Citrus Sinensis ID: 027877


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------
MAIQPNHFYASALKHADQNKQLIFTTGKTKSLQINAKASNARQLIQSGAIQPFTPKEAAAAMKEGFMLLDIRPIWETEKARVKGSLHVPLFVEDRDYSAITLLKKWVHFGYIGLWTGQKFTMFNPNFVRQVEAAVPDKESKLLVACGEGLRSMMAASKLYEGGYRNLGWLAGGFNRAIEGDFPEIEGKEKLQYATIGGVSYYFLRLLLLLQAVGKSD
cccccccccHHHccHHHcccccccccccccccHHHHHHHHHHHHHHcccccCCcHHHHHHHHHcccEEEEEccHHHHHHccccccEEEcccccccccHHHHHHHHHHHHccccccccccccccccHHHHHHHHHcccccccEEEEcccccHHHHHHHHHHHcccccEEEccccHHHHHccccccccccccccHHcccHHHHHHHHHHHHHHHccccc
********************QLIFTTG*********************AIQPFTPKEAAAAMKEGFMLLDIRPIWETEKARVKGSLHVPLFVEDRDYSAITLLKKWVHFGYIGLWTGQKFTMFNPNFVRQVEAAVPDKESKLLVACGEGLRSMMAASKLYEGGYRNLGWLAGGFNRAIEGDFPEIEGKEKLQYATIGGVSYYFLRLLLLLQAVG***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAIQPNHFYASALKHADQNKQLIFTTGKTKSLQINAKASNARQLIQSGAIQPFTPKEAAAAMKEGFMLLDIRPIWETEKARVKGSLHVPLFVEDRDYSAITLLKKWVHFGYIGLWTGQKFTMFNPNFVRQVEAAVPDKESKLLVACGEGLRSMMAASKLYEGGYRNLGWLAGGFNRAIEGDFPEIEGKEKLQYATIGGVSYYFLRLLLLLQAVGKSD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Rhodanese-like domain-containing protein 10 probableQ9SR92

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1YT8, chain A
Confidence level:very confident
Coverage over the Query: 50-92,127-189
View the alignment between query and template
View the model in PyMOL
Template: 3ICS, chain A
Confidence level:very confident
Coverage over the Query: 29-95,130-181
View the alignment between query and template
View the model in PyMOL
Template: 3G5J, chain A
Confidence level:confident
Coverage over the Query: 51-180
View the alignment between query and template
View the model in PyMOL