Citrus Sinensis ID: 027945


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210------
MKLKQLESVLGDLEQFSNPKVELEQYPTGPHIASRMLYTAENSFGDVSNKVVADFGCGCGTLGAAATLLGADQVIAIDIDSDSLELASENAADLELDIDFVQCDIRNLEWRVCSVGHVDTVVMNPPFGTRKKGVDMDFLSMALKVASQAVYSLHKTSTREHVKKAALRDFNASSAEVLCELRYDVPQLYKFHKKKEVDIAVDLWRFVPKRNLGRGI
cccHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHcccccccEEEEcccccHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHccccEEEEEcccccccHHHcccccccEEEEccccccccccccHHHHHHHHHcccccEEEEEccccHHHHHHHHHHHcccccEEEEEEEccccccccccccccEEEEEEEEEEEEEcccccccc
*KLKQLESVLGDLEQFSNPKVELEQYPTGPHIASRMLYTAENSFGDVSNKVVADFGCGCGTLGAAATLLGADQVIAIDIDSDSLELASENAADLELDIDFVQCDIRNLEWRVCSVGHVDTVVMNPPFGTRKKGVDMDFLSMALKVASQAVYSLHKTSTREHVKKAALRDFNASSAEVLCELRYDVPQLYKFHKKKEVDIAVDLWRFVP*R******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKLKQLESVLGDLEQFSNPKVELEQYPTGPHIASRMLYTAENSFGDVSNKVVADFGCGCGTLGAAATLLGADQVIAIDIDSDSxxxxxxxxxxxxxxxxxxxxxxxxxxxxVCSVGHVDTVVMNPPFGTRKKGVDMDFLSMALKVASQAVYSLHKTSTREHVKKAALRDFNASSAEVLCELRYDVPQLYKFHKKKEVDIAVDLWRFVPKRNLGRGI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Methyltransferase-like protein 5 Probable methyltransferase.probableQ8K1A0
Methyltransferase-like protein 5 Probable methyltransferase.probableQ9NRN9
Uncharacterized protein MJ0284 probableQ57732

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WY7, chain A
Confidence level:very confident
Coverage over the Query: 2-209
View the alignment between query and template
View the model in PyMOL