Citrus Sinensis ID: 027921

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------
MLKLWKWYQNCLAVHPLKTQVISSGFLWGVGDIAAQYITHATAKSRLQLSDADEKFKVNWKRVAVTSSFGFGFVGPVGHFWYEGLDRFIRLKLQLPPKSARFVATKVAMDSIIFGPLDLFVFFTYMGFSTGKNVAQVKEDLKRDFLPALVLEGGIWPIVQVANFRYVPVRYQLLYVNIFCLLDSAFLSWVEQQKDAAWKQWFTSFHSLEERGGKGGL
cHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHcccccccccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccccccHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHcccccHHHccccccc
MLKLWKWYQNCLAVHPLKTQVISSGFLWGVGDIAAQYITHATA**********EKFKVNWKRVAVTSSFGFGFVGPVGHFWYEGLDRFIRLKLQLPPKSARFVATKVAMDSIIFGPLDLFVFFTYMGFSTGKNVAQVKEDLKRDFLPALVLEGGIWPIVQVANFRYVPVRYQLLYVNIFCLLDSAFLSWVEQQKDAAWKQWFTSFH***********
xxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLKLWKWYQNCLAVHPLKTQVISSGFLWGVGDIAAQYITHATAKSRLQLSDADEKFKVNWKRVAVTSSFGFGFVGPVGHFWYEGLDRFIRLKLQLPPKSARFVATKVAMDSIIFGPLDLFVFFTYMGFSTGKNVAQVKEDLKRDFLPALVLEGGIWPIVQVANFRYVPVRYQLLYVNIFCLLDSAFLSWVEQQKDAAWKQWFTSFHSLEERGGKGGL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein Mpv17 Involved in mitochondria homeostasis. May be involved in the metabolism of reactive oxygen species and control of oxidative phosphorylation and mitochondrial DNA (mtDNA) maintenance.probableQ5BK62
PXMP2/4 family protein 2 probableQ54XX9
Protein Mpv17 Involved in mitochondria homeostasis. May be involved in the metabolism of reactive oxygen species and control of oxidative phosphorylation and mitochondrial DNA (mtDNA) maintenance.probableP19258

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted