomal RNA large subunit methyltransferase J; c | 98.91 | |
| 2frx_A | 479 | Hypothetical protein YEBU; rossmann-type S-adenosy | 98.91 | |
| 2b9e_A | 309 | NOL1/NOP2/SUN domain family, member 5 isoform 2; m | 98.9 | |
| 4dmg_A | 393 | Putative uncharacterized protein TTHA1493; rRNA, m | 98.9 | |
| 2i7c_A | 283 | Spermidine synthase; transferase, structural genom | 98.88 | |
| 3m6w_A | 464 | RRNA methylase; rRNA methyltransferase, 5-methylcy | 98.86 | |
| 2cmg_A | 262 | Spermidine synthase; transferase, putrescine amino | 98.85 | |
| 2f8l_A | 344 | Hypothetical protein LMO1582; structural genomics, | 98.84 | |
| 3m4x_A | 456 | NOL1/NOP2/SUN family protein; mtase domain, PUA do | 98.84 | |
| 4gqb_A | 637 | Protein arginine N-methyltransferase 5; TIM barrel | 98.83 | |
| 1sqg_A | 429 | SUN protein, FMU protein; rossmann-fold, mixed bet | 98.83 | |
| 2nyu_A | 196 | Putative ribosomal RNA methyltransferase 2; SAM, s | 98.79 | |
| 3v97_A | 703 | Ribosomal RNA large subunit methyltransferase L; Y | 98.68 | |
| 2okc_A | 445 | Type I restriction enzyme stysji M protein; NP_813 | 98.67 | |
| 2ih2_A | 421 | Modification methylase TAQI; DNA, DNA methyltransf | 98.66 | |
| 3ua3_A | 745 | Protein arginine N-methyltransferase 5; TIM-barrel | 98.66 | |
| 2dul_A | 378 | N(2),N(2)-dimethylguanosine tRNA methyltransferas; | 98.65 | |
| 2p41_A | 305 | Type II methyltransferase; vizier, viral enzymes i | 98.62 | |
| 2oyr_A | 258 | UPF0341 protein YHIQ; alpha-beta protein, structur | 98.6 | |
| 2qfm_A | 364 | Spermine synthase; spermidine aminopropyltransfera | 98.58 | |
| 3axs_A | 392 | Probable N(2),N(2)-dimethylguanosine tRNA methylt | 98.56 | |
| 2xyq_A | 290 | Putative 2'-O-methyl transferase; transferase-vira | 98.49 | |
| 1wg8_A | 285 | Predicted S-adenosylmethionine-dependent methyltra | 98.49 | |
| 3lkd_A | 542 | Type I restriction-modification system methyltrans | 98.38 | |
| 3cvo_A | 202 | Methyltransferase-like protein of unknown functio; | 98.38 | |
| 3b5i_A | 374 | S-adenosyl-L-methionine:salicylic acid carboxyl me | 98.36 | |
| 2efj_A | 384 | 3,7-dimethylxanthine methyltransferase; SAM-depend | 98.33 | |
| 2k4m_A | 153 | TR8_protein, UPF0146 protein MTH_1000; alpha+beta, | 98.3 | |
| 2ar0_A | 541 | M.ecoki, type I restriction enzyme ecoki M protein | 98.27 | |
| 3khk_A | 544 | Type I restriction-modification system methylation | 98.26 | |
| 1m6e_X | 359 | S-adenosyl-L-methionnine:salicylic acid carboxyl m | 98.13 | |
| 4auk_A | 375 | Ribosomal RNA large subunit methyltransferase M; Y | 98.13 | |
| 2zig_A | 297 | TTHA0409, putative modification methylase; methylt | 98.1 | |
| 3o4f_A | 294 | Spermidine synthase; aminopropyltransferase, polya | 97.92 | |
| 3s1s_A | 878 | Restriction endonuclease bpusi; PD--(D/E)XK cataly | 97.87 | |
| 3evf_A | 277 | RNA-directed RNA polymerase NS5; NS5 methyltransfe | 97.86 | |
| 3gcz_A | 282 | Polyprotein; flavivirus, RNA capping, methyltransf | 97.72 | |
| 3tka_A | 347 | Ribosomal RNA small subunit methyltransferase H; H | 97.69 | |
| 2wk1_A | 282 | NOVP; transferase, O-methyltransferase, novobiocin | 97.6 | |
| 1g60_A | 260 | Adenine-specific methyltransferase MBOIIA; structu | 97.53 | |
| 3ufb_A | 530 | Type I restriction-modification system methyltran | 97.5 | |
| 4fzv_A | 359 | Putative methyltransferase NSUN4; mterf fold, meth | 97.5 | |
| 3p8z_A | 267 | Mtase, non-structural protein 5; methyltransferase | 97.47 | |
| 2qy6_A | 257 | UPF0209 protein YFCK; structural genomics, unknown | 97.46 | |
| 1i4w_A | 353 | Mitochondrial replication protein MTF1; mitochondr | 97.26 | |
| 3lkz_A | 321 | Non-structural protein 5; flavivirus, methyltransf | 97.2 | |
| 3c6k_A | 381 | Spermine synthase; spermidine aminopropyltransfera | 97.17 | |
| 3eld_A | 300 | Methyltransferase; flavivirus, RNA capping, guanyl | 96.93 | |
| 2px2_A | 269 | Genome polyprotein [contains: capsid protein C (co | 96.45 | |
| 1g55_A | 343 | DNA cytosine methyltransferase DNMT2; human DNA me | 96.32 | |
| 3g7u_A | 376 | Cytosine-specific methyltransferase; DNA-binding, | 96.24 | |
| 1zkd_A | 387 | DUF185; NESG, RPR58, structural genomics, PSI, pro | 96.2 | |
| 2vz8_A | 2512 | Fatty acid synthase; transferase, phosphopantethei | 96.19 | |
| 2py6_A | 409 | Methyltransferase FKBM; YP_546752.1, structural ge | 95.75 | |
| 1boo_A | 323 | Protein (N-4 cytosine-specific methyltransferase P | 95.5 | |
| 2c7p_A | 327 | Modification methylase HHAI; DNA methyltransferase | 95.38 | |
| 4f3n_A | 432 | Uncharacterized ACR, COG1565 superfamily; structur | 95.29 | |
| 1rjd_A | 334 | PPM1P, carboxy methyl transferase for protein phos | 95.22 | |
| 1eg2_A | 319 | Modification methylase RSRI; rossmann fold, exocyc | 95.05 | |
| 3qv2_A | 327 | 5-cytosine DNA methyltransferase; DNMT2, ehmeth; H | 94.62 | |
| 4h0n_A | 333 | DNMT2; SAH binding, transferase; HET: SAH; 2.71A { | 94.23 | |
| 3r24_A | 344 | NSP16, 2'-O-methyl transferase; methyltransferase, | 93.74 | |
| 2qrv_A | 295 | DNA (cytosine-5)-methyltransferase 3A; DNA methylt | 93.47 | |
| 2uyo_A | 310 | Hypothetical protein ML2640; putative methyltransf | 93.06 | |
| 3ubt_Y | 331 | Modification methylase HAEIII; protein-DNA complex | 92.67 | |
| 2oo3_A | 283 | Protein involved in catabolism of external DNA; st | 92.29 | |
| 3fwz_A | 140 | Inner membrane protein YBAL; TRKA-N domain, E.coli | 91.91 | |
| 3llv_A | 141 | Exopolyphosphatase-related protein; NAD(P)-binding | 91.75 | |
| 1f8f_A | 371 | Benzyl alcohol dehydrogenase; rossmann fold, oxido | 89.42 | |
| 3e8x_A | 236 | Putative NAD-dependent epimerase/dehydratase; stru | 89.23 | |
| 3two_A | 348 | Mannitol dehydrogenase; cinnamyl-alcohol dehydroge | 88.89 | |
| 3ius_A | 286 | Uncharacterized conserved protein; APC63810, silic | 88.32 | |
| 3me5_A | 482 | Cytosine-specific methyltransferase; structural ge | 88.2 | |
| 3nzo_A | 399 | UDP-N-acetylglucosamine 4,6-dehydratase; structura | 87.06 | |
| 3fpc_A | 352 | NADP-dependent alcohol dehydrogenase; oxydoreducta | 86.66 | |
| 3goh_A | 315 | Alcohol dehydrogenase, zinc-containing; NP_718042. | 84.98 | |
| 2dph_A | 398 | Formaldehyde dismutase; dismutation of aldehydes, | 84.7 | |
| 2ae2_A | 260 | Protein (tropinone reductase-II); oxidoreductase, | 84.42 | |
| 1lss_A | 140 | TRK system potassium uptake protein TRKA homolog; | 84.4 | |
| 3iht_A | 174 | S-adenosyl-L-methionine methyl transferase; YP_165 | 84.07 | |
| 3s2e_A | 340 | Zinc-containing alcohol dehydrogenase superfamily; | 83.9 | |
| 3c85_A | 183 | Putative glutathione-regulated potassium-efflux S | 83.64 | |
| 1ae1_A | 273 | Tropinone reductase-I; oxidoreductase, tropane alk | 82.86 | |
| 1piw_A | 360 | Hypothetical zinc-type alcohol dehydrogenase- like | 82.78 | |
| 4ej6_A | 370 | Putative zinc-binding dehydrogenase; structural ge | 82.78 | |
| 3swr_A | 1002 | DNA (cytosine-5)-methyltransferase 1; epigenetics, | 82.51 | |
| 3gms_A | 340 | Putative NADPH:quinone reductase; structural genom | 82.49 | |
| 1pl8_A | 356 | Human sorbitol dehydrogenase; NAD, oxidoreductase; | 82.48 | |
| 3h7a_A | 252 | Short chain dehydrogenase; oxidoreductase, PSI-2, | 82.37 | |
| 3l4b_C | 218 | TRKA K+ channel protien TM1088B; potassium channel | 82.15 | |
| 4g65_A | 461 | TRK system potassium uptake protein TRKA; structur | 81.49 | |
| 1jvb_A | 347 | NAD(H)-dependent alcohol dehydrogenase; archaeon, | 81.45 | |
| 4fn4_A | 254 | Short chain dehydrogenase; NADH-binding, rossmann | 81.45 | |
| 3l9w_A | 413 | Glutathione-regulated potassium-efflux system Pro | 81.3 | |
| 4hp8_A | 247 | 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi | 81.23 | |
| 3l77_A | 235 | Short-chain alcohol dehydrogenase; oxidoreductase; | 81.06 | |
| 3ioy_A | 319 | Short-chain dehydrogenase/reductase SDR; structura | 80.93 | |
| 1y1p_A | 342 | ARII, aldehyde reductase II; rossmann fold, short | 80.8 | |
| 4fs3_A | 256 | Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; | 80.63 | |
| 3cxt_A | 291 | Dehydrogenase with different specificities; rossma | 80.5 | |
| 3tsc_A | 277 | Putative oxidoreductase; structural genomics, seat | 80.1 |
| >4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* | Back alignment and structure |
|---|
Probab=99.75 E-value=2.3e-17 Score=132.81 Aligned_cols=103 Identities=14% Similarity=0.208 Sum_probs=85.9
Q ss_pred HHHHHHHHHHHHHHHHHhcCCCCeEEEECCCCCcchHHhhhC---CCCeEEEEcCCHHHHHHHHHHHHHcCCCCCCeEEE
Q 027860 105 KSYEAEVAGYKSQLFDNLRGKAKKVLEIGIGTGPNLKYYAAD---TDVQVLGVDPNRKMEKYAQTAAVAAGLPLTNFKFL 181 (217)
Q Consensus 105 ~~~~~~~~~~~~~~~~~l~~~~~~VLDiGcG~G~~~~~la~~---~~~~v~giD~S~~~l~~a~~~~~~~~~~~~~i~~~ 181 (217)
+.|.. +.+....++.....++.+|||||||+|.++..+++. ++.+|+|+|+|+.|++.|++++...+.. .+++|+
T Consensus 51 P~Y~~-~~~~i~~l~~~~~~~~~~vLDlGcGtG~~~~~la~~~~~~~~~v~gvD~s~~ml~~A~~~~~~~~~~-~~v~~~ 128 (261)
T 4gek_A 51 PGYSN-IISMIGMLAERFVQPGTQVYDLGCSLGAATLSVRRNIHHDNCKIIAIDNSPAMIERCRRHIDAYKAP-TPVDVI 128 (261)
T ss_dssp TTHHH-HHHHHHHHHHHHCCTTCEEEEETCTTTHHHHHHHHTCCSSSCEEEEEESCHHHHHHHHHHHHTSCCS-SCEEEE
T ss_pred CCHHH-HHHHHHHHHHHhCCCCCEEEEEeCCCCHHHHHHHHhcCCCCCEEEEEECCHHHHHHHHHHHHhhccC-ceEEEe
Confidence 34655 555556666666568899999999999999998863 4679999999999999999999887765 689999
Q ss_pred eccccccCCCCCcccEEEeccccccccChh
Q 027860 182 QAVGEAIPVSDASVDAVVGTLVLCSVKDVD 211 (217)
Q Consensus 182 ~~d~~~lp~~~~sfD~Vi~~~~l~~~~d~~ 211 (217)
++|+.++|++ .||+|+++++++|+++.+
T Consensus 129 ~~D~~~~~~~--~~d~v~~~~~l~~~~~~~ 156 (261)
T 4gek_A 129 EGDIRDIAIE--NASMVVLNFTLQFLEPSE 156 (261)
T ss_dssp ESCTTTCCCC--SEEEEEEESCGGGSCHHH
T ss_pred eccccccccc--ccccceeeeeeeecCchh
Confidence 9999999874 599999999999998654
|
| >3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} | Back alignment and structure |
|---|
| >3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} | Back alignment and structure |
|---|
| >1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 | Back alignment and structure |
|---|
| >2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 | Back alignment and structure |
|---|
| >3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* | Back alignment and structure |
|---|
| >4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} | Back alignment and structure |
|---|
| >1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 | Back alignment and structure |
|---|
| >3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* | Back alignment and structure |
|---|
| >1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* | Back alignment and structure |
|---|
| >3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* | Back alignment and structure |
|---|
| >3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A | Back alignment and structure |
|---|
| >3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A | Back alignment and structure |
|---|
| >3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A | Back alignment and structure |
|---|
| >3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* | Back alignment and structure |
|---|
| >3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* | Back alignment and structure |
|---|
| >3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} | Back alignment and structure |
|---|
| >2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* | Back alignment and structure |
|---|
| >4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A | Back alignment and structure |
|---|
| >3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 | Back alignment and structure |
|---|
| >2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 | Back alignment and structure |
|---|
| >2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A | Back alignment and structure |
|---|
| >3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* | Back alignment and structure |
|---|
| >1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* | Back alignment and structure |
|---|
| >3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* | Back alignment and structure |
|---|
| >2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* | Back alignment and structure |
|---|
| >2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* | Back alignment and structure |
|---|
| >3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} | Back alignment and structure |
|---|
| >3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} | Back alignment and structure |
|---|
| >3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* | Back alignment and structure |
|---|
| >3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* | Back alignment and structure |
|---|
| >3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* | Back alignment and structure |
|---|
| >1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* | Back alignment and structure |
|---|
| >3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 | Back alignment and structure |
|---|
| >1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A | Back alignment and structure |
|---|
| >3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* | Back alignment and structure |
|---|
| >2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* | Back alignment and structure |
|---|
| >2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* | Back alignment and structure |
|---|
| >3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* | Back alignment and structure |
|---|
| >3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* | Back alignment and structure |
|---|
| >3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* | Back alignment and structure |
|---|
| >3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} | Back alignment and structure |
|---|
| >3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} | Back alignment and structure |
|---|
| >3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* | Back alignment and structure |
|---|
| >2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 | Back alignment and structure |
|---|
| >3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} | Back alignment and structure |
|---|
| >1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 | Back alignment and structure |
|---|
| >3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* | Back alignment and structure |
|---|
| >3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} | Back alignment and structure |
|---|
| >1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... | Back alignment and structure |
|---|
| >2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* | Back alignment and structure |
|---|
| >2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} | Back alignment and structure |
|---|
| >2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A | Back alignment and structure |
|---|
| >2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A | Back alignment and structure |
|---|
| >3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* | Back alignment and structure |
|---|
| >2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* | Back alignment and structure |
|---|
| >3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} | Back alignment and structure |
|---|
| >3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} | Back alignment and structure |
|---|
| >3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* | Back alignment and structure |
|---|
| >3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} | Back alignment and structure |
|---|
| >3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} | Back alignment and structure |
|---|
| >3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* | Back alignment and structure |
|---|
| >2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} | Back alignment and structure |
|---|
| >3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 | Back alignment and structure |
|---|
| >2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 | Back alignment and structure |
|---|
| >4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} | Back alignment and structure |
|---|
| >3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 | Back alignment and structure |
|---|
| >3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* | Back alignment and structure |
|---|
| >1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 | Back alignment and structure |
|---|
| >2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} | Back alignment and structure |
|---|
| >3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} | Back alignment and structure |
|---|
| >2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* | Back alignment and structure |
|---|
| >1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 | Back alignment and structure |
|---|
| >3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* | Back alignment and structure |
|---|
| >2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... | Back alignment and structure |
|---|
| >3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* | Back alignment and structure |
|---|
| >1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 | Back alignment and structure |
|---|
| >1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* | Back alignment and structure |
|---|
| >1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* | Back alignment and structure |
|---|
| >1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 | Back alignment and structure |
|---|
| >3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} | Back alignment and structure |
|---|
| >2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} | Back alignment and structure |
|---|
| >3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 | Back alignment and structure |
|---|
| >1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* | Back alignment and structure |
|---|
| >3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* | Back alignment and structure |
|---|
| >3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* | Back alignment and structure |
|---|
| >3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 | Back alignment and structure |
|---|
| >3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* | Back alignment and structure |
|---|
| >2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 | Back alignment and structure |
|---|
| >3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* | Back alignment and structure |
|---|
| >3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} | Back alignment and structure |
|---|
| >3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} | Back alignment and structure |
|---|
| >2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* | Back alignment and structure |
|---|
| >2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* | Back alignment and structure |
|---|
| >3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* | Back alignment and structure |
|---|
| >3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* | Back alignment and structure |
|---|
| >1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 | Back alignment and structure |
|---|
| >3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A* | Back alignment and structure |
|---|
| >2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 | Back alignment and structure |
|---|
| >2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A | Back alignment and structure |
|---|
| >2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* | Back alignment and structure |
|---|
| >1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* | Back alignment and structure |
|---|
| >2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E | Back alignment and structure |
|---|
| >2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} | Back alignment and structure |
|---|
| >1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 | Back alignment and structure |
|---|
| >3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* | Back alignment and structure |
|---|
| >3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* | Back alignment and structure |
|---|
| >2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 | Back alignment and structure |
|---|
| >2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} | Back alignment and structure |
|---|
| >3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* | Back alignment and structure |
|---|
| >1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* | Back alignment and structure |
|---|
| >4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A* | Back alignment and structure |
|---|
| >1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A* | Back alignment and structure |
|---|
| >3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A* | Back alignment and structure |
|---|
| >3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} | Back alignment and structure |
|---|
| >1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* | Back alignment and structure |
|---|
| >1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* | Back alignment and structure |
|---|
| >2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* | Back alignment and structure |
|---|
| >3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} | Back alignment and structure |
|---|
| >3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* | Back alignment and structure |
|---|
| >2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* | Back alignment and structure |
|---|
| >3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} | Back alignment and structure |
|---|
| >2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 | Back alignment and structure |
|---|
| >1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A | Back alignment and structure |
|---|
| >3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A* | Back alignment and structure |
|---|
| >1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 | Back alignment and structure |
|---|
| >2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 | Back alignment and structure |
|---|
| >3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* | Back alignment and structure |
|---|
| >3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} | Back alignment and structure |
|---|
| >1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* | Back alignment and structure |
|---|
| >3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* | Back alignment and structure |
|---|
| >1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A | Back alignment and structure |
|---|
| >2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* | Back alignment and structure |
|---|
| >3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* | Back alignment and structure |
|---|
| >1m6y_A S-adenosyl-methyltransferase MRAW; SAM-dependent methyltransferase fold, protein-cofactor product complex, structural genomics, PSI; HET: SAH; 1.90A {Thermotoga maritima} SCOP: a.60.13.1 c.66.1.23 PDB: 1n2x_A* | Back alignment and structure |
|---|
| >3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A* | Back alignment and structure |
|---|
| >3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, anti resistance, methyltransferase, RNA-binding; 1.44A {Aquifex aeolicus} PDB: 3ftc_A 3fte_A 3ftf_A* 3r9x_B* | Back alignment and structure |
|---|
| >3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} | Back alignment and structure |
|---|
| >2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} | Back alignment and structure |
|---|
| >1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* | Back alignment and structure |
|---|
| >3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* | Back alignment and structure |
|---|
| >1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A | Back alignment and structure |
|---|
| >3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A | Back alignment and structure |
|---|
| >1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* | Back alignment and structure |
|---|
| >1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 | Back alignment and structure |
|---|
| >2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* | Back alignment and structure |
|---|
| >2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A | Back alignment and structure |
|---|
| >3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A | Back alignment and structure |
|---|
| >2r6z_A UPF0341 protein in RSP 3' region; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 1.80A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* | Back alignment and structure |
|---|
| >1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* | Back alignment and structure |
|---|
| >3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* | Back alignment and structure |
|---|
| >3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 | Back alignment and structure |
|---|
| >3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} | Back alignment and structure |
|---|
| >2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* | Back alignment and structure |
|---|
| >2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* | Back alignment and structure |
|---|
| >2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1qyr_A KSGA, high level kasugamycin resistance protein, S-adenosylMet; adenosine dimethyltransferase, rRNA modification, transferase, translation; 2.10A {Escherichia coli} SCOP: c.66.1.24 PDB: 4adv_V 3tpz_A | Back alignment and structure |
|---|
| >3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} | Back alignment and structure |
|---|
| >2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* | Back alignment and structure |
|---|
| >3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* | Back alignment and structure |
|---|
| >3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile} | Back alignment and structure |
|---|
| >2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* | Back alignment and structure |
|---|
| >2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 | Back alignment and structure |
|---|
| >2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans} | Back alignment and structure |
|---|
| >4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* | Back alignment and structure |
|---|
| >3ll7_A Putative methyltransferase; methytransferase, structural genomics, MCSG, PSI-2, protein initiative; HET: MSE; 1.80A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} | Back alignment and structure |
|---|
| >3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24 | Back alignment and structure |
|---|
| >1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* | Back alignment and structure |
|---|
| >3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} | Back alignment and structure |
|---|
| >2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 | Back alignment and structure |
|---|
| >4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* | Back alignment and structure |
|---|
| >3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* | Back alignment and structure |
|---|
| >2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A | Back alignment and structure |
|---|
| >2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 | Back alignment and structure |
|---|
| >3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} | Back alignment and structure |
|---|
| >4gqb_A Protein arginine N-methyltransferase 5; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} PDB: 4g56_A* | Back alignment and structure |
|---|
| >1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A | Back alignment and structure |
|---|
| >2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} | Back alignment and structure |
|---|
| >3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* | Back alignment and structure |
|---|
| >2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 | Back alignment and structure |
|---|
| >2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* | Back alignment and structure |
|---|
| >3ua3_A Protein arginine N-methyltransferase 5; TIM-barrel, rossmann fold, beta-barrel, symmetric arginine dimethylase, SAM binding; HET: SAH; 3.00A {Caenorhabditis elegans} PDB: 3ua4_A | Back alignment and structure |
|---|
| >2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A* | Back alignment and structure |
|---|
| >2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* | Back alignment and structure |
|---|
| >2oyr_A UPF0341 protein YHIQ; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Shigella flexneri 2A} SCOP: c.66.1.55 PDB: 2pgx_A 2pkw_A | Back alignment and structure |
|---|
| >3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A* | Back alignment and structure |
|---|
| >2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A* | Back alignment and structure |
|---|
| >1wg8_A Predicted S-adenosylmethionine-dependent methyltransferase; S-adenosyl-methyltransferase, MRAW; HET: SAM; 2.00A {Thermus thermophilus} SCOP: a.60.13.1 c.66.1.23 | Back alignment and structure |
|---|
| >3lkd_A Type I restriction-modification system methyltransferase subunit; Q5M500_STRT2, STU0711, NESG, SUR80, structural genomics, PSI-2; 2.25A {Streptococcus thermophilus} | Back alignment and structure |
|---|
| >3cvo_A Methyltransferase-like protein of unknown functio; rossman fold, structural genomics, joint center for structur genomics, JCSG; HET: MSE PG4; 1.80A {Silicibacter pomeroyi dss-3} | Back alignment and structure |
|---|
| >3b5i_A S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase-like protein; sabath family, indole-3-acetic acid, S-AD methionine; HET: SAH; 2.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2efj_A 3,7-dimethylxanthine methyltransferase; SAM-dependant methyltransferase, SAH, theobromine; HET: SAH 37T; 2.00A {Coffea canephora} PDB: 2eg5_A* | Back alignment and structure |
|---|
| >2k4m_A TR8_protein, UPF0146 protein MTH_1000; alpha+beta, rossman fold, structural genomics, PSI-2; NMR {Methanothermobacterthermautotrophicus str} | Back alignment and structure |
|---|
| >2ar0_A M.ecoki, type I restriction enzyme ecoki M protein; structural genomics, protein structure initiative, nysgxrc; 2.80A {Escherichia coli} SCOP: c.66.1.45 PDB: 2y7c_B 2y7h_B* | Back alignment and structure |
|---|
| >3khk_A Type I restriction-modification system methylation subunit; structural genomics, PSI-2, protein structure initiative; 2.55A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >1m6e_X S-adenosyl-L-methionnine:salicylic acid carboxyl methyltransferase; rossmann fold, protein-small molecule complex; HET: SAH SAL; 3.00A {Clarkia breweri} SCOP: c.66.1.35 | Back alignment and structure |
|---|
| >4auk_A Ribosomal RNA large subunit methyltransferase M; YGDE; HET: TLA PGE; 1.90A {Escherichia coli} PDB: 4atn_A* 4b17_A* | Back alignment and structure |
|---|
| >2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A | Back alignment and structure |
|---|
| >3o4f_A Spermidine synthase; aminopropyltransferase, polyamine synthase, rossmann fold, P biosynthesis, spermidine biosynthesis, transferase; 2.90A {Escherichia coli} | Back alignment and structure |
|---|
| >3s1s_A Restriction endonuclease bpusi; PD--(D/E)XK catalytic motif, gamma-N6M-adenosine methyltrans S-adenosyl-methionine binding, hydrolase; HET: SAH; 2.35A {Bacillus pumilus} | Back alignment and structure |
|---|
| >3evf_A RNA-directed RNA polymerase NS5; NS5 methyltransferase, RNA CAP binding, binding, capsid protein; HET: GTA SAH; 1.45A {Yellow fever virus} SCOP: c.66.1.0 PDB: 3evb_A* 3evc_A* 3evd_A* 3eve_A* 3eva_A* | Back alignment and structure |
|---|
| >3gcz_A Polyprotein; flavivirus, RNA capping, methyltransferase, viral enzyme STR ATP-binding, nucleotide-binding, RNA replication, structura genomics; HET: SAM; 1.70A {Yokose virus} | Back alignment and structure |
|---|
| >3tka_A Ribosomal RNA small subunit methyltransferase H; HET: SAM CTN PG4; 2.25A {Escherichia coli} | Back alignment and structure |
|---|
| >2wk1_A NOVP; transferase, O-methyltransferase, novobiocin, TYLF superfamily; HET: SAH; 1.40A {Streptomyces caeruleus} | Back alignment and structure |
|---|
| >1g60_A Adenine-specific methyltransferase MBOIIA; structural genomics, DNA methylation, S- adenosylmethionine, PSI, protein structure initiative; HET: SAM; 1.74A {Moraxella bovis} SCOP: c.66.1.11 | Back alignment and structure |
|---|
| >3ufb_A Type I restriction-modification system methyltran subunit; methyltransferase activity, transferase; 1.80A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >4fzv_A Putative methyltransferase NSUN4; mterf fold, methyltransferase fold, rRNA methyltransferase, mitochondria, transferase; HET: MSE SAM; 2.00A {Homo sapiens} PDB: 4fp9_A* | Back alignment and structure |
|---|
| >3p8z_A Mtase, non-structural protein 5; methyltransferase, RNA, ER, transferase-transferase inhibito; HET: 36A SAH; 1.70A {Dengue virus 3} SCOP: c.66.1.25 PDB: 3p97_A* 2xbm_A* 3evg_A* | Back alignment and structure |
|---|
| >2qy6_A UPF0209 protein YFCK; structural genomics, unknown function, PSI-2, protein struct initiative; 2.00A {Escherichia coli} | Back alignment and structure |
|---|
| >1i4w_A Mitochondrial replication protein MTF1; mitochondrial transcription factor, transcription initiation; 2.60A {Saccharomyces cerevisiae} SCOP: c.66.1.24 | Back alignment and structure |
|---|
| >3lkz_A Non-structural protein 5; flavivirus, methyltransferase, inhibitor, P nucleotide-binding, RNA replication, viral protein; HET: SFG; 2.00A {West nile virus} | Back alignment and structure |
|---|
| >3c6k_A Spermine synthase; spermidine aminopropyltransferase, SPMSY, structural genomics, structural genomics consortium, SGC, phosphoprotein; HET: SPD MTA; 1.95A {Homo sapiens} PDB: 3c6m_A* | Back alignment and structure |
|---|
| >3eld_A Methyltransferase; flavivirus, RNA capping, guanylyltransfer viral enzyme structure; HET: SFG; 1.90A {Wesselsbron virus} PDB: 3elu_A* 3elw_A* 3ely_A* 3emb_A* 3emd_A* | Back alignment and structure |
|---|
| >2px2_A Genome polyprotein [contains: capsid protein C (core protein); envelope protein M...; methyltransferase, SAH; HET: SAH; 2.00A {Murray valley encephalitis virus} PDB: 2px4_A* 2px5_A* 2pxa_A* 2pxc_A* 2px8_A* 2oy0_A* | Back alignment and structure |
|---|
| >1g55_A DNA cytosine methyltransferase DNMT2; human DNA methyltransferase homologue; HET: DNA SAH; 1.80A {Homo sapiens} SCOP: c.66.1.26 | Back alignment and structure |
|---|
| >3g7u_A Cytosine-specific methyltransferase; DNA-binding, NAD-binding, structural GENO protein structure initiative, PSI; 1.75A {Escherichia coli O157} | Back alignment and structure |
|---|
| >1zkd_A DUF185; NESG, RPR58, structural genomics, PSI, protein structure INI northeast structural genomics consortium, unknown function; 2.10A {Rhodopseudomonas palustris} SCOP: c.66.1.52 | Back alignment and structure |
|---|
| >2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* | Back alignment and structure |
|---|
| >2py6_A Methyltransferase FKBM; YP_546752.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.15A {Methylobacillus flagellatus KT} SCOP: c.66.1.56 | Back alignment and structure |
|---|
| >1boo_A Protein (N-4 cytosine-specific methyltransferase PVU II); type II DNA-(cytosine N4) methyltransferase, amino methylation, selenomethionine; HET: SAH; 2.80A {Proteus vulgaris} SCOP: c.66.1.11 | Back alignment and structure |
|---|
| >2c7p_A Modification methylase HHAI; DNA methyltransferase, methyltransferase, base flipping, restriction system, transferase; HET: 5CM A1P SAH EPE CIT; 1.7A {Haemophilus haemolyticus} SCOP: c.66.1.26 PDB: 10mh_A* 1m0e_A* 1mht_A* 1hmy_A* 1skm_A* 2c7o_A* 2c7q_A* 2hmy_B* 2hr1_A* 3eeo_A* 3mht_A* 4mht_A* 5mht_A* 6mht_A* 7mht_A* 8mht_A* 9mht_A* 2zcj_A* 2z6u_A* 2z6q_A* ... | Back alignment and structure |
|---|
| >4f3n_A Uncharacterized ACR, COG1565 superfamily; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.75A {Burkholderia thailandensis} PDB: 4g67_A* | Back alignment and structure |
|---|
| >1rjd_A PPM1P, carboxy methyl transferase for protein phosphatase 2A catalytic subunit; SAM dependent methyltransferase; HET: SAM; 1.80A {Saccharomyces cerevisiae} SCOP: c.66.1.37 PDB: 1rje_A* 1rjf_A 1rjg_A* 2ob2_A* 2ob1_A | Back alignment and structure |
|---|
| >1eg2_A Modification methylase RSRI; rossmann fold, exocyclic amino DNA methyltransferase RSRI, D binding, DNA modification, DNA methylation; HET: MTA; 1.75A {Rhodobacter sphaeroides} SCOP: c.66.1.11 PDB: 1nw5_A* 1nw6_A* 1nw7_A* 1nw8_A | Back alignment and structure |
|---|
| >3qv2_A 5-cytosine DNA methyltransferase; DNMT2, ehmeth; HET: SAH; 2.15A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >4h0n_A DNMT2; SAH binding, transferase; HET: SAH; 2.71A {Spodoptera frugiperda} | Back alignment and structure |
|---|
| >3r24_A NSP16, 2'-O-methyl transferase; methyltransferase, zinc-finger, transferase, viral protein; HET: SAM; 2.00A {Sars coronavirus} | Back alignment and structure |
|---|
| >2qrv_A DNA (cytosine-5)-methyltransferase 3A; DNA methyltransferase 3A (DNMT3A) and ITS regulatory factor; HET: DNA SAH; 2.89A {Homo sapiens} | Back alignment and structure |
|---|
| >2uyo_A Hypothetical protein ML2640; putative methyltransferase, transferas; 1.7A {Mycobacterium leprae} SCOP: c.66.1.57 PDB: 2ckd_A 2uyq_A* | Back alignment and structure |
|---|
| >3ubt_Y Modification methylase HAEIII; protein-DNA complex, DNA cytosine-5 methyltransferase, DNA B S-adenosyl methionine binding; HET: ATP 2PE; 2.50A {Haemophilus aegyptius} PDB: 1dct_A* | Back alignment and structure |
|---|
| >2oo3_A Protein involved in catabolism of external DNA; structural genomics, unknown function, PSI-2, protein structure initiative; 2.00A {Legionella pneumophila subsp} SCOP: c.66.1.59 | Back alignment and structure |
|---|
| >3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} | Back alignment and structure |
|---|
| >3me5_A Cytosine-specific methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.75A {Shigella flexneri 2A} PDB: 3lx6_A | Back alignment and structure |
|---|
| >3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A | Back alignment and structure |
|---|
| >3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} | Back alignment and structure |
|---|
| >2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* | Back alignment and structure |
|---|
| >1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 | Back alignment and structure |
|---|
| >3iht_A S-adenosyl-L-methionine methyl transferase; YP_165822.1, STR genomics, joint center for structural genomics, JCSG; HET: MSE SAM; 1.80A {Ruegeria pomeroyi dss-3} | Back alignment and structure |
|---|
| >3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* | Back alignment and structure |
|---|
| >3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A | Back alignment and structure |
|---|
| >4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* | Back alignment and structure |
|---|
| >3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* | Back alignment and structure |
|---|
| >3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} | Back alignment and structure |
|---|
| >1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A | Back alignment and structure |
|---|
| >3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} | Back alignment and structure |
|---|
| >4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* | Back alignment and structure |
|---|
| >4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} | Back alignment and structure |
|---|
| >3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* | Back alignment and structure |
|---|
| >4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* | Back alignment and structure |
|---|
| >3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} | Back alignment and structure |
|---|
| >1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A | Back alignment and structure |
|---|
| >4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A | Back alignment and structure |
|---|
| >3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 217 | ||||
| d1xvaa_ | 292 | c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Ra | 4e-09 | |
| d1ri5a_ | 252 | c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransf | 2e-06 | |
| d1p91a_ | 268 | c.66.1.33 (A:) rRNA methyltransferase RlmA {Escher | 3e-06 | |
| d1wzna1 | 251 | c.66.1.43 (A:1-251) Hypothetical methyltransferase | 7e-06 | |
| d1jqea_ | 280 | c.66.1.19 (A:) Histamine methyltransferase {Human | 2e-04 | |
| d1pjza_ | 201 | c.66.1.36 (A:) Thiopurine S-methyltransferase {Pse | 5e-04 | |
| d1l3ia_ | 186 | c.66.1.22 (A:) Precorrin-6Y methyltransferase (Cbi | 6e-04 | |
| d1vl5a_ | 231 | c.66.1.41 (A:) Hypothetical protein BH2331 {Bacill | 7e-04 | |
| d2p7ia1 | 225 | c.66.1.41 (A:22-246) Hypothetical protein ECA1738 | 8e-04 | |
| d1y8ca_ | 246 | c.66.1.43 (A:) Putative methyltransferase CAC2371 | 8e-04 | |
| d1yzha1 | 204 | c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltra | 0.001 | |
| d1g6q1_ | 328 | c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Ba | 0.001 | |
| d1nw3a_ | 328 | c.66.1.31 (A:) Catalytic, N-terminal domain of his | 0.002 | |
| d2fyta1 | 311 | c.66.1.6 (A:238-548) Protein arginine N-methyltran | 0.003 | |
| d2fcaa1 | 204 | c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltr | 0.004 | |
| d1xxla_ | 234 | c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus | 0.004 | |
| d2a14a1 | 257 | c.66.1.15 (A:5-261) Indolethylamine N-methyltransf | 0.004 |
| >d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 292 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: S-adenosyl-L-methionine-dependent methyltransferases superfamily: S-adenosyl-L-methionine-dependent methyltransferases family: Glycine N-methyltransferase domain: Glycine N-methyltransferase species: Rat (Rattus norvegicus) [TaxId: 10116]
Score = 53.0 bits (126), Expect = 4e-09
Identities = 28/134 (20%), Positives = 43/134 (32%), Gaps = 9/134 (6%)
Query: 89 PDWY-EEFYASVMNSSMKSYEAEVAGYKSQLFDNLRGK-AKKVLEIGIGTGPNLKYYAAD 146
PD Y + A V + + A YK+ L LR +VL++ GTG + +
Sbjct: 18 PDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCHRVLDVACGTGVDSIML-VE 76
Query: 147 TDVQVLGVDPNRKMEKYAQTAAVAAGLPLTNFKFLQAVGEA------IPVSDASVDAVVG 200
V VD + KM KYA K++ +P D +
Sbjct: 77 EGFSVTSVDASDKMLKYALKERWNRRKEPAFDKWVIEEANWLTLDKDVPAGDGFDAVICL 136
Query: 201 TLVLCSVKDVDMTL 214
+ D
Sbjct: 137 GNSFAHLPDSKGDQ 150
|
| >d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Length = 252 | Back information, alignment and structure |
|---|
| >d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Length = 268 | Back information, alignment and structure |
|---|
| >d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 251 | Back information, alignment and structure |
|---|
| >d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 280 | Back information, alignment and structure |
|---|
| >d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Length = 201 | Back information, alignment and structure |
|---|
| >d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 186 | Back information, alignment and structure |
|---|
| >d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Length = 231 | Back information, alignment and structure |
|---|
| >d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Length = 225 | Back information, alignment and structure |
|---|
| >d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Length = 246 | Back information, alignment and structure |
|---|
| >d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Length = 204 | Back information, alignment and structure |
|---|
| >d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 328 | Back information, alignment and structure |
|---|
| >d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Length = 328 | Back information, alignment and structure |
|---|
| >d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Length = 311 | Back information, alignment and structure |
|---|
| >d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Length = 204 | Back information, alignment and structure |
|---|
| >d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Length = 234 | Back information, alignment and structure |
|---|
| >d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Length = 257 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 217 | |||
| d1p91a_ | 268 | rRNA methyltransferase RlmA {Escherichia coli [Tax | 99.87 | |
| d1xxla_ | 234 | Hypothetical protein YcgJ {Bacillus subtilis [TaxI | 99.83 | |
| d1vl5a_ | 231 | Hypothetical protein BH2331 {Bacillus halodurans [ | 99.83 | |
| d2o57a1 | 282 | Putative sarcosine dimethylglycine methyltransfera | 99.81 | |
| d1ve3a1 | 226 | Hypothetical protein PH0226 {Archaeon Pyrococcus h | 99.8 | |
| d1nkva_ | 245 | Hypothetical Protein YjhP {Escherichia coli [TaxId | 99.78 | |
| d2avna1 | 246 | Hypothetical methyltransferase TM1389 {Thermotoga | 99.77 | |
| d2ex4a1 | 222 | Adrenal gland protein AD-003 (C9orf32) {Human (Hom | 99.75 | |
| d1vlma_ | 208 | Possible histamine N-methyltransferase TM1293 {The | 99.75 | |
| d1wzna1 | 251 | Hypothetical methyltransferase PH1305 {Archaeon Py | 99.74 | |
| d1im8a_ | 225 | Hypothetical protein HI0319 (YecO) {Haemophilus in | 99.72 | |
| d1y8ca_ | 246 | Putative methyltransferase CAC2371 {Clostridium ac | 99.71 | |
| d1ri5a_ | 252 | mRNA cap (Guanine N-7) methyltransferase {Fungus ( | 99.69 | |
| d2gh1a1 | 281 | Methyltransferase BC2162 {Bacillus cereus [TaxId: | 99.69 | |
| d2p7ia1 | 225 | Hypothetical protein ECA1738 {Erwinia carotovora [ | 99.68 | |
| d2i6ga1 | 198 | Putative methyltransferase TehB {Salmonella typhim | 99.68 | |
| d1xtpa_ | 254 | Hypothetical protein Lmaj004091aaa (LmjF30.0810) { | 99.68 | |
| d2fk8a1 | 280 | Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri | 99.63 | |
| d1l3ia_ | 186 | Precorrin-6Y methyltransferase (CbiT) {Archaeon Me | 99.62 | |
| d1kpia_ | 291 | CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} | 99.6 | |
| d1kpga_ | 285 | CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} | 99.6 | |
| d1pjza_ | 201 | Thiopurine S-methyltransferase {Pseudomonas syring | 99.58 | |
| d1dl5a1 | 213 | Protein-L-isoaspartyl O-methyltransferase {Thermot | 99.57 | |
| d2bzga1 | 229 | Thiopurine S-methyltransferase {Human (Homo sapien | 99.55 | |
| d1dusa_ | 194 | Hypothetical protein MJ0882 {Archaeon Methanococcu | 99.54 | |
| d1zx0a1 | 229 | Guanidinoacetate methyltransferase {Human (Homo sa | 99.53 | |
| d1jqea_ | 280 | Histamine methyltransferase {Human (Homo sapiens) | 99.49 | |
| d1xvaa_ | 292 | Glycine N-methyltransferase {Rat (Rattus norvegicu | 99.48 | |
| d1i9ga_ | 264 | Probable methyltransferase Rv2118c {Mycobacterium | 99.47 | |
| d1g6q1_ | 328 | Arginine methyltransferase, HMT1 {Baker's yeast (S | 99.46 | |
| d1i1na_ | 224 | Protein-L-isoaspartyl O-methyltransferase {Human ( | 99.45 | |
| d2nxca1 | 254 | PrmA-like protein TTHA0656 (TT0836) {Thermus therm | 99.44 | |
| d2a14a1 | 257 | Indolethylamine N-methyltransferase, INMT {Human ( | 99.44 | |
| d1tw3a2 | 253 | Carminomycin 4-O-methyltransferase {Streptomyces p | 99.44 | |
| d2fyta1 | 311 | Protein arginine N-methyltransferase 3, PRMT3 {Hum | 99.43 | |
| d2fcaa1 | 204 | tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil | 99.43 | |
| d1oria_ | 316 | Protein arginine N-methyltransferase 1, PRMT1 {Rat | 99.41 | |
| d1nw3a_ | 328 | Catalytic, N-terminal domain of histone methyltran | 99.39 | |
| d1yb2a1 | 250 | Hypothetical protein Ta0852 {Thermoplasma acidophi | 99.38 | |
| d1nt2a_ | 209 | Fibrillarin homologue {Archaeon Archaeoglobus fulg | 99.36 | |
| d1jg1a_ | 215 | Protein-L-isoaspartyl O-methyltransferase {Archaeo | 99.36 | |
| d1vbfa_ | 224 | Protein-L-isoaspartyl O-methyltransferase {Sulfolo | 99.36 | |
| d1g8sa_ | 230 | Fibrillarin homologue {Archaeon Methanococcus jann | 99.36 | |
| d1yzha1 | 204 | tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep | 99.35 | |
| d1ne2a_ | 197 | Hypothetical protein Ta1320 {Archaeon Thermoplasma | 99.35 | |
| d2b3ta1 | 274 | N5-glutamine methyltransferase, HemK {Escherichia | 99.34 | |
| d1qzza2 | 256 | Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu | 99.33 | |
| d2g72a1 | 263 | Phenylethanolamine N-methyltransferase, PNMTase {H | 99.32 | |
| d1wy7a1 | 201 | Hypothetical protein PH1948 {Archaeon Pyrococcus h | 99.29 | |
| d1o54a_ | 266 | Hypothetical protein TM0748 {Thermotoga maritima [ | 99.29 | |
| d2esra1 | 152 | Putative methyltransferase SPy1538 {Streptococcus | 99.26 | |
| d2b25a1 | 324 | Hypothetical protein FLJ20628 {Human (Homo sapiens | 99.22 | |
| d2frna1 | 260 | Hypothetical protein PH0793 {Pyrococcus horikoshii | 99.21 | |
| d1r18a_ | 223 | Protein-L-isoaspartyl O-methyltransferase {Fruit f | 99.17 | |
| d1g8aa_ | 227 | Fibrillarin homologue {Archaeon Pyrococcus horikos | 99.14 | |
| d2h00a1 | 250 | Methyltransferase 10 domain containing protein MET | 99.11 | |
| d2as0a2 | 324 | Hypothetical protein PH1915, middle and C-terminal | 99.07 | |
| d1ws6a1 | 171 | Methyltransferase TTHA0928 {Thermus thermophilus [ | 98.99 | |
| d1wxxa2 | 318 | Hypothetical protein TTHA1280, middle and C-termin | 98.97 | |
| d1u2za_ | 406 | Catalytic, N-terminal domain of histone methyltran | 98.96 | |
| d2igta1 | 309 | Putative methyltransferase Atu0340 {Agrobacterium | 98.96 | |
| d2fpoa1 | 183 | Methylase YhhF {Escherichia coli [TaxId: 562]} | 98.96 | |
| d1nv8a_ | 271 | N5-glutamine methyltransferase, HemK {Thermotoga m | 98.96 | |
| d2cl5a1 | 214 | Catechol O-methyltransferase, COMT {Rat (Rattus no | 98.92 | |
| d1m6ya2 | 192 | TM0872, methyltransferase domain {Thermotoga marit | 98.92 | |
| d2b78a2 | 317 | Hypothetical protein SMu776, middle and C-terminal | 98.89 | |
| d1qama_ | 235 | rRNA adenine dimethylase {Bacillus subtilis, Ermc' | 98.89 | |
| d2fhpa1 | 182 | Putative methylase EF2452 {Enterococcus faecalis [ | 98.87 | |
| d2avda1 | 219 | COMT domain-containing protein 1, COMTD1 {Human (H | 98.8 | |
| d1yuba_ | 245 | rRNA adenine dimethylase {Streptococcus pneumoniae | 98.76 | |
| d1uwva2 | 358 | rRNA (Uracil-5-)-methyltransferase RumA, catalytic | 98.74 | |
| d1susa1 | 227 | Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag | 98.61 | |
| d1fp1d2 | 244 | Chalcone O-methyltransferase {Alfalfa (Medicago sa | 98.59 | |
| d2ifta1 | 183 | Putative methylase HI0767 {Haemophilus influenzae | 98.54 | |
| d1fp2a2 | 244 | Isoflavone O-methyltransferase {Alfalfa (Medicago | 98.53 | |
| d1jsxa_ | 207 | Glucose-inhibited division protein B (GidB) {Esche | 98.49 | |
| d1zq9a1 | 278 | Probable dimethyladenosine transferase {Human (Hom | 98.47 | |
| d1qyra_ | 252 | High level kasugamycin resistance protein KsgA {Es | 98.35 | |
| d1af7a2 | 193 | Chemotaxis receptor methyltransferase CheR, C-term | 98.29 | |
| d2f8la1 | 328 | Hypothetical protein Lmo1582 {Listeria monocytogen | 98.28 | |
| d1kyza2 | 243 | Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra | 98.14 | |
| d1mjfa_ | 276 | Putative spermidine synthetase PF0127 (SpeE) {Arch | 98.11 | |
| d1wg8a2 | 182 | TM0872, methyltransferase domain {Thermus thermoph | 97.98 | |
| d2ih2a1 | 223 | DNA methylase TaqI, N-terminal domain {Thermus aqu | 97.97 | |
| d1uira_ | 312 | Spermidine synthase {Thermus thermophilus [TaxId: | 97.97 | |
| d1xdza_ | 239 | Glucose-inhibited division protein B (GidB) {Bacil | 97.86 | |
| d2b9ea1 | 293 | NOL1R {Human (Homo sapiens) [TaxId: 9606]} | 97.85 | |
| d1inla_ | 295 | Spermidine synthase {Thermotoga maritima [TaxId: 2 | 97.81 | |
| d1iy9a_ | 274 | Spermidine synthase {Bacillus subtilis [TaxId: 142 | 97.8 | |
| d2b2ca1 | 312 | Spermidine synthase {Caenorhabditis elegans [TaxId | 97.68 | |
| d2o07a1 | 285 | Spermidine synthase {Human (Homo sapiens) [TaxId: | 97.67 | |
| d1ixka_ | 313 | Hypothetical methyltransferase PH1374 {Archaeon Py | 97.65 | |
| d1xj5a_ | 290 | Spermidine synthase {Thale cress (Arabidopsis thal | 97.64 | |
| d2okca1 | 425 | Type I restriction enzyme StySJI M protein {Bacter | 97.59 | |
| d1ej0a_ | 180 | RNA methyltransferase FtsJ {Escherichia coli [TaxI | 97.4 | |
| d2bm8a1 | 232 | Cephalosporin hydroxylase CmcI {Streptomyces clavu | 97.35 | |
| d2dula1 | 375 | N(2),N(2)-dimethylguanosine tRNA methyltransferase | 97.31 | |
| d1sqga2 | 284 | Ribosomal RNA small subunit methyltransferase B, R | 97.2 | |
| d1i4wa_ | 322 | Transcription factor sc-mtTFB {Baker's yeast (Sacc | 96.78 | |
| d2oyra1 | 250 | Hypothetical protein YhiQ {Shigella flexneri [TaxI | 96.71 | |
| d1g60a_ | 256 | Methyltransferase mboII {Moraxella bovis [TaxId: 4 | 96.25 | |
| d2ar0a1 | 524 | M.EcoKI {Escherichia coli [TaxId: 562]} | 96.16 | |
| d1zkda1 | 365 | Hypothetical protein RPA4359 {Rhodopseudomonas pal | 95.97 | |
| d1m6ex_ | 359 | Salicylic acid carboxyl methyltransferase (SAMT) { | 95.95 | |
| d1booa_ | 320 | m.PvuII N4 cytosine-specific DNA methyltransferase | 95.9 | |
| d1eg2a_ | 279 | m.RsrI N6 adenosine-specific DNA methyltransferase | 95.49 | |
| d1piwa2 | 168 | Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas | 95.28 | |
| d2p41a1 | 257 | An RNA cap (nucleoside-2'-O-)-methyltransferase do | 94.36 | |
| d1lssa_ | 132 | Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax | 93.99 | |
| d1jqba2 | 174 | Bacterial secondary alcohol dehydrogenase {Clostri | 93.0 | |
| d1kola2 | 195 | Formaldehyde dehydrogenase {Pseudomonas putida [Ta | 92.69 | |
| d1o9ga_ | 249 | rRNA methyltransferase AviRa {Streptomyces viridoc | 92.6 | |
| d1e3ja2 | 170 | Ketose reductase (sorbitol dehydrogenase) {Silverl | 92.36 | |
| d1dcta_ | 324 | DNA methylase HaeIII {Haemophilus aegyptius [TaxId | 92.32 | |
| d1g55a_ | 343 | DNMT2 {Human (Homo sapiens) [TaxId: 9606]} | 92.25 | |
| d1xg5a_ | 257 | Putative dehydrogenase ARPG836 (MGC4172) {Human (H | 92.16 | |
| d2py6a1 | 395 | Methyltransferase FkbM {Methylobacillus flagellatu | 91.43 | |
| d1pjca1 | 168 | L-alanine dehydrogenase {Phormidium lapideum [TaxI | 90.72 | |
| d1yb5a2 | 174 | Quinone oxidoreductase {Human (Homo sapiens) [TaxI | 90.61 | |
| d1yb1a_ | 244 | 17-beta-hydroxysteroid dehydrogenase type XI {Huma | 90.61 | |
| d1ae1a_ | 258 | Tropinone reductase {Jimsonweed (Datura stramonium | 90.52 | |
| d2c7pa1 | 327 | DNA methylase HhaI {Haemophilus haemolyticus [TaxI | 90.51 | |
| d1f8fa2 | 174 | Benzyl alcohol dehydrogenase {Acinetobacter calcoa | 90.45 | |
| d1vj0a2 | 182 | Hypothetical protein TM0436 {Thermotoga maritima [ | 90.27 | |
| d2c07a1 | 251 | beta-keto acyl carrier protein reductase {Malaria | 89.78 | |
| d2hmva1 | 134 | Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | 88.75 | |
| d1xkqa_ | 272 | Hypothetical protein R05D8.7 {Caenorhabditis elega | 88.34 | |
| d2ae2a_ | 259 | Tropinone reductase {Jimsonweed (Datura stramonium | 87.79 | |
| d2gdza1 | 254 | 15-hydroxyprostaglandin dehydrogenase, PGDH {Human | 87.69 | |
| d1llua2 | 166 | Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax | 87.39 | |
| d1uufa2 | 168 | Hypothetical protein YahK {Escherichia coli [TaxId | 87.14 | |
| d1pr9a_ | 244 | Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 | 86.99 | |
| d1i24a_ | 393 | Sulfolipid biosynthesis protein SQD1 {Thale cress | 86.61 | |
| d1iy8a_ | 258 | Levodione reductase {Corynebacterium aquaticum [Ta | 85.29 | |
| d1fmca_ | 255 | 7-alpha-hydroxysteroid dehydrogenase {Escherichia | 85.22 | |
| d2g5ca2 | 171 | Prephenate dehydrogenase TyrA {Aquifex aeolicus [T | 85.15 | |
| d1zema1 | 260 | Xylitol dehydrogenase {Gluconobacter oxydans [TaxI | 84.75 | |
| d1udca_ | 338 | Uridine diphosphogalactose-4-epimerase (UDP-galact | 84.4 | |
| d1gega_ | 255 | meso-2,3-butanediol dehydrogenase {Klebsiella pneu | 84.3 | |
| d2f1ka2 | 165 | Prephenate dehydrogenase TyrA {Synechocystis sp. p | 84.05 | |
| d1spxa_ | 264 | Glucose dehydrogenase (5l265) {Nematode (Caenorhab | 83.79 | |
| d1xhla_ | 274 | Hypothetical protein F25D1.5 {Caenorhabditis elega | 83.7 | |
| d1jvba2 | 170 | Alcohol dehydrogenase {Archaeon Sulfolobus solfata | 83.6 | |
| d1d1ta2 | 176 | Alcohol dehydrogenase {Human (Homo sapiens), diffe | 83.19 | |
| d1pl8a2 | 171 | Ketose reductase (sorbitol dehydrogenase) {Human ( | 83.05 | |
| d1e3ia2 | 174 | Alcohol dehydrogenase {Mouse (Mus musculus), class | 83.04 | |
| d2rhca1 | 257 | beta-keto acyl carrier protein reductase {Streptom | 82.11 | |
| d1wmaa1 | 275 | Carbonyl reductase/20beta-hydroxysteroid dehydroge | 82.08 | |
| d1orra_ | 338 | CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: | 81.74 | |
| d1cyda_ | 242 | Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 | 81.31 | |
| d1luaa1 | 191 | Methylene-tetrahydromethanopterin dehydrogenase {M | 81.28 | |
| d1h2ba2 | 172 | Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ | 80.91 | |
| d1qora2 | 179 | Quinone oxidoreductase {Escherichia coli [TaxId: 5 | 80.72 | |
| d1rjwa2 | 168 | Alcohol dehydrogenase {Bacillus stearothermophilus | 80.55 | |
| d2bgka1 | 268 | Rhizome secoisolariciresinol dehydrogenase {Mayapp | 80.04 |
| >d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: S-adenosyl-L-methionine-dependent methyltransferases superfamily: S-adenosyl-L-methionine-dependent methyltransferases family: rRNA methyltransferase RlmA domain: rRNA methyltransferase RlmA species: Escherichia coli [TaxId: 562]
Probab=99.87 E-value=6.1e-22 Score=158.25 Aligned_cols=149 Identities=24% Similarity=0.417 Sum_probs=112.8
Q ss_pred ccccCCchhhhhhhc--ccccccccCCCCCCCCCCCCchHHhhhcCCCchhhHHHHHHHHhhhhhHHHHHHHHHHHHHHH
Q 027860 42 SCCCGSRRHFIQGAS--TALFPLVYSSTPSSASSPSDSMAMLNRLHPPRPDWYEEFYASVMNSSMKSYEAEVAGYKSQLF 119 (217)
Q Consensus 42 ~c~C~~~~~f~~a~~--~~l~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 119 (217)
...|.++|+|+.+++ ++++|. +.+....+.+..++..+.+ .| +.. ..|..........+.
T Consensus 17 ~l~C~~~h~fd~~~~Gy~~ll~~----~~~~~~~~~~~~~~~~ar~----~~--------l~~--g~~~~l~~~~~~~l~ 78 (268)
T d1p91a_ 17 SYICPQRHQFDMAKEGYVNLLPV----QHKRSRDPGDSAEMMQARR----AF--------LDA--GHYQPLRDAIVAQLR 78 (268)
T ss_dssp EEECTTCCEEEBCTTSCEECSCS----SSSCSCCCSSSHHHHHHHH----HH--------HTT--TTTHHHHHHHHHHHH
T ss_pred eEECCCCCccccccCceEecccc----cccccCCCCCCHHHHHHHH----HH--------HHc--CchHHHHHHHHHHHH
Confidence 467899999999987 777777 6666666667666654421 11 111 112221223334444
Q ss_pred HHhcCCCCeEEEECCCCCcchHHhhh-CCCCeEEEEcCCHHHHHHHHHHHHHcCCCCCCeEEEeccccccCCCCCcccEE
Q 027860 120 DNLRGKAKKVLEIGIGTGPNLKYYAA-DTDVQVLGVDPNRKMEKYAQTAAVAAGLPLTNFKFLQAVGEAIPVSDASVDAV 198 (217)
Q Consensus 120 ~~l~~~~~~VLDiGcG~G~~~~~la~-~~~~~v~giD~S~~~l~~a~~~~~~~~~~~~~i~~~~~d~~~lp~~~~sfD~V 198 (217)
..+..++.+|||||||+|.++..+++ .++..++|+|+|+.|++.|+++. +++.|+++|+.++|+++++||+|
T Consensus 79 ~~~~~~~~~iLDiGcG~G~~~~~l~~~~~~~~~~giD~s~~~~~~a~~~~-------~~~~~~~~d~~~l~~~~~sfD~v 151 (268)
T d1p91a_ 79 ERLDDKATAVLDIGCGEGYYTHAFADALPEITTFGLDVSKVAIKAAAKRY-------PQVTFCVASSHRLPFSDTSMDAI 151 (268)
T ss_dssp HHSCTTCCEEEEETCTTSTTHHHHHHTCTTSEEEEEESCHHHHHHHHHHC-------TTSEEEECCTTSCSBCTTCEEEE
T ss_pred HhcCCCCCEEEEeCCCCcHHHHHHHHHCCCCEEEEecchHhhhhhhhccc-------ccccceeeehhhccCCCCCEEEE
Confidence 55556788999999999999999986 45779999999999999998763 57899999999999999999999
Q ss_pred EeccccccccChhhhcc
Q 027860 199 VGTLVLCSVKDVDMTLQ 215 (217)
Q Consensus 199 i~~~~l~~~~d~~~~L~ 215 (217)
++.++++|+.+..++|+
T Consensus 152 ~~~~~~~~~~e~~rvLk 168 (268)
T d1p91a_ 152 IRIYAPCKAEELARVVK 168 (268)
T ss_dssp EEESCCCCHHHHHHHEE
T ss_pred eecCCHHHHHHHHHHhC
Confidence 99999999988877775
|
| >d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} | Back information, alignment and structure |
|---|
| >d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} | Back information, alignment and structure |
|---|
| >d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} | Back information, alignment and structure |
|---|
| >d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} | Back information, alignment and structure |
|---|
| >d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} | Back information, alignment and structure |
|---|
| >d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} | Back information, alignment and structure |
|---|
| >d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} | Back information, alignment and structure |
|---|
| >d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} | Back information, alignment and structure |
|---|
| >d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yuba_ c.66.1.24 (A:) rRNA adenine dimethylase {Streptococcus pneumoniae, Ermam [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d1jsxa_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zq9a1 c.66.1.24 (A:36-313) Probable dimethyladenosine transferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qyra_ c.66.1.24 (A:) High level kasugamycin resistance protein KsgA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1af7a2 c.66.1.8 (A:92-284) Chemotaxis receptor methyltransferase CheR, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1xdza_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2okca1 c.66.1.45 (A:9-433) Type I restriction enzyme StySJI M protein {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1ej0a_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bm8a1 c.66.1.50 (A:2-233) Cephalosporin hydroxylase CmcI {Streptomyces clavuligerus [TaxId: 1901]} | Back information, alignment and structure |
|---|
| >d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1i4wa_ c.66.1.24 (A:) Transcription factor sc-mtTFB {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2oyra1 c.66.1.55 (A:1-250) Hypothetical protein YhiQ {Shigella flexneri [TaxId: 623]} | Back information, alignment and structure |
|---|
| >d1g60a_ c.66.1.11 (A:) Methyltransferase mboII {Moraxella bovis [TaxId: 476]} | Back information, alignment and structure |
|---|
| >d2ar0a1 c.66.1.45 (A:6-529) M.EcoKI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zkda1 c.66.1.52 (A:2-366) Hypothetical protein RPA4359 {Rhodopseudomonas palustris [TaxId: 1076]} | Back information, alignment and structure |
|---|
| >d1m6ex_ c.66.1.35 (X:) Salicylic acid carboxyl methyltransferase (SAMT) {Clarkia breweri [TaxId: 36903]} | Back information, alignment and structure |
|---|
| >d1booa_ c.66.1.11 (A:) m.PvuII N4 cytosine-specific DNA methyltransferase {Proteus vulgaris [TaxId: 585]} | Back information, alignment and structure |
|---|
| >d1eg2a_ c.66.1.11 (A:) m.RsrI N6 adenosine-specific DNA methyltransferase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2p41a1 c.66.1.25 (A:8-264) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Dengue virus 2 [TaxId: 11060]} | Back information, alignment and structure |
|---|
| >d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} | Back information, alignment and structure |
|---|
| >d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1o9ga_ c.66.1.29 (A:) rRNA methyltransferase AviRa {Streptomyces viridochromogenes [TaxId: 1938]} | Back information, alignment and structure |
|---|
| >d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} | Back information, alignment and structure |
|---|
| >d1dcta_ c.66.1.26 (A:) DNA methylase HaeIII {Haemophilus aegyptius [TaxId: 197575]} | Back information, alignment and structure |
|---|
| >d1g55a_ c.66.1.26 (A:) DNMT2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2py6a1 c.66.1.56 (A:14-408) Methyltransferase FkbM {Methylobacillus flagellatus [TaxId: 405]} | Back information, alignment and structure |
|---|
| >d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} | Back information, alignment and structure |
|---|
| >d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} | Back information, alignment and structure |
|---|
| >d2c7pa1 c.66.1.26 (A:1-327) DNA methylase HhaI {Haemophilus haemolyticus [TaxId: 726]} | Back information, alignment and structure |
|---|
| >d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} | Back information, alignment and structure |
|---|
| >d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} | Back information, alignment and structure |
|---|
| >d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} | Back information, alignment and structure |
|---|
| >d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} | Back information, alignment and structure |
|---|
| >d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} | Back information, alignment and structure |
|---|
| >d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} | Back information, alignment and structure |
|---|