Citrus Sinensis ID: 027877

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------
MAIQPNHFYASALKHADQNKQLIFTTGKTKSLQINAKASNARQLIQSGAIQPFTPKEAAAAMKEGFMLLDIRPIWETEKARVKGSLHVPLFVEDRDYSAITLLKKWVHFGYIGLWTGQKFTMFNPNFVRQVEAAVPDKESKLLVACGEGLRSMMAASKLYEGGYRNLGWLAGGFNRAIEGDFPEIEGKEKLQYATIGGVSYYFLRLLLLLQAVGKSD
cccccccccHHHccHHHcccccccccccccccHHHHHHHHHHHHHHcccccEEcHHHHHHHHHcccEEEEEccHHHHHHccccccEEEcccccccccHHHHHHHHHHHHccccccccccccccccHHHHHHHHHcccccccEEEEcccccHHHHHHHHHHHcccccEEEccccHHHHHHcccccccccccccHHcccHHHHHHHHHHHHHHHccccc
cccEcccccHHHHHHHHcccccccccccccEEEcccccHHHHHHHHHcccccccHHHHHHHHHcccEEEEcccHHHHHHccccccEEEEEEEEcccccHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHcccccccEEEEEccccHHHHHHHHHHHcccccEEEcccHHHHHcccccccccccHHHHHHcHHHHHHHHHHHHHHHHHHcccc
MAIQPNHFYASALKHADQNKQLIFTTGKTKSLQINAKASNARQLiqsgaiqpftpKEAAAAMKEGFMLLDIRPIWETEKARVkgslhvplfvedrDYSAITLLKKWVHFGYIglwtgqkftmfnpnfVRQVEAAVPDKESKLLVACGEGLRSMMAASKLYEggyrnlgwlaggfnraiegdfpeiegkeklqyatiGGVSYYFLRLLLLLQAVGKSD
MAIQPNHFYASALKHADQNKQLIFTTGKTKSLQINAKASNARQLIQSGAIQPFTPKEAAAAMKEGFMLLDIRPIWETEKARVKGSLHVPLFVEDRDYSAITLLKKWVHFGYIGLWTGQKFTMFNPNFVRQVEAAVPDKESKLLVACGEGLRSMMAASKLYEGGYRNLGWLAGGFNRAIEGDFPEIEGKEKLQYATIGGVSYYFLRLLLLLQAVGKSD
MAIQPNHFYASALKHADQNKQLIFTTGKTKSLQINAKASNARQLIQSGAIQPFTPKEAAAAMKEGFMLLDIRPIWETEKARVKGSLHVPLFVEDRDYSAITLLKKWVHFGYIGLWTGQKFTMFNPNFVRQVEAAVPDKESKLLVACGEGLRSMMAASKLYEGGYRNLGWLAGGFNRAIEGDFPEIEGKEKLQYATIGGVSYYFlrlllllQAVGKSD
********************QLIFTTG**********************I**F****AAAAMKEGFMLLDIRPIWETEKARVKGSLHVPLFVEDRDYSAITLLKKWVHFGYIGLWTGQKFTMFNPNFVRQVEAAVPDKESKLLVACGEGLRSMMAASKLYEGGYRNLGWLAGGFNRAIEGDFPEIEGKEKLQYATIGGVSYYFLRLLLLLQAV****
************************************************AIQPFTPKEAAAAMKEGFMLLDIRPIWETEKARVKGSLHVPLFVEDRDYSAITLLKKWVHFGYIGLWTGQKFTMFNPNFVRQVEAAVPDKESKLLVACGEGLRSMMAASKLYEGGYRNLGWLAGGFNRAIEGDFPEIEGKEKLQYATIGGVSYYFLRLLLLLQAVG***
MAIQPNHFYASALKHADQNKQLIFTTGKTKSLQINAKASNARQLIQSGAIQPFTPKEAAAAMKEGFMLLDIRPIWETEKARVKGSLHVPLFVEDRDYSAITLLKKWVHFGYIGLWTGQKFTMFNPNFVRQVEAAVPDKESKLLVACGEGLRSMMAASKLYEGGYRNLGWLAGGFNRAIEGDFPEIEGKEKLQYATIGGVSYYFLRLLLLLQAVGKSD
*AIQPNHFYASALKHADQNKQLIFTTGKTKSLQINAKASNARQLIQSGAIQPFTPKEAAAAMKEGFMLLDIRPIWETEKARVKGSLHVPLFVEDRDYSAITLLKKWVHFGYIGLWTGQKFTMFNPNFVRQVEAAVPDKESKLLVACGEGLRSMMAASKLYEGGYRNLGWLAGGFNRAIEGDFPEIEGKEKLQYATIGGVSYYFLRLLLLLQAVGKS*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAIQPNHFYASALKHADQNKQLIFTTGKTKSLQINAKASNARQLIQSGAIQPFTPKEAAAAMKEGFMLLDIRPIWETEKARVKGSLHVPLFVEDRDYSAITLLKKWVHFGYIGLWTGQKFTMFNPNFVRQVEAAVPDKESKLLVACGEGLRSMMAASKLYEGGYRNLGWLAGGFNRAIEGDFPEIEGKEKLQYATIGGVSYYFLRLLLLLQAVGKSD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query217 2.2.26 [Sep-21-2011]
Q9SR92214 Rhodanese-like domain-con yes no 0.760 0.771 0.668 1e-61
Q0WWT7292 Rhodanese-like domain-con no no 0.728 0.541 0.416 5e-24
O48529234 Rhodanese-like domain-con no no 0.622 0.576 0.372 2e-20
Q94A65224 Rhodanese-like domain-con no no 0.589 0.571 0.310 2e-10
F4IPI4156 Rhodanese-like domain-con no no 0.525 0.730 0.253 0.0003
Q8RUD6169 Rhodanese-like domain-con no no 0.640 0.822 0.266 0.0003
P27626183 Senescence-associated pro N/A no 0.271 0.322 0.333 0.0007
A5UHG8105 Thiosulfate sulfurtransfe yes no 0.456 0.942 0.237 0.0008
Q4QMN7105 Thiosulfate sulfurtransfe yes no 0.456 0.942 0.237 0.0008
P44819105 Thiosulfate sulfurtransfe yes no 0.433 0.895 0.246 0.0008
>sp|Q9SR92|STR10_ARATH Rhodanese-like domain-containing protein 10 OS=Arabidopsis thaliana GN=STR10 PE=2 SV=1 Back     alignment and function desciption
 Score =  236 bits (601), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 111/166 (66%), Positives = 132/166 (79%), Gaps = 1/166 (0%)

Query: 38  ASNARQLIQSGAIQPFTPKEAAAAM-KEGFMLLDIRPIWETEKARVKGSLHVPLFVEDRD 96
           A + ++LI SG ++   PKEA A +  EG++LLD+RP WE EKARVKGSLHVPLFVED D
Sbjct: 33  AVSGKELILSGKVRAVEPKEANAVVASEGYILLDVRPAWEREKARVKGSLHVPLFVEDPD 92

Query: 97  YSAITLLKKWVHFGYIGLWTGQKFTMFNPNFVRQVEAAVPDKESKLLVACGEGLRSMMAA 156
              ITLLKKW+H GYIGLWTGQ+FTM N  F  +V  AVPDKESK+LV CGEGLRS+ A 
Sbjct: 93  NGPITLLKKWIHLGYIGLWTGQRFTMINDEFALRVVEAVPDKESKVLVVCGEGLRSLAAV 152

Query: 157 SKLYEGGYRNLGWLAGGFNRAIEGDFPEIEGKEKLQYATIGGVSYY 202
           SKL+  GY++LGWL GGFNR  EGDFPEIEG E+L++ATIGGVS+Y
Sbjct: 153 SKLHGEGYKSLGWLTGGFNRVSEGDFPEIEGTEELRFATIGGVSFY 198

Arabidopsis thaliana (taxid: 3702)
>sp|Q0WWT7|STR11_ARATH Rhodanese-like domain-containing protein 11, chloroplastic OS=Arabidopsis thaliana GN=STR11 PE=2 SV=1 Back     alignment and function description
>sp|O48529|STR9_ARATH Rhodanese-like domain-containing protein 9, chloroplastic OS=Arabidopsis thaliana GN=STR9 PE=2 SV=1 Back     alignment and function description
>sp|Q94A65|STR14_ARATH Rhodanese-like domain-containing protein 14, chloroplastic OS=Arabidopsis thaliana GN=At4g27700 PE=2 SV=1 Back     alignment and function description
>sp|F4IPI4|STR17_ARATH Rhodanese-like domain-containing protein 17 OS=Arabidopsis thaliana GN=STR17 PE=2 SV=1 Back     alignment and function description
>sp|Q8RUD6|STR19_ARATH Rhodanese-like domain-containing protein 19, mitochondrial OS=Arabidopsis thaliana GN=STR19 PE=2 SV=1 Back     alignment and function description
>sp|P27626|DIN1_RAPSA Senescence-associated protein DIN1 OS=Raphanus sativus GN=DIN1 PE=2 SV=1 Back     alignment and function description
>sp|A5UHG8|GLPE_HAEIG Thiosulfate sulfurtransferase GlpE OS=Haemophilus influenzae (strain PittGG) GN=glpE PE=3 SV=1 Back     alignment and function description
>sp|Q4QMN7|GLPE_HAEI8 Thiosulfate sulfurtransferase GlpE OS=Haemophilus influenzae (strain 86-028NP) GN=glpE PE=3 SV=1 Back     alignment and function description
>sp|P44819|GLPE_HAEIN Thiosulfate sulfurtransferase GlpE OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=glpE PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query217
225439433218 PREDICTED: uncharacterized protein LOC10 0.990 0.986 0.722 2e-86
255574353222 conserved hypothetical protein [Ricinus 1.0 0.977 0.695 2e-84
147858666206 hypothetical protein VITISV_043095 [Viti 0.935 0.985 0.685 6e-79
224091002219 predicted protein [Populus trichocarpa] 1.0 0.990 0.689 1e-77
449440263217 PREDICTED: rhodanese-like domain-contain 0.986 0.986 0.627 3e-73
358349073224 Rhodanese-like family protein-like prote 0.981 0.950 0.618 1e-70
255647228215 unknown [Glycine max] 0.917 0.925 0.641 7e-69
297829414214 hypothetical protein ARALYDRAFT_478195 [ 0.820 0.831 0.653 3e-64
388497824223 unknown [Medicago truncatula] 0.940 0.914 0.591 2e-63
21592651214 rhodanese-like family protein [Arabidops 0.760 0.771 0.668 4e-60
>gi|225439433|ref|XP_002265850.1| PREDICTED: uncharacterized protein LOC100252319 [Vitis vinifera] gi|296083157|emb|CBI22793.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  324 bits (830), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 156/216 (72%), Positives = 180/216 (83%), Gaps = 1/216 (0%)

Query: 1   MAIQPNHFYASALKHADQNKQLIFTTGKTKSLQINAKASNARQLIQSGAIQPFTPKEAAA 60
           MAIQ    Y S LKH  Q K  IF      +LQ++A +S+ARQLI SGA++P  PK+AA+
Sbjct: 1   MAIQLKLPYTSTLKHRKQGKPPIFNISTPPTLQVHASSSSARQLIGSGAVRPILPKDAAS 60

Query: 61  AMK-EGFMLLDIRPIWETEKARVKGSLHVPLFVEDRDYSAITLLKKWVHFGYIGLWTGQK 119
           A+  EGF+LLD+RP WE EKARV GS+HVPLFV+D D S ITLLKKWVHFGYIGLWTGQ 
Sbjct: 61  ALNSEGFILLDVRPAWEREKARVSGSMHVPLFVKDMDNSPITLLKKWVHFGYIGLWTGQN 120

Query: 120 FTMFNPNFVRQVEAAVPDKESKLLVACGEGLRSMMAASKLYEGGYRNLGWLAGGFNRAIE 179
           FTM NP+FV QVE AVPDK++KLLVACGEGLRSMMAASKL+ GGYRNLGWLAGGFNRA +
Sbjct: 121 FTMINPDFVGQVEIAVPDKDAKLLVACGEGLRSMMAASKLHGGGYRNLGWLAGGFNRAND 180

Query: 180 GDFPEIEGKEKLQYATIGGVSYYFLRLLLLLQAVGK 215
           GDFP++EG EKLQYATIGGVSYYFL+LL+LLQAVG+
Sbjct: 181 GDFPDVEGTEKLQYATIGGVSYYFLQLLILLQAVGE 216

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255574353|ref|XP_002528090.1| conserved hypothetical protein [Ricinus communis] gi|223532479|gb|EEF34269.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|147858666|emb|CAN82892.1| hypothetical protein VITISV_043095 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224091002|ref|XP_002309141.1| predicted protein [Populus trichocarpa] gi|222855117|gb|EEE92664.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449440263|ref|XP_004137904.1| PREDICTED: rhodanese-like domain-containing protein 10-like [Cucumis sativus] gi|449523127|ref|XP_004168576.1| PREDICTED: rhodanese-like domain-containing protein 10-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|358349073|ref|XP_003638564.1| Rhodanese-like family protein-like protein [Medicago truncatula] gi|355504499|gb|AES85702.1| Rhodanese-like family protein-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|255647228|gb|ACU24082.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|297829414|ref|XP_002882589.1| hypothetical protein ARALYDRAFT_478195 [Arabidopsis lyrata subsp. lyrata] gi|297328429|gb|EFH58848.1| hypothetical protein ARALYDRAFT_478195 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|388497824|gb|AFK36978.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|21592651|gb|AAM64600.1| rhodanese-like family protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query217
TAIR|locus:2097628214 AT3G08920 "AT3G08920" [Arabido 0.760 0.771 0.668 1.1e-57
TAIR|locus:2121994292 AT4G24750 "AT4G24750" [Arabido 0.723 0.537 0.418 9.7e-25
TAIR|locus:2059999234 AT2G42220 "AT2G42220" [Arabido 0.718 0.666 0.35 8e-21
TAIR|locus:2137792224 AT4G27700 "AT4G27700" [Arabido 0.585 0.566 0.312 8.2e-12
UNIPROTKB|Q83F83124 CBU_0065 "Rhodanese-related su 0.262 0.459 0.385 3.5e-10
TIGR_CMR|CBU_0065124 CBU_0065 "rhodanese domain pro 0.262 0.459 0.385 3.5e-10
UNIPROTKB|Q607E4120 MCA1816 "Sulfurtransferase" [M 0.211 0.383 0.413 4.5e-06
UNIPROTKB|Q3AEL0126 CHY_0566 "Rhodanese-like domai 0.202 0.349 0.413 7.1e-05
TIGR_CMR|CHY_0566126 CHY_0566 "rhodanese-like domai 0.202 0.349 0.413 7.1e-05
TAIR|locus:505006261169 AT2G21045 [Arabidopsis thalian 0.635 0.816 0.268 0.00011
TAIR|locus:2097628 AT3G08920 "AT3G08920" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 593 (213.8 bits), Expect = 1.1e-57, P = 1.1e-57
 Identities = 111/166 (66%), Positives = 132/166 (79%)

Query:    38 ASNARQLIQSGAIQPFTPKEAAAAM-KEGFMLLDIRPIWETEKARVKGSLHVPLFVEDRD 96
             A + ++LI SG ++   PKEA A +  EG++LLD+RP WE EKARVKGSLHVPLFVED D
Sbjct:    33 AVSGKELILSGKVRAVEPKEANAVVASEGYILLDVRPAWEREKARVKGSLHVPLFVEDPD 92

Query:    97 YSAITLLKKWVHFGYIGLWTGQKFTMFNPNFVRQVEAAVPDKESKLLVACGEGLRSMMAA 156
                ITLLKKW+H GYIGLWTGQ+FTM N  F  +V  AVPDKESK+LV CGEGLRS+ A 
Sbjct:    93 NGPITLLKKWIHLGYIGLWTGQRFTMINDEFALRVVEAVPDKESKVLVVCGEGLRSLAAV 152

Query:   157 SKLYEGGYRNLGWLAGGFNRAIEGDFPEIEGKEKLQYATIGGVSYY 202
             SKL+  GY++LGWL GGFNR  EGDFPEIEG E+L++ATIGGVS+Y
Sbjct:   153 SKLHGEGYKSLGWLTGGFNRVSEGDFPEIEGTEELRFATIGGVSFY 198
GO:0003674 "molecular_function" evidence=ND
GO:0008150 "biological_process" evidence=ND
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0009534 "chloroplast thylakoid" evidence=IDA
GO:0009941 "chloroplast envelope" evidence=IDA
TAIR|locus:2121994 AT4G24750 "AT4G24750" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2059999 AT2G42220 "AT2G42220" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2137792 AT4G27700 "AT4G27700" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q83F83 CBU_0065 "Rhodanese-related sulfurtransferase" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
TIGR_CMR|CBU_0065 CBU_0065 "rhodanese domain protein" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
UNIPROTKB|Q607E4 MCA1816 "Sulfurtransferase" [Methylococcus capsulatus str. Bath (taxid:243233)] Back     alignment and assigned GO terms
UNIPROTKB|Q3AEL0 CHY_0566 "Rhodanese-like domain protein" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_0566 CHY_0566 "rhodanese-like domain protein" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
TAIR|locus:505006261 AT2G21045 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9SR92STR10_ARATHNo assigned EC number0.66860.76030.7710yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00038891001
SubName- Full=Chromosome chr8 scaffold_99, whole genome shotgun sequence; (218 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query217
PRK08762 376 PRK08762, PRK08762, molybdopterin biosynthesis pro 3e-13
cd0015889 cd00158, RHOD, Rhodanese Homology Domain (RHOD); a 7e-12
pfam00581106 pfam00581, Rhodanese, Rhodanese-like domain 7e-10
smart00450100 smart00450, RHOD, Rhodanese Homology Domain 4e-09
cd01528101 cd01528, RHOD_2, Member of the Rhodanese Homology 6e-07
cd01522117 cd01522, RHOD_1, Member of the Rhodanese Homology 1e-04
COG0607110 COG0607, PspE, Rhodanese-related sulfurtransferase 1e-04
cd01447103 cd01447, Polysulfide_ST, Polysulfide-sulfurtransfe 2e-04
cd0152799 cd01527, RHOD_YgaP, Member of the Rhodanese Homolo 9e-04
cd01526122 cd01526, RHOD_ThiF, Member of the Rhodanese Homolo 9e-04
>gnl|CDD|236337 PRK08762, PRK08762, molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information 
 Score = 67.3 bits (165), Expect = 3e-13
 Identities = 32/128 (25%), Positives = 58/128 (45%), Gaps = 34/128 (26%)

Query: 49  AIQPFTPKEAAAAMKEGFMLLDIRPIWETEKARVKGSLHVPLFVEDRDYSAITLLKKWVH 108
           +I+  +P EA A   +G +L+D+R   E    + +G+L +P                   
Sbjct: 1   SIREISPAEARARAAQGAVLIDVREAHERASGQAEGALRIPR------------------ 42

Query: 109 FGYIGLWTGQKFTMFNPNFVRQVEAAVPDKESKLLVACGEGLRSMMAASKLYEGGYRNLG 168
            G++ L               ++E  +PD++ ++++ C  G RS  AA+ L E GY  + 
Sbjct: 43  -GFLEL---------------RIETHLPDRDREIVLICASGTRSAHAAATLRELGYTRVA 86

Query: 169 WLAGGFNR 176
            +AGGF+ 
Sbjct: 87  SVAGGFSA 94

Length = 376
>gnl|CDD|238089 cd00158, RHOD, Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein Back     alignment and domain information
>gnl|CDD|216005 pfam00581, Rhodanese, Rhodanese-like domain Back     alignment and domain information
>gnl|CDD|197731 smart00450, RHOD, Rhodanese Homology Domain Back     alignment and domain information
>gnl|CDD|238786 cd01528, RHOD_2, Member of the Rhodanese Homology Domain superfamily, subgroup 2 Back     alignment and domain information
>gnl|CDD|238780 cd01522, RHOD_1, Member of the Rhodanese Homology Domain superfamily, subgroup 1 Back     alignment and domain information
>gnl|CDD|223680 COG0607, PspE, Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|238724 cd01447, Polysulfide_ST, Polysulfide-sulfurtransferase - Rhodanese Homology Domain Back     alignment and domain information
>gnl|CDD|238785 cd01527, RHOD_YgaP, Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>gnl|CDD|238784 cd01526, RHOD_ThiF, Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 217
PLN02160136 thiosulfate sulfurtransferase 99.89
cd01533109 4RHOD_Repeat_2 Member of the Rhodanese Homology Do 99.89
KOG1530136 consensus Rhodanese-related sulfurtransferase [Ino 99.88
cd01518101 RHOD_YceA Member of the Rhodanese Homology Domain 99.88
PRK00162108 glpE thiosulfate sulfurtransferase; Validated 99.86
cd0152799 RHOD_YgaP Member of the Rhodanese Homology Domain 99.86
TIGR03865162 PQQ_CXXCW PQQ-dependent catabolism-associated CXXC 99.86
cd0153495 4RHOD_Repeat_3 Member of the Rhodanese Homology Do 99.85
cd01523100 RHOD_Lact_B Member of the Rhodanese Homology Domai 99.84
cd01519106 RHOD_HSP67B2 Member of the Rhodanese Homology Doma 99.84
cd01520128 RHOD_YbbB Member of the Rhodanese Homology Domain 99.84
cd01521110 RHOD_PspE2 Member of the Rhodanese Homology Domain 99.83
cd01448122 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), 99.82
cd01526122 RHOD_ThiF Member of the Rhodanese Homology Domain 99.82
cd01522117 RHOD_1 Member of the Rhodanese Homology Domain sup 99.82
smart00450100 RHOD Rhodanese Homology Domain. An alpha beta fold 99.82
cd01528101 RHOD_2 Member of the Rhodanese Homology Domain sup 99.82
cd0152490 RHOD_Pyr_redox Member of the Rhodanese Homology Do 99.82
cd01447103 Polysulfide_ST Polysulfide-sulfurtransferase - Rho 99.81
cd01449118 TST_Repeat_2 Thiosulfate sulfurtransferase (TST), 99.81
cd0144496 GlpE_ST GlpE sulfurtransferase (ST) and homologs a 99.81
cd01530121 Cdc25 Cdc25 phosphatases are members of the Rhodan 99.81
cd01525105 RHOD_Kc Member of the Rhodanese Homology Domain su 99.81
PF00581113 Rhodanese: Rhodanese-like domain This Prosite entr 99.8
PRK08762 376 molybdopterin biosynthesis protein MoeB; Validated 99.8
cd01535145 4RHOD_Repeat_4 Member of the Rhodanese Homology Do 99.8
cd0152996 4RHOD_Repeats Member of the Rhodanese Homology Dom 99.8
PRK11493 281 sseA 3-mercaptopyruvate sulfurtransferase; Provisi 99.8
cd0153292 4RHOD_Repeat_1 Member of the Rhodanese Homology Do 99.79
PLN02723 320 3-mercaptopyruvate sulfurtransferase 99.79
PRK09629 610 bifunctional thiosulfate sulfurtransferase/phospha 99.78
PRK11784 345 tRNA 2-selenouridine synthase; Provisional 99.78
cd01445138 TST_Repeats Thiosulfate sulfurtransferases (TST) c 99.77
TIGR03167 311 tRNA_sel_U_synt tRNA 2-selenouridine synthase. The 99.77
cd0015889 RHOD Rhodanese Homology Domain (RHOD); an alpha be 99.76
cd01531113 Acr2p Eukaryotic arsenate resistance proteins are 99.76
TIGR02981101 phageshock_pspE phage shock operon rhodanese PspE. 99.76
PRK01415247 hypothetical protein; Validated 99.75
PRK05320257 rhodanese superfamily protein; Provisional 99.75
PLN02723320 3-mercaptopyruvate sulfurtransferase 99.75
PRK10287104 thiosulfate:cyanide sulfurtransferase; Provisional 99.74
COG0607110 PspE Rhodanese-related sulfurtransferase [Inorgani 99.74
PRK11493281 sseA 3-mercaptopyruvate sulfurtransferase; Provisi 99.74
PRK00142314 putative rhodanese-related sulfurtransferase; Prov 99.73
cd01443113 Cdc25_Acr2p Cdc25 enzymes are members of the Rhoda 99.73
COG2897 285 SseA Rhodanese-related sulfurtransferase [Inorgani 99.72
PRK09629 610 bifunctional thiosulfate sulfurtransferase/phospha 99.7
COG2897285 SseA Rhodanese-related sulfurtransferase [Inorgani 99.69
PRK07878392 molybdopterin biosynthesis-like protein MoeZ; Vali 99.68
PRK05597355 molybdopterin biosynthesis protein MoeB; Validated 99.65
PRK07411390 hypothetical protein; Validated 99.64
cd01446132 DSP_MapKP N-terminal regulatory rhodanese domain o 99.61
PRK05600370 thiamine biosynthesis protein ThiF; Validated 99.53
KOG1529 286 consensus Mercaptopyruvate sulfurtransferase/thios 99.38
COG1054308 Predicted sulfurtransferase [General function pred 99.37
PRK01269482 tRNA s(4)U8 sulfurtransferase; Provisional 99.29
KOG3772325 consensus M-phase inducer phosphatase [Cell cycle 99.18
KOG2017427 consensus Molybdopterin synthase sulfurylase [Coen 99.14
KOG1529286 consensus Mercaptopyruvate sulfurtransferase/thios 98.83
COG5105427 MIH1 Mitotic inducer, protein phosphatase [Cell di 98.42
COG2603 334 Predicted ATPase [General function prediction only 98.14
PF04273110 DUF442: Putative phosphatase (DUF442); InterPro: I 96.98
TIGR01244135 conserved hypothetical protein TIGR01244. No membe 96.94
KOG1093725 consensus Predicted protein kinase (contains TBC a 96.03
PF13350164 Y_phosphatase3: Tyrosine phosphatase family; PDB: 94.55
KOG1717 343 consensus Dual specificity phosphatase [Defense me 93.88
PRK00142 314 putative rhodanese-related sulfurtransferase; Prov 93.7
KOG3636 669 consensus Uncharacterized conserved protein, conta 90.15
COG3453130 Uncharacterized protein conserved in bacteria [Fun 88.97
cd00127139 DSPc Dual specificity phosphatases (DSP); Ser/Thr 88.97
PF01451138 LMWPc: Low molecular weight phosphotyrosine protei 85.71
PLN02727 986 NAD kinase 81.87
smart00195138 DSPc Dual specificity phosphatase, catalytic domai 81.48
>PLN02160 thiosulfate sulfurtransferase Back     alignment and domain information 
Probab=99.89  E-value=1.1e-22  Score=158.51  Aligned_cols=119  Identities=22%  Similarity=0.432  Sum_probs=96.9

Q ss_pred             CCcccCHHHHHHHhhCCcEEEecCChhhhhhccCCCc--EeccCcccccchhHHHHHHhhhhccccccccCCcccCCChh
Q 027877           49 AIQPFTPKEAAAAMKEGFMLLDIRPIWETEKARVKGS--LHVPLFVEDRDYSAITLLKKWVHFGYIGLWTGQKFTMFNPN  126 (217)
Q Consensus        49 ~~~~is~~e~~~~l~~~~~lIDvR~~~ey~~ghIpGA--inip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  126 (217)
                      .+..++++++.+.++++.+|||||++.||..||||||  +|+|+..+...                       ....+++
T Consensus        13 ~~~~i~~~e~~~~~~~~~~lIDVR~~~E~~~ghIpgA~~iniP~~~~~~~-----------------------~~l~~~~   69 (136)
T PLN02160         13 EVVSVDVSQAKTLLQSGHQYLDVRTQDEFRRGHCEAAKIVNIPYMLNTPQ-----------------------GRVKNQE   69 (136)
T ss_pred             eeeEeCHHHHHHHHhCCCEEEECCCHHHHhcCCCCCcceecccchhcCcc-----------------------cccCCHH
Confidence            4678999999998855678999999999999999999  89998532110                       0112245


Q ss_pred             HHHHHHHhCCCCCCeEEEEeCCCchHHHHHHHHHHcCCcceeeccccHHHHHhCCCCcccCCccc
Q 027877          127 FVRQVEAAVPDKESKLLVACGEGLRSMMAASKLYEGGYRNLGWLAGGFNRAIEGDFPEIEGKEKL  191 (217)
Q Consensus       127 ~~~~~~~~~~~~~~~IvlyC~~G~ra~~aa~~L~~~G~~nv~~l~GG~~~W~~~g~p~~~~~~~~  191 (217)
                      +...+...+ +++++||+||++|.||..++..|.+.||++|+.|.||+.+|.++|+|+.+..++.
T Consensus        70 ~~~~~~~~~-~~~~~IivyC~sG~RS~~Aa~~L~~~G~~~v~~l~GG~~~W~~~g~p~~~~~~~~  133 (136)
T PLN02160         70 FLEQVSSLL-NPADDILVGCQSGARSLKATTELVAAGYKKVRNKGGGYLAWVDHSFPINQEEEEP  133 (136)
T ss_pred             HHHHHHhcc-CCCCcEEEECCCcHHHHHHHHHHHHcCCCCeeecCCcHHHHhhCCCCccccccCC
Confidence            555554433 6788999999999999999999999999999999999999999999999886654

>cd01533 4RHOD_Repeat_2 Member of the Rhodanese Homology Domain superfamily, repeat 2 Back     alignment and domain information
>KOG1530 consensus Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd01518 RHOD_YceA Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>PRK00162 glpE thiosulfate sulfurtransferase; Validated Back     alignment and domain information
>cd01527 RHOD_YgaP Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>TIGR03865 PQQ_CXXCW PQQ-dependent catabolism-associated CXXCW motif protein Back     alignment and domain information
>cd01534 4RHOD_Repeat_3 Member of the Rhodanese Homology Domain superfamily, repeat 3 Back     alignment and domain information
>cd01523 RHOD_Lact_B Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01519 RHOD_HSP67B2 Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01520 RHOD_YbbB Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01521 RHOD_PspE2 Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01448 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), N-terminal, inactive domain Back     alignment and domain information
>cd01526 RHOD_ThiF Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01522 RHOD_1 Member of the Rhodanese Homology Domain superfamily, subgroup 1 Back     alignment and domain information
>smart00450 RHOD Rhodanese Homology Domain Back     alignment and domain information
>cd01528 RHOD_2 Member of the Rhodanese Homology Domain superfamily, subgroup 2 Back     alignment and domain information
>cd01524 RHOD_Pyr_redox Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01447 Polysulfide_ST Polysulfide-sulfurtransferase - Rhodanese Homology Domain Back     alignment and domain information
>cd01449 TST_Repeat_2 Thiosulfate sulfurtransferase (TST), C-terminal, catalytic domain Back     alignment and domain information
>cd01444 GlpE_ST GlpE sulfurtransferase (ST) and homologs are members of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01530 Cdc25 Cdc25 phosphatases are members of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01525 RHOD_Kc Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>PF00581 Rhodanese: Rhodanese-like domain This Prosite entry represents a subset of this family Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>cd01535 4RHOD_Repeat_4 Member of the Rhodanese Homology Domain superfamily, repeat 4 Back     alignment and domain information
>cd01529 4RHOD_Repeats Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>PRK11493 sseA 3-mercaptopyruvate sulfurtransferase; Provisional Back     alignment and domain information
>cd01532 4RHOD_Repeat_1 Member of the Rhodanese Homology Domain superfamily, repeat 1 Back     alignment and domain information
>PLN02723 3-mercaptopyruvate sulfurtransferase Back     alignment and domain information
>PRK09629 bifunctional thiosulfate sulfurtransferase/phosphatidylserine decarboxylase; Provisional Back     alignment and domain information
>PRK11784 tRNA 2-selenouridine synthase; Provisional Back     alignment and domain information
>cd01445 TST_Repeats Thiosulfate sulfurtransferases (TST) contain 2 copies of the Rhodanese Homology Domain Back     alignment and domain information
>TIGR03167 tRNA_sel_U_synt tRNA 2-selenouridine synthase Back     alignment and domain information
>cd00158 RHOD Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein Back     alignment and domain information
>cd01531 Acr2p Eukaryotic arsenate resistance proteins are members of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>TIGR02981 phageshock_pspE phage shock operon rhodanese PspE Back     alignment and domain information
>PRK01415 hypothetical protein; Validated Back     alignment and domain information
>PRK05320 rhodanese superfamily protein; Provisional Back     alignment and domain information
>PLN02723 3-mercaptopyruvate sulfurtransferase Back     alignment and domain information
>PRK10287 thiosulfate:cyanide sulfurtransferase; Provisional Back     alignment and domain information
>COG0607 PspE Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11493 sseA 3-mercaptopyruvate sulfurtransferase; Provisional Back     alignment and domain information
>PRK00142 putative rhodanese-related sulfurtransferase; Provisional Back     alignment and domain information
>cd01443 Cdc25_Acr2p Cdc25 enzymes are members of the Rhodanese Homology Domain (RHOD) superfamily Back     alignment and domain information
>COG2897 SseA Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09629 bifunctional thiosulfate sulfurtransferase/phosphatidylserine decarboxylase; Provisional Back     alignment and domain information
>COG2897 SseA Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK07411 hypothetical protein; Validated Back     alignment and domain information
>cd01446 DSP_MapKP N-terminal regulatory rhodanese domain of dual specificity phosphatases (DSP), such as Mapk Phosphatase Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>KOG1529 consensus Mercaptopyruvate sulfurtransferase/thiosulfate sulfurtransferase [Defense mechanisms] Back     alignment and domain information
>COG1054 Predicted sulfurtransferase [General function prediction only] Back     alignment and domain information
>PRK01269 tRNA s(4)U8 sulfurtransferase; Provisional Back     alignment and domain information
>KOG3772 consensus M-phase inducer phosphatase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2017 consensus Molybdopterin synthase sulfurylase [Coenzyme transport and metabolism] Back     alignment and domain information
>KOG1529 consensus Mercaptopyruvate sulfurtransferase/thiosulfate sulfurtransferase [Defense mechanisms] Back     alignment and domain information
>COG5105 MIH1 Mitotic inducer, protein phosphatase [Cell division and chromosome partitioning] Back     alignment and domain information
>COG2603 Predicted ATPase [General function prediction only] Back     alignment and domain information
>PF04273 DUF442: Putative phosphatase (DUF442); InterPro: IPR005939 Although this domain is uncharacterised it seems likely that it performs a phosphatase function Back     alignment and domain information
>TIGR01244 conserved hypothetical protein TIGR01244 Back     alignment and domain information
>KOG1093 consensus Predicted protein kinase (contains TBC and RHOD domains) [General function prediction only] Back     alignment and domain information
>PF13350 Y_phosphatase3: Tyrosine phosphatase family; PDB: 1YWF_A 2OZ5_B Back     alignment and domain information
>KOG1717 consensus Dual specificity phosphatase [Defense mechanisms] Back     alignment and domain information
>PRK00142 putative rhodanese-related sulfurtransferase; Provisional Back     alignment and domain information
>KOG3636 consensus Uncharacterized conserved protein, contains TBC and Rhodanese domains [General function prediction only] Back     alignment and domain information
>COG3453 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>cd00127 DSPc Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases Back     alignment and domain information
>PF01451 LMWPc: Low molecular weight phosphotyrosine protein phosphatase; InterPro: IPR023485 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>PLN02727 NAD kinase Back     alignment and domain information
>smart00195 DSPc Dual specificity phosphatase, catalytic domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query217
1tq1_A129 AT5G66040, senescence-associated family protein; C 1e-14
2hhg_A139 Hypothetical protein RPA3614; MCSG, structural gen 6e-14
3d1p_A139 Putative thiosulfate sulfurtransferase YOR285W; at 4e-12
3i2v_A127 Adenylyltransferase and sulfurtransferase MOCS3; r 7e-12
1wv9_A94 Rhodanese homolog TT1651; CDC25, phosphatase, sulf 2e-11
1yt8_A 539 Thiosulfate sulfurtransferase; rhodanase domains, 2e-11
1yt8_A539 Thiosulfate sulfurtransferase; rhodanase domains, 2e-09
1yt8_A 539 Thiosulfate sulfurtransferase; rhodanase domains, 2e-08
1yt8_A 539 Thiosulfate sulfurtransferase; rhodanase domains, 9e-05
1qxn_A137 SUD, sulfide dehydrogenase; polysulfide-sulfur tra 6e-11
1gmx_A108 GLPE protein; transferase, rhodanese, sulfurtransf 9e-11
3tp9_A474 Beta-lactamase and rhodanese domain protein; struc 2e-10
2fsx_A148 RV0390, COG0607: rhodanese-related sulfurtransfera 3e-10
1vee_A134 Proline-rich protein family; hypothetical protein, 3e-09
3r2u_A466 Metallo-beta-lactamase family protein; structural 8e-09
3ilm_A141 ALR3790 protein; rhodanese-like, NSR437H, NESG, st 1e-08
2k0z_A110 Uncharacterized protein HP1203; A/B domain, struct 3e-08
3hix_A106 ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q 3e-08
3eme_A103 Rhodanese-like domain protein; alpha-beta-alpha sa 3e-08
3foj_A100 Uncharacterized protein; protein SSP1007, structur 2e-07
3gk5_A108 Uncharacterized rhodanese-related protein TVG08686 4e-07
2jtq_A85 Phage shock protein E; solution structure rhodanes 4e-06
3nhv_A144 BH2092 protein; alpha-beta protein, structural gen 8e-06
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 1e-05
1t3k_A152 Arath CDC25, dual-specificity tyrosine phosphatase 9e-05
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 1e-04
3g5j_A134 Putative ATP/GTP binding protein; N-terminal domai 9e-04
>1tq1_A AT5G66040, senescence-associated family protein; CESG, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: c.46.1.3 Length = 129 Back     alignment and structure
 Score = 67.1 bits (164), Expect = 1e-14
 Identities = 26/140 (18%), Positives = 48/140 (34%), Gaps = 26/140 (18%)

Query: 38  ASNARQLI--QSGAIQPFTPKEAAAAMKEGFMLLDIRPIWETEKARVKGSLHVPLFVEDR 95
             +   L   +S      +   A   +  G   LD+R   E  +    G+++VP      
Sbjct: 3   HHHHHHLEAEESRVPSSVSVTVAHDLLLAGHRYLDVRTPEEFSQGHACGAINVPYMN--- 59

Query: 96  DYSAITLLKKWVHFGYIGLWTGQKFTMFNPNFVRQVEAAVPDKESKLLVACGEGLRSMMA 155
                                G      N +F+ QV +    +   ++V C  G RS+ A
Sbjct: 60  --------------------RGASGMSKNTDFLEQVSSHF-GQSDNIIVGCQSGGRSIKA 98

Query: 156 ASKLYEGGYRNLGWLAGGFN 175
            + L   G+  +  + GG++
Sbjct: 99  TTDLLHAGFTGVKDIVGGYS 118
>2hhg_A Hypothetical protein RPA3614; MCSG, structural genomics, rohopseudom palustris, PSI-2, protein structure initiative; 1.20A {Rhodopseudomonas palustris} Length = 139 Back     alignment and structure
>3d1p_A Putative thiosulfate sulfurtransferase YOR285W; atomic structure, atomic resolution structure, PSI, MCSG; HET: MSE; 0.98A {Saccharomyces cerevisiae} Length = 139 Back     alignment and structure
>3i2v_A Adenylyltransferase and sulfurtransferase MOCS3; rhodanese, UBA4, structural genomics, ubiquitin biology, structural genomics consortium, SGC; 1.25A {Homo sapiens} Length = 127 Back     alignment and structure
>1wv9_A Rhodanese homolog TT1651; CDC25, phosphatase, sulfurtransferase, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} Length = 94 Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539 Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539 Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539 Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539 Back     alignment and structure
>1qxn_A SUD, sulfide dehydrogenase; polysulfide-sulfur transferase, homodimer; NMR {Wolinella succinogenes} SCOP: c.46.1.3 Length = 137 Back     alignment and structure
>1gmx_A GLPE protein; transferase, rhodanese, sulfurtransferase, glycerol metabolism; 1.1A {Escherichia coli} SCOP: c.46.1.3 PDB: 1gn0_A Length = 108 Back     alignment and structure
>3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} Length = 474 Back     alignment and structure
>2fsx_A RV0390, COG0607: rhodanese-related sulfurtransferase; RV0390 BR SAD DATA with FBAR, structural genomics, PSI; 1.80A {Mycobacterium tuberculosis} Length = 148 Back     alignment and structure
>1vee_A Proline-rich protein family; hypothetical protein, structural genomics, rhodanese domain, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} PDB: 2dcq_A Length = 134 Back     alignment and structure
>3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} Length = 466 Back     alignment and structure
>3ilm_A ALR3790 protein; rhodanese-like, NSR437H, NESG, structural genomics, protein structure initiative, northeast structural genomics consortium; 2.26A {Nostoc SP} PDB: 2kl3_A Length = 141 Back     alignment and structure
>2k0z_A Uncharacterized protein HP1203; A/B domain, structural genomics, unknown function, PSI-2, PR structure initiative; NMR {Helicobacter pylori} Length = 110 Back     alignment and structure
>3hix_A ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q8YQN0_anAsp, NSR437I, NESG, structural genomics, PSI-2, protein structure initiative; 1.92A {Anabaena SP} PDB: 3k9r_A Length = 106 Back     alignment and structure
>3foj_A Uncharacterized protein; protein SSP1007, structural genomics, PSI-2, protein structure initiative; 1.60A {Staphylococcus saprophyticus subsp} Length = 100 Back     alignment and structure
>3gk5_A Uncharacterized rhodanese-related protein TVG0868615; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Thermoplasma volcanium GSS1} Length = 108 Back     alignment and structure
>2jtq_A Phage shock protein E; solution structure rhodanese, stress response, transferase; NMR {Escherichia coli} PDB: 2jtr_A 2jts_A Length = 85 Back     alignment and structure
>3nhv_A BH2092 protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.50A {Bacillus halodurans} PDB: 3o3w_A Length = 144 Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Length = 588 Back     alignment and structure
>1t3k_A Arath CDC25, dual-specificity tyrosine phosphatase; cell cycle, phosphorylation, plant, hydrolase; NMR {Arabidopsis thaliana} SCOP: c.46.1.1 Length = 152 Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Length = 565 Back     alignment and structure
>3g5j_A Putative ATP/GTP binding protein; N-terminal domain of ATP/GTP binding protein, PSI, MCSG, STR genomics, protein structure initiative; HET: PGE; 1.76A {Clostridium difficile} Length = 134 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query217
3iwh_A103 Rhodanese-like domain protein; alpha-beta-alpha sa 99.93
3foj_A100 Uncharacterized protein; protein SSP1007, structur 99.92
3eme_A103 Rhodanese-like domain protein; alpha-beta-alpha sa 99.92
3hix_A106 ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q 99.92
3gk5_A108 Uncharacterized rhodanese-related protein TVG08686 99.92
1tq1_A129 AT5G66040, senescence-associated family protein; C 99.92
1gmx_A108 GLPE protein; transferase, rhodanese, sulfurtransf 99.91
3d1p_A139 Putative thiosulfate sulfurtransferase YOR285W; at 99.91
3ilm_A141 ALR3790 protein; rhodanese-like, NSR437H, NESG, st 99.91
2hhg_A139 Hypothetical protein RPA3614; MCSG, structural gen 99.91
1qxn_A137 SUD, sulfide dehydrogenase; polysulfide-sulfur tra 99.9
3nhv_A144 BH2092 protein; alpha-beta protein, structural gen 99.89
2k0z_A110 Uncharacterized protein HP1203; A/B domain, struct 99.88
3flh_A124 Uncharacterized protein LP_1913; alpha-beta protei 99.88
1t3k_A152 Arath CDC25, dual-specificity tyrosine phosphatase 99.87
1vee_A134 Proline-rich protein family; hypothetical protein, 99.87
2fsx_A148 RV0390, COG0607: rhodanese-related sulfurtransfera 99.87
1wv9_A94 Rhodanese homolog TT1651; CDC25, phosphatase, sulf 99.87
1e0c_A 271 Rhodanese, sulfurtransferase; sulfur metabolism, t 99.86
3i2v_A127 Adenylyltransferase and sulfurtransferase MOCS3; r 99.86
1urh_A 280 3-mercaptopyruvate sulfurtransferase; rhodanese; 2 99.86
3g5j_A134 Putative ATP/GTP binding protein; N-terminal domai 99.86
1e0c_A271 Rhodanese, sulfurtransferase; sulfur metabolism, t 99.85
2jtq_A85 Phage shock protein E; solution structure rhodanes 99.85
3hzu_A 318 Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, 99.84
1c25_A161 CDC25A; hydrolase, cell cycle phosphatase,dual spe 99.83
3aay_A 277 Putative thiosulfate sulfurtransferase; sulfurtran 99.83
1rhs_A 296 Sulfur-substituted rhodanese; transferase, sulfurt 99.83
1rhs_A296 Sulfur-substituted rhodanese; transferase, sulfurt 99.82
3olh_A 302 MST, 3-mercaptopyruvate sulfurtransferase; structu 99.82
2ouc_A142 Dual specificity protein phosphatase 10; rhodanese 99.82
1uar_A285 Rhodanese; sulfurtransferase, riken structural gen 99.82
3olh_A302 MST, 3-mercaptopyruvate sulfurtransferase; structu 99.82
1urh_A280 3-mercaptopyruvate sulfurtransferase; rhodanese; 2 99.82
2j6p_A152 SB(V)-AS(V) reductase; arsenate reductase, antimon 99.82
1uar_A 285 Rhodanese; sulfurtransferase, riken structural gen 99.82
3hzu_A318 Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, 99.81
1yt8_A 539 Thiosulfate sulfurtransferase; rhodanase domains, 99.81
3aay_A277 Putative thiosulfate sulfurtransferase; sulfurtran 99.81
1qb0_A211 Protein (M-phase inducer phosphatase 2 (CDC25B)); 99.81
2vsw_A153 Dual specificity protein phosphatase 16; hydrolase 99.81
2a2k_A175 M-phase inducer phosphatase 2; dual specificity, s 99.8
4f67_A265 UPF0176 protein LPG2838; structural genomics, PSI- 99.8
1okg_A 373 Possible 3-mercaptopyruvate sulfurtransferase; rho 99.79
3op3_A216 M-phase inducer phosphatase 3; structural genomics 99.78
2eg4_A230 Probable thiosulfate sulfurtransferase; structural 99.78
3tp9_A474 Beta-lactamase and rhodanese domain protein; struc 99.77
1yt8_A539 Thiosulfate sulfurtransferase; rhodanase domains, 99.77
2wlr_A423 Putative thiosulfate sulfurtransferase YNJE; rhoda 99.77
3f4a_A169 Uncharacterized protein YGR203W; protein phosphata 99.76
2wlr_A 423 Putative thiosulfate sulfurtransferase YNJE; rhoda 99.76
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 99.74
1whb_A157 KIAA0055; deubiqutinating enzyme, UBPY, structural 99.74
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 99.73
1hzm_A154 Dual specificity protein phosphatase 6; hydrolase; 99.73
3tg1_B158 Dual specificity protein phosphatase 10; kinase/rh 99.72
2gwf_A157 Ubiquitin carboxyl-terminal hydrolase 8; protein-p 99.72
2eg4_A230 Probable thiosulfate sulfurtransferase; structural 99.71
3utn_X 327 Thiosulfate sulfurtransferase TUM1; rhodanese-like 99.69
1okg_A373 Possible 3-mercaptopyruvate sulfurtransferase; rho 99.69
3tp9_A474 Beta-lactamase and rhodanese domain protein; struc 99.63
3utn_X327 Thiosulfate sulfurtransferase TUM1; rhodanese-like 99.62
3r2u_A466 Metallo-beta-lactamase family protein; structural 99.6
3r2u_A466 Metallo-beta-lactamase family protein; structural 99.24
2f46_A156 Hypothetical protein; structural genomics, joint c 97.86
4erc_A150 Dual specificity protein phosphatase 23; alpha bet 90.42
1v8c_A168 MOAD related protein; riken structural genomics/pr 89.54
1ywf_A296 Phosphotyrosine protein phosphatase PTPB; four str 86.4
2hcm_A164 Dual specificity protein phosphatase; structural g 86.11
1xri_A151 AT1G05000; structural genomics, protein structure 85.8
2nt2_A145 Protein phosphatase slingshot homolog 2; alpha/bet 84.84
2img_A151 Dual specificity protein phosphatase 23; DUSP23, V 83.51
1wrm_A165 Dual specificity phosphatase 22; DSP, JNK, hydrola 82.91
1yz4_A160 DUSP15, dual specificity phosphatase-like 15 isofo 82.31
3f81_A183 Dual specificity protein phosphatase 3; hydrolase, 81.96
3ezz_A144 Dual specificity protein phosphatase 4; alpha/beta 80.96
>3iwh_A Rhodanese-like domain protein; alpha-beta-alpha sandwich, structural genomics, C structural genomics of infectious diseases, csgid; 2.00A {Staphylococcus aureus subsp} PDB: 3mzz_A Back     alignment and structure
Probab=99.93  E-value=4.4e-26  Score=168.55  Aligned_cols=100  Identities=16%  Similarity=0.240  Sum_probs=86.5

Q ss_pred             CcccCHHHHHHHh--hCCcEEEecCChhhhhhccCCCcEeccCcccccchhHHHHHHhhhhccccccccCCcccCCChhH
Q 027877           50 IQPFTPKEAAAAM--KEGFMLLDIRPIWETEKARVKGSLHVPLFVEDRDYSAITLLKKWVHFGYIGLWTGQKFTMFNPNF  127 (217)
Q Consensus        50 ~~~is~~e~~~~l--~~~~~lIDvR~~~ey~~ghIpGAinip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  127 (217)
                      ++.|+++|+++.+  +++++|||||++.||..||||||+|+|+..+..                                
T Consensus         1 ~k~Is~~el~~~l~~~~~~~liDvR~~~e~~~ghIpgA~~ip~~~l~~--------------------------------   48 (103)
T 3iwh_A            1 MKSITTDELKNKLLESKPVQIVDVRTDEETAMGYIPNAKLIPMDTIPD--------------------------------   48 (103)
T ss_dssp             CCEECHHHHHHGGGSSSCCEEEECSCHHHHTTCBCTTCEECCGGGGGG--------------------------------
T ss_pred             CCCcCHHHHHHHHhCCCCeEEEECCChhHHhcCccCCcccCcccchhh--------------------------------
Confidence            4679999999988  567999999999999999999999999975432                                


Q ss_pred             HHHHHHhCCCCCCeEEEEeCCCchHHHHHHHHHHcCCcceeeccccHHHHHhCCCCccc
Q 027877          128 VRQVEAAVPDKESKLLVACGEGLRSMMAASKLYEGGYRNLGWLAGGFNRAIEGDFPEIE  186 (217)
Q Consensus       128 ~~~~~~~~~~~~~~IvlyC~~G~ra~~aa~~L~~~G~~nv~~l~GG~~~W~~~g~p~~~  186 (217)
                        . ...+ +++++||+||++|.||..++..|++.||+++ .|.||+.+|+++|+|+++
T Consensus        49 --~-~~~l-~~~~~ivv~C~~G~rS~~aa~~L~~~G~~~~-~l~GG~~~W~~~g~pves  102 (103)
T 3iwh_A           49 --N-LNSF-NKNEIYYIVCAGGVRSAKVVEYLEANGIDAV-NVEGGMHAWGDEGLEIKS  102 (103)
T ss_dssp             --C-GGGC-CTTSEEEEECSSSSHHHHHHHHHHTTTCEEE-EETTHHHHHCSSSCBCCC
T ss_pred             --h-hhhh-cCCCeEEEECCCCHHHHHHHHHHHHcCCCEE-EecChHHHHHHCCCccee
Confidence              1 1224 7889999999999999999999999999655 689999999999999874
>3foj_A Uncharacterized protein; protein SSP1007, structural genomics, PSI-2, protein structure initiative; 1.60A {Staphylococcus saprophyticus subsp} Back     alignment and structure
>3hix_A ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q8YQN0_anAsp, NSR437I, NESG, structural genomics, PSI-2, protein structure initiative; 1.92A {Anabaena SP} PDB: 3k9r_A Back     alignment and structure
>3gk5_A Uncharacterized rhodanese-related protein TVG0868615; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Thermoplasma volcanium GSS1} Back     alignment and structure
>1tq1_A AT5G66040, senescence-associated family protein; CESG, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: c.46.1.3 Back     alignment and structure
>1gmx_A GLPE protein; transferase, rhodanese, sulfurtransferase, glycerol metabolism; 1.1A {Escherichia coli} SCOP: c.46.1.3 PDB: 1gn0_A Back     alignment and structure
>3d1p_A Putative thiosulfate sulfurtransferase YOR285W; atomic structure, atomic resolution structure, PSI, MCSG; HET: MSE; 0.98A {Saccharomyces cerevisiae} Back     alignment and structure
>3ilm_A ALR3790 protein; rhodanese-like, NSR437H, NESG, structural genomics, protein structure initiative, northeast structural genomics consortium; 2.26A {Nostoc SP} PDB: 2kl3_A Back     alignment and structure
>2hhg_A Hypothetical protein RPA3614; MCSG, structural genomics, rohopseudom palustris, PSI-2, protein structure initiative; 1.20A {Rhodopseudomonas palustris} Back     alignment and structure
>1qxn_A SUD, sulfide dehydrogenase; polysulfide-sulfur transferase, homodimer; NMR {Wolinella succinogenes} SCOP: c.46.1.3 Back     alignment and structure
>3nhv_A BH2092 protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.50A {Bacillus halodurans} PDB: 3o3w_A Back     alignment and structure
>2k0z_A Uncharacterized protein HP1203; A/B domain, structural genomics, unknown function, PSI-2, PR structure initiative; NMR {Helicobacter pylori} Back     alignment and structure
>3flh_A Uncharacterized protein LP_1913; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} PDB: 3fnj_A 3i3u_A Back     alignment and structure
>1t3k_A Arath CDC25, dual-specificity tyrosine phosphatase; cell cycle, phosphorylation, plant, hydrolase; NMR {Arabidopsis thaliana} SCOP: c.46.1.1 Back     alignment and structure
>1vee_A Proline-rich protein family; hypothetical protein, structural genomics, rhodanese domain, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} PDB: 2dcq_A Back     alignment and structure
>2fsx_A RV0390, COG0607: rhodanese-related sulfurtransferase; RV0390 BR SAD DATA with FBAR, structural genomics, PSI; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>1wv9_A Rhodanese homolog TT1651; CDC25, phosphatase, sulfurtransferase, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} Back     alignment and structure
>1e0c_A Rhodanese, sulfurtransferase; sulfur metabolism, thiosulfate:cyanide sulfurtransferase; 1.8A {Azotobacter vinelandii} SCOP: c.46.1.2 c.46.1.2 PDB: 1h4k_X 1h4m_X Back     alignment and structure
>3i2v_A Adenylyltransferase and sulfurtransferase MOCS3; rhodanese, UBA4, structural genomics, ubiquitin biology, structural genomics consortium, SGC; 1.25A {Homo sapiens} Back     alignment and structure
>1urh_A 3-mercaptopyruvate sulfurtransferase; rhodanese; 2.8A {Escherichia coli} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>3g5j_A Putative ATP/GTP binding protein; N-terminal domain of ATP/GTP binding protein, PSI, MCSG, STR genomics, protein structure initiative; HET: PGE; 1.76A {Clostridium difficile} Back     alignment and structure
>1e0c_A Rhodanese, sulfurtransferase; sulfur metabolism, thiosulfate:cyanide sulfurtransferase; 1.8A {Azotobacter vinelandii} SCOP: c.46.1.2 c.46.1.2 PDB: 1h4k_X 1h4m_X Back     alignment and structure
>2jtq_A Phage shock protein E; solution structure rhodanese, stress response, transferase; NMR {Escherichia coli} PDB: 2jtr_A 2jts_A Back     alignment and structure
>3hzu_A Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, infectious disease, transferase structural genomics; 2.10A {Mycobacterium tuberculosis} PDB: 3p3a_A Back     alignment and structure
>1c25_A CDC25A; hydrolase, cell cycle phosphatase,dual specificity protein phosphatase, CDK2; 2.30A {Homo sapiens} SCOP: c.46.1.1 Back     alignment and structure
>3aay_A Putative thiosulfate sulfurtransferase; sulfurtranserase, structural genomics, PSI, structure initiative; 1.90A {Mycobacterium tuberculosis} PDB: 3aax_A 3hwi_A Back     alignment and structure
>1rhs_A Sulfur-substituted rhodanese; transferase, sulfurtransferase; 1.36A {Bos taurus} SCOP: c.46.1.2 c.46.1.2 PDB: 1boh_A 1boi_A 1orb_A 2ora_A 1dp2_A* 1rhd_A Back     alignment and structure
>1rhs_A Sulfur-substituted rhodanese; transferase, sulfurtransferase; 1.36A {Bos taurus} SCOP: c.46.1.2 c.46.1.2 PDB: 1boh_A 1boi_A 1orb_A 2ora_A 1dp2_A* 1rhd_A Back     alignment and structure
>3olh_A MST, 3-mercaptopyruvate sulfurtransferase; structural genomics, structural genomics consortium, SGC, RH fold; 2.50A {Homo sapiens} Back     alignment and structure
>2ouc_A Dual specificity protein phosphatase 10; rhodanese fold, hydrolase; 2.20A {Homo sapiens} Back     alignment and structure
>1uar_A Rhodanese; sulfurtransferase, riken structural genomics/PROT initiative, RSGI, structural genomics, transferase; 1.70A {Thermus thermophilus} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>3olh_A MST, 3-mercaptopyruvate sulfurtransferase; structural genomics, structural genomics consortium, SGC, RH fold; 2.50A {Homo sapiens} Back     alignment and structure
>1urh_A 3-mercaptopyruvate sulfurtransferase; rhodanese; 2.8A {Escherichia coli} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>2j6p_A SB(V)-AS(V) reductase; arsenate reductase, antimonate reductase, CDC25 phosphatase, rhodanese, C-MYC epitope, oxidoreductase; HET: EPE; 2.15A {Leishmania major} Back     alignment and structure
>1uar_A Rhodanese; sulfurtransferase, riken structural genomics/PROT initiative, RSGI, structural genomics, transferase; 1.70A {Thermus thermophilus} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>3hzu_A Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, infectious disease, transferase structural genomics; 2.10A {Mycobacterium tuberculosis} PDB: 3p3a_A Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Back     alignment and structure
>3aay_A Putative thiosulfate sulfurtransferase; sulfurtranserase, structural genomics, PSI, structure initiative; 1.90A {Mycobacterium tuberculosis} PDB: 3aax_A 3hwi_A Back     alignment and structure
>1qb0_A Protein (M-phase inducer phosphatase 2 (CDC25B)); hydrolase, cell cycle phosphatase, dual specificity protein phosphatase; 1.91A {Homo sapiens} SCOP: c.46.1.1 PDB: 1cwr_A 1cws_A 2uzq_A Back     alignment and structure
>2vsw_A Dual specificity protein phosphatase 16; hydrolase, dual specificity phosphatase, nucleus, cytoplasm, rhodanese domain, CAsp8; 2.20A {Homo sapiens} PDB: 3tg3_A Back     alignment and structure
>2a2k_A M-phase inducer phosphatase 2; dual specificity, substrate trapping, active site mutant, hydrolase; 1.52A {Homo sapiens} PDB: 2ifv_A 1ymd_A 1ym9_A 1ymk_A 1yml_A 1ys0_A 1cwt_A 2ifd_A Back     alignment and structure
>4f67_A UPF0176 protein LPG2838; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium; 1.79A {Legionella pneumophila subsp} Back     alignment and structure
>1okg_A Possible 3-mercaptopyruvate sulfurtransferase; rhodanese, prolyl isomerase, catalytic triad, serine protease, leishmania pyruvate; HET: CSR; 2.10A {Leishmania major} SCOP: c.46.1.2 c.46.1.2 d.26.1.3 Back     alignment and structure
>3op3_A M-phase inducer phosphatase 3; structural genomics, structural genomics consortium, SGC, Al alpha sandwich, kinase, cytosol, hydrolase; 2.63A {Homo sapiens} Back     alignment and structure
>2eg4_A Probable thiosulfate sulfurtransferase; structural genomics, NPPSFA, national Pro protein structural and functional analyses; 1.70A {Thermus thermophilus} PDB: 2eg3_A Back     alignment and structure
>3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Back     alignment and structure
>2wlr_A Putative thiosulfate sulfurtransferase YNJE; rhodanese domains; HET: EPE; 1.45A {Escherichia coli} PDB: 2wlx_A* 3ipo_A* 3ipp_A Back     alignment and structure
>3f4a_A Uncharacterized protein YGR203W; protein phosphatase, rhodanese-like family, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.80A {Saccharomyces cerevisiae} PDB: 3fs5_A* Back     alignment and structure
>2wlr_A Putative thiosulfate sulfurtransferase YNJE; rhodanese domains; HET: EPE; 1.45A {Escherichia coli} PDB: 2wlx_A* 3ipo_A* 3ipp_A Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>1whb_A KIAA0055; deubiqutinating enzyme, UBPY, structural genomics, riken structural genomics/proteomics initiative, RSGI, hydrolase; NMR {Homo sapiens} SCOP: c.46.1.4 Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>1hzm_A Dual specificity protein phosphatase 6; hydrolase; NMR {Homo sapiens} SCOP: c.46.1.1 Back     alignment and structure
>3tg1_B Dual specificity protein phosphatase 10; kinase/rhodanese-like domain, docking interaction, transfera hydrolase complex; 2.71A {Homo sapiens} Back     alignment and structure
>2gwf_A Ubiquitin carboxyl-terminal hydrolase 8; protein-protein complex, E3 ligase, protein ubiquitination, hydrolase, protease, UBL conjugation pathway; 2.30A {Homo sapiens} SCOP: c.46.1.4 Back     alignment and structure
>2eg4_A Probable thiosulfate sulfurtransferase; structural genomics, NPPSFA, national Pro protein structural and functional analyses; 1.70A {Thermus thermophilus} PDB: 2eg3_A Back     alignment and structure
>3utn_X Thiosulfate sulfurtransferase TUM1; rhodanese-like domain; 1.90A {Saccharomyces cerevisiae} Back     alignment and structure
>1okg_A Possible 3-mercaptopyruvate sulfurtransferase; rhodanese, prolyl isomerase, catalytic triad, serine protease, leishmania pyruvate; HET: CSR; 2.10A {Leishmania major} SCOP: c.46.1.2 c.46.1.2 d.26.1.3 Back     alignment and structure
>3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3utn_X Thiosulfate sulfurtransferase TUM1; rhodanese-like domain; 1.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} Back     alignment and structure
>3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} Back     alignment and structure
>2f46_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.41A {Neisseria meningitidis Z2491} Back     alignment and structure
>4erc_A Dual specificity protein phosphatase 23; alpha beta, phosphatase(hydrolase), hydrolase; 1.15A {Homo sapiens} PDB: 2img_A Back     alignment and structure
>1v8c_A MOAD related protein; riken structural genomics/proteomics initiative, RSGI, structural genomics, protein binding; 1.60A {Thermus thermophilus} SCOP: d.15.3.1 d.129.5.1 Back     alignment and structure
>1ywf_A Phosphotyrosine protein phosphatase PTPB; four stranded parallel beta sheet with flanking helices, structural genomics, PSI; 1.71A {Mycobacterium tuberculosis} SCOP: c.45.1.5 PDB: 2oz5_A* Back     alignment and structure
>2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus} Back     alignment and structure
>1xri_A AT1G05000; structural genomics, protein structure initiative, CESG for eukaryotic structural genomics, phosphoprote phosphatase; 3.30A {Arabidopsis thaliana} SCOP: c.45.1.1 PDB: 2q47_A Back     alignment and structure
>2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} Back     alignment and structure
>2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} Back     alignment and structure
>1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens} Back     alignment and structure
>1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens} Back     alignment and structure
>3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1vhr_A* 1j4x_A* Back     alignment and structure
>3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1m3g_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 217
d1tq1a_119 c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senesc 4e-08
d1gmxa_108 c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia 6e-05
d2gwfa1135 c.46.1.4 (A:181-315) Ubiquitin carboxyl-terminal h 4e-04
d1e0ca2136 c.46.1.2 (A:136-271) Sulfurtransferase {Azotobacte 0.002
d1qxna_137 c.46.1.3 (A:) Polysulfide-sulfur transferase (sulf 0.004
>d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 119 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Rhodanese/Cell cycle control phosphatase
superfamily: Rhodanese/Cell cycle control phosphatase
family: Single-domain sulfurtransferase
domain: Thiosulfate sulfurtransferase/Senescence-associated protein
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score = 47.9 bits (113), Expect = 4e-08
 Identities = 25/130 (19%), Positives = 46/130 (35%), Gaps = 24/130 (18%)

Query: 54  TPKEAAAAMKEGFMLLDIRPIWETEKARVKGSLHVPLFVEDRDYSAITLLKKWVHFGYIG 113
           +   A   +  G   LD+R   E  +    G+++VP                        
Sbjct: 11  SVTVAHDLLLAGHRYLDVRTPEEFSQGHACGAINVPYM---------------------- 48

Query: 114 LWTGQKFTMFNPNFVRQVEAAVPDKESKLLVACGEGLRSMMAASKLYEGGYRNLGWLAGG 173
              G      N +F+ QV +    +   ++V C  G RS+ A + L   G+  +  + GG
Sbjct: 49  -NRGASGMSKNTDFLEQVSSHF-GQSDNIIVGCQSGGRSIKATTDLLHAGFTGVKDIVGG 106

Query: 174 FNRAIEGDFP 183
           ++   +   P
Sbjct: 107 YSAWAKNGLP 116
>d1gmxa_ c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia coli [TaxId: 562]} Length = 108 Back     information, alignment and structure
>d2gwfa1 c.46.1.4 (A:181-315) Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Human (Homo sapiens) [TaxId: 9606]} Length = 135 Back     information, alignment and structure
>d1e0ca2 c.46.1.2 (A:136-271) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} Length = 136 Back     information, alignment and structure
>d1qxna_ c.46.1.3 (A:) Polysulfide-sulfur transferase (sulfide dehydrogenase, Sud) {Wolinella succinogenes [TaxId: 844]} Length = 137 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query217
d1yt8a1136 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 99.93
d1tq1a_119 Thiosulfate sulfurtransferase/Senescence-associate 99.93
d1yt8a2101 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 99.91
d1urha1147 3-mercaptopyruvate sulfurtransferase {Escherichia 99.91
d1e0ca2136 Sulfurtransferase {Azotobacter vinelandii [TaxId: 99.91
d1gmxa_108 Sulfurtransferase GlpE {Escherichia coli [TaxId: 5 99.9
d1qxna_137 Polysulfide-sulfur transferase (sulfide dehydrogen 99.9
d1yt8a3157 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 99.9
d1rhsa1149 Rhodanese {Cow (Bos taurus) [TaxId: 9913]} 99.89
d1uara1143 Sulfurtransferase {Thermus thermophilus [TaxId: 27 99.89
d1e0ca1135 Sulfurtransferase {Azotobacter vinelandii [TaxId: 99.89
d1yt8a4130 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 99.88
d1uara2141 Sulfurtransferase {Thermus thermophilus [TaxId: 27 99.87
d1rhsa2144 Rhodanese {Cow (Bos taurus) [TaxId: 9913]} 99.87
d1t3ka_132 Dual specificity phosphatase Cdc25 {Thale cress (A 99.87
d1okga1156 3-mercaptopyruvate sulfurtransferase {Leishmania m 99.84
d1urha2120 3-mercaptopyruvate sulfurtransferase {Escherichia 99.83
d1okga2139 3-mercaptopyruvate sulfurtransferase {Leishmania m 99.8
d1c25a_161 CDC25a {Human (Homo sapiens) [TaxId: 9606]} 99.74
d2gwfa1135 Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Hum 99.7
d1ymka1174 CDC25b {Human (Homo sapiens) [TaxId: 9606]} 99.69
d1hzma_154 Erk2 binding domain of Mapk phosphatase mkp-3 {Hum 99.62
d1ywfa1272 Phosphotyrosine protein phosphatase PtpB {Mycobact 90.61
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 89.94
d1xria_151 Putative phosphatase At1g05000 {Thale cress (Arabi 88.91
d1jl3a_137 Arsenate reductase ArsC {Bacillus subtilis [TaxId: 88.03
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 83.81
d1jf8a_130 Arsenate reductase ArsC {Staphylococcus aureus [Ta 81.31
>d1yt8a1 c.46.1.2 (A:107-242) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Rhodanese/Cell cycle control phosphatase
superfamily: Rhodanese/Cell cycle control phosphatase
family: Multidomain sulfurtransferase (rhodanese)
domain: Thiosulfate sulfurtransferase PA2603
species: Pseudomonas aeruginosa [TaxId: 287]

Probab=99.93  E-value=1.2e-25  Score=172.28  Aligned_cols=118  Identities=20%  Similarity=0.318  Sum_probs=99.3

Q ss_pred             hhHHHHhh-cCCCcccCHHHHHHHh--hCCcEEEecCChhhhhhccCCCcEeccCcccccchhHHHHHHhhhhccccccc
Q 027877           39 SNARQLIQ-SGAIQPFTPKEAAAAM--KEGFMLLDIRPIWETEKARVKGSLHVPLFVEDRDYSAITLLKKWVHFGYIGLW  115 (217)
Q Consensus        39 ~~~~~~~~-~~~~~~is~~e~~~~l--~~~~~lIDvR~~~ey~~ghIpGAinip~~~~~~~~~~~~~~~~~~~~~~~~~~  115 (217)
                      +.+.+.+. ....+.|+++++.+++  +.+++|||||++.||..||||||+|+|...                       
T Consensus        11 k~fge~~e~~~~~~~Is~~el~~~l~~~~~~~liDvR~~~e~~~ghIpGAi~ip~~~-----------------------   67 (136)
T d1yt8a1          11 KAFGELVEAERHTPSLAAEEVQALLDARAEAVILDARRFDEYQTMSIPGGISVPGAE-----------------------   67 (136)
T ss_dssp             HHHHHHHHHHHCCCEECHHHHHHHHHTTCSEEEEECSCHHHHHHSBCTTCEECCGGG-----------------------
T ss_pred             ccHHHHHHHHcCCCccCHHHHHHHHhcCCCcEEEEcCChhhccceecCCchhhhhhH-----------------------
Confidence            33444332 3556789999999988  566899999999999999999999999863                       


Q ss_pred             cCCcccCCChhHHHHHHHhCCCCCCeEEEEeCCCchHHHHHHHHHHcCCcc-eeeccccHHHHHhCCCCcccCCcc
Q 027877          116 TGQKFTMFNPNFVRQVEAAVPDKESKLLVACGEGLRSMMAASKLYEGGYRN-LGWLAGGFNRAIEGDFPEIEGKEK  190 (217)
Q Consensus       116 ~~~~~~~~~~~~~~~~~~~~~~~~~~IvlyC~~G~ra~~aa~~L~~~G~~n-v~~l~GG~~~W~~~g~p~~~~~~~  190 (217)
                                 +...+.+..++++++||+||++|.||..++..|+..||+| |++|+||+.+|+.+|+|++++..+
T Consensus        68 -----------l~~~~~~l~~~~~~~iV~~C~~g~rs~~aa~~L~~~G~~~~V~~L~GG~~~W~~~G~pve~g~~~  132 (136)
T d1yt8a1          68 -----------LVLRVAELAPDPRTRVIVNCAGRTRSIIGTQSLLNAGIPNPVAALRNGTIGWTLAGQQLEHGQTR  132 (136)
T ss_dssp             -----------HHHHHHHHCCSTTSEEEEECSSSHHHHHHHHHHHHTTCSSCEEEETTHHHHHHHTTCCCBCSCCC
T ss_pred             -----------HHHHhhcccccccceEEEEcCCCCchHHHHHHHHHcCCCceEEEeCCcHHHHHHCCCCceeCCCC
Confidence                       3444555555788899999999999999999999999987 999999999999999999988643
>d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1yt8a2 c.46.1.2 (A:6-106) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1urha1 c.46.1.2 (A:2-148) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e0ca2 c.46.1.2 (A:136-271) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1gmxa_ c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qxna_ c.46.1.3 (A:) Polysulfide-sulfur transferase (sulfide dehydrogenase, Sud) {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1yt8a3 c.46.1.2 (A:373-529) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1rhsa1 c.46.1.2 (A:1-149) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1uara1 c.46.1.2 (A:2-144) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e0ca1 c.46.1.2 (A:1-135) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1yt8a4 c.46.1.2 (A:243-372) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1uara2 c.46.1.2 (A:145-285) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1rhsa2 c.46.1.2 (A:150-293) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1t3ka_ c.46.1.1 (A:) Dual specificity phosphatase Cdc25 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1okga1 c.46.1.2 (A:7-162) 3-mercaptopyruvate sulfurtransferase {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1urha2 c.46.1.2 (A:149-268) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1okga2 c.46.1.2 (A:163-301) 3-mercaptopyruvate sulfurtransferase {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1c25a_ c.46.1.1 (A:) CDC25a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gwfa1 c.46.1.4 (A:181-315) Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ymka1 c.46.1.1 (A:377-550) CDC25b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hzma_ c.46.1.1 (A:) Erk2 binding domain of Mapk phosphatase mkp-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywfa1 c.45.1.5 (A:4-275) Phosphotyrosine protein phosphatase PtpB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xria_ c.45.1.1 (A:) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jl3a_ c.44.1.1 (A:) Arsenate reductase ArsC {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1jf8a_ c.44.1.1 (A:) Arsenate reductase ArsC {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure