Citrus Sinensis ID: 027950


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210------
MLDRRLTRQMSRQSSFDPRRNNMRFSFGRQSSLDPIRRSPVQDELTVPENLDSTMQLLFMACSGDVKGVEDLLNEGIDVNSIDLDGRTALHIAACEGHVEVVKLLLSKKANIDARDRWGSTAAADAKYYGNVEVYNILKARGAKVPKTKRTPMTVANPREVPEYELNPLELQVRKADGITKAWPVPLIFVHYVILLRQAGSFNQELEYVNGIFVQT
cHHHHHHHHccccccccccccHHHHHHHHHccHHHHHHccccccccccccccccHHHHHHHHcccHHHHHHHHHcccccccccccccHHHHHHHHcccHHHHHHHHHcccccccccccccHHHHHHHHcccHHHHHHHHHccccccccccHHHHHHccccccEEEEcccccccccccccccccccccHHHHHHHHHHHHccccccHHHHHHccccc
cccccccccccccccccHHHHHHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHHcccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccHHHHHcHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHccccccccccccEEEEEc
mldrrltrqmsrqssfdprrnnmrfsfgrqssldpirrspvqdeltvpenLDSTMQLLFMACSGDVKGVEDLLnegidvnsidldgrtaLHIAACEGHVEVVKLLLSKKANIDARDRWGSTAAADAKYYGNVEVYNILKArgakvpktkrtpmtvanprevpeyelnplELQVRKadgitkawpvpLIFVHYVILLRQagsfnqeleyvngifvqt
mldrrltrqmsrqssfdprrnnmrfsfgrqssldpirrspVQDELTVPENLDSTMQLLFMACSGDVKGVEDLLNEGIDVNSIDLDGRTALHIAACEGHVEVVKLLLSKkanidardrwgstaaadakyygnVEVYNILkargakvpktkrtpmtvanprevpeyelNPLELQVRKADGITKAWPVPLIFVHYVILLRQAGSFNQELEYVNGIFVQT
MLDRRLTRQMSRQSSFDPRRNNMRFSFGRQSSLDPIRRSPVQDELTVPENLDSTMQLLFMACSGDVKGVEDLLNEGIDVNSIDLDGRTALHIAACEGHVEVVKLLLSKKANIDARDRWGSTAAADAKYYGNVEVYNILKARGAKVPKTKRTPMTVANPREVPEYELNPLELQVRKADGITKAWPVPLIFVHYVILLRQAGSFNQELEYVNGIFVQT
****************************************************STMQLLFMACSGDVKGVEDLLNEGIDVNSIDLDGRTALHIAACEGHVEVVKLLLSKKANIDARDRWGSTAAADAKYYGNVEVYNILKARGA********************YELNPLELQVRKADGITKAWPVPLIFVHYVILLRQAGSFNQELEYVNGIFV**
MLDRRLTRQMSRQSSFDPRRNNMRFSFGRQSSLDPIRRSPVQDELTVPENLDSTMQLLFMACSGDVKGVEDLLNEGIDVNSIDLDGRTALHIAACEGHVEVVKLLLSKKANIDARDRWGSTAAADAKYYGNVEVYNILKARGAKVPKTKRTPMTVANPREVPEYELNPLELQVRKADGITKAWPVPLIFVHYVILLRQAGSFNQELEYVNGIFVQ*
****************DPRRNNMRFSFGRQSSLDPIRRSPVQDELTVPENLDSTMQLLFMACSGDVKGVEDLLNEGIDVNSIDLDGRTALHIAACEGHVEVVKLLLSKKANIDARDRWGSTAAADAKYYGNVEVYNILKARGAKVPKTKRTPMTVANPREVPEYELNPLELQVRKADGITKAWPVPLIFVHYVILLRQAGSFNQELEYVNGIFVQT
*****LTRQMSRQSSFDPRRNNMRFSFGRQSSLDPIRRSPVQDELTVPENLDSTMQLLFMACSGDVKGVEDLLNEGIDVNSIDLDGRTALHIAACEGHVEVVKLLLSKKANIDARDRWGSTAAADAKYYGNVEVYNILKARGAKVPKTKRTPMTVANPREVPEYELNPLELQVRKADGITKAWPVPLIFVHYVILLRQAGSFNQELEYVNGIFVQT
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLDRRLTRQMSRQSSFDPRRNNMRFSFGRQSSLDPIRRSPVQDELTVPENLDSTMQLLFMACSGDVKGVEDLLNEGIDVNSIDLDGRTALHIAACEGHVEVVKLLLSKKANIDARDRWGSTAAADAKYYGNVEVYNILKARGAKVPKTKRTPMTVANPREVPEYELNPLELQVRKADGITKAWPVPLIFVHYVILLRQAGSFNQELEYVNGIFVQT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query216 2.2.26 [Sep-21-2011]
D3Z7P3674 Glutaminase kidney isofor yes no 0.421 0.135 0.423 3e-13
P13264674 Glutaminase kidney isofor yes no 0.421 0.135 0.423 3e-13
O94925669 Glutaminase kidney isofor yes no 0.421 0.136 0.423 4e-13
Q9UI32602 Glutaminase liver isoform no no 0.402 0.144 0.431 1e-12
Q571F8602 Glutaminase liver isoform no no 0.402 0.144 0.420 5e-12
P28492602 Glutaminase liver isoform no no 0.402 0.144 0.409 9e-12
G5E8K5 1961 Ankyrin-3 OS=Mus musculus no no 0.430 0.047 0.404 1e-11
Q12955 4377 Ankyrin-3 OS=Homo sapiens no no 0.393 0.019 0.409 3e-11
Q01484 3957 Ankyrin-2 OS=Homo sapiens no no 0.449 0.024 0.367 4e-11
Q8C8R3 3898 Ankyrin-2 OS=Mus musculus no no 0.449 0.024 0.367 4e-11
>sp|D3Z7P3|GLSK_MOUSE Glutaminase kidney isoform, mitochondrial OS=Mus musculus GN=Gls PE=1 SV=1 Back     alignment and function desciption
 Score = 75.1 bits (183), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 57/92 (61%), Gaps = 1/92 (1%)

Query: 49  ENLDSTMQLLFMACSGDVKGVEDLLNEGIDVNSIDLDGRTALHIAACEGHVEVVKLLL-S 107
           + + S + LLF A +GDV  +       +D+   D D RTALH+AA EGHVEVVK LL +
Sbjct: 554 QRVKSVINLLFAAYTGDVSALRRFALSAMDMEQRDYDSRTALHVAAAEGHVEVVKFLLEA 613

Query: 108 KKANIDARDRWGSTAAADAKYYGNVEVYNILK 139
            K N   +DRW +T   +A ++G+ +V+ IL+
Sbjct: 614 CKVNPFPKDRWNNTPMDEALHFGHHDVFKILQ 645




Catalyzes the first reaction in the primary pathway for the renal catabolism of glutamine. Plays a role in maintaining acid-base homeostasis. Regulates the levels of the neurotransmitter glutamate in the brain.
Mus musculus (taxid: 10090)
EC: 3EC: .EC: 5EC: .EC: 1EC: .EC: 2
>sp|P13264|GLSK_RAT Glutaminase kidney isoform, mitochondrial OS=Rattus norvegicus GN=Gls PE=1 SV=2 Back     alignment and function description
>sp|O94925|GLSK_HUMAN Glutaminase kidney isoform, mitochondrial OS=Homo sapiens GN=GLS PE=1 SV=1 Back     alignment and function description
>sp|Q9UI32|GLSL_HUMAN Glutaminase liver isoform, mitochondrial OS=Homo sapiens GN=GLS2 PE=1 SV=2 Back     alignment and function description
>sp|Q571F8|GLSL_MOUSE Glutaminase liver isoform, mitochondrial OS=Mus musculus GN=Gls2 PE=2 SV=2 Back     alignment and function description
>sp|P28492|GLSL_RAT Glutaminase liver isoform, mitochondrial OS=Rattus norvegicus GN=Gls2 PE=2 SV=3 Back     alignment and function description
>sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 Back     alignment and function description
>sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 Back     alignment and function description
>sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 Back     alignment and function description
>sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query216
147802196 495 hypothetical protein VITISV_010336 [Viti 0.837 0.365 0.861 7e-88
225434181 472 PREDICTED: dual specificity protein kina 0.837 0.383 0.861 8e-88
255577895 482 ankyrin-kinase, putative [Ricinus commun 0.837 0.375 0.842 1e-86
357519311 458 Dual specificity tyrosine-phosphorylatio 0.828 0.390 0.857 1e-86
356512588 474 PREDICTED: serine/threonine-protein kina 0.837 0.381 0.841 3e-86
18700701 477 ankyrin-kinase [Medicago truncatula] 0.828 0.375 0.852 3e-86
356525359 475 PREDICTED: serine/threonine-protein kina 0.837 0.381 0.836 9e-86
449438147 473 PREDICTED: serine/threonine-protein kina 0.837 0.382 0.829 5e-85
449520086 473 PREDICTED: serine/threonine-protein kina 0.837 0.382 0.829 2e-84
42569534 476 Integrin-linked protein kinase-like prot 0.837 0.380 0.826 8e-84
>gi|147802196|emb|CAN63815.1| hypothetical protein VITISV_010336 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  328 bits (842), Expect = 7e-88,   Method: Compositional matrix adjust.
 Identities = 156/181 (86%), Positives = 167/181 (92%)

Query: 2   LDRRLTRQMSRQSSFDPRRNNMRFSFGRQSSLDPIRRSPVQDELTVPENLDSTMQLLFMA 61
           L R L+RQ SRQSS DPRR N+RFS GRQSSLDPIRRSPV +EL+VPENLDSTMQ+LFMA
Sbjct: 20  LLRTLSRQFSRQSSLDPRRTNLRFSLGRQSSLDPIRRSPVNEELSVPENLDSTMQMLFMA 79

Query: 62  CSGDVKGVEDLLNEGIDVNSIDLDGRTALHIAACEGHVEVVKLLLSKKANIDARDRWGST 121
           C GDVKGVEDLLNEG DVNSIDLDGRTALHIAACEG +EVVKLLLS+KANIDARDRWGST
Sbjct: 80  CRGDVKGVEDLLNEGTDVNSIDLDGRTALHIAACEGQIEVVKLLLSRKANIDARDRWGST 139

Query: 122 AAADAKYYGNVEVYNILKARGAKVPKTKRTPMTVANPREVPEYELNPLELQVRKADGITK 181
           AAADAKYYGNVE+YNILKARGAK PK ++TPM VANPREVPEYELNPLELQVRK+DGITK
Sbjct: 140 AAADAKYYGNVEIYNILKARGAKTPKIRKTPMAVANPREVPEYELNPLELQVRKSDGITK 199

Query: 182 A 182
            
Sbjct: 200 G 200




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225434181|ref|XP_002279175.1| PREDICTED: dual specificity protein kinase shkC-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255577895|ref|XP_002529820.1| ankyrin-kinase, putative [Ricinus communis] gi|223530697|gb|EEF32569.1| ankyrin-kinase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|357519311|ref|XP_003629944.1| Dual specificity tyrosine-phosphorylation-regulated kinase 1A [Medicago truncatula] gi|355523966|gb|AET04420.1| Dual specificity tyrosine-phosphorylation-regulated kinase 1A [Medicago truncatula] Back     alignment and taxonomy information
>gi|356512588|ref|XP_003525000.1| PREDICTED: serine/threonine-protein kinase CTR1-like [Glycine max] Back     alignment and taxonomy information
>gi|18700701|gb|AAL78674.1|AF458699_1 ankyrin-kinase [Medicago truncatula] Back     alignment and taxonomy information
>gi|356525359|ref|XP_003531292.1| PREDICTED: serine/threonine-protein kinase CTR1-like [Glycine max] Back     alignment and taxonomy information
>gi|449438147|ref|XP_004136851.1| PREDICTED: serine/threonine-protein kinase TNNI3K-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449520086|ref|XP_004167065.1| PREDICTED: serine/threonine-protein kinase TNNI3K-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|42569534|ref|NP_180739.2| Integrin-linked protein kinase-like protein [Arabidopsis thaliana] gi|95147274|gb|ABF57272.1| At2g31800 [Arabidopsis thaliana] gi|330253491|gb|AEC08585.1| Integrin-linked protein kinase-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query216
TAIR|locus:2045258 476 AT2G31800 [Arabidopsis thalian 0.833 0.378 0.830 1.3e-77
TAIR|locus:2080517 477 AT3G59830 [Arabidopsis thalian 0.824 0.373 0.807 3.9e-76
TAIR|locus:2044034 479 AT2G43850 [Arabidopsis thalian 0.824 0.371 0.804 1.7e-75
TAIR|locus:2117129 459 AT4G18950 [Arabidopsis thalian 0.717 0.337 0.478 2.8e-34
TAIR|locus:2098999 471 AT3G58760 [Arabidopsis thalian 0.712 0.326 0.455 3.3e-31
UNIPROTKB|B7Z509174 GLS "Glutaminase kidney isofor 0.421 0.522 0.423 1.1e-14
UNIPROTKB|F1NHF5540 GLS "Uncharacterized protein" 0.421 0.168 0.423 4.6e-14
UNIPROTKB|F1LR09567 Gls "Glutaminase kidney isofor 0.421 0.160 0.423 1.1e-13
UNIPROTKB|O94925669 GLS "Glutaminase kidney isofor 0.421 0.136 0.423 1.4e-13
MGI|MGI:95752674 Gls "glutaminase" [Mus musculu 0.421 0.135 0.423 1.4e-13
TAIR|locus:2045258 AT2G31800 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 781 (280.0 bits), Expect = 1.3e-77, P = 1.3e-77
 Identities = 152/183 (83%), Positives = 169/183 (92%)

Query:     2 LDRRLTRQMSRQSSFDPRRNNMRFSFGRQSSLDPIRRSPVQD---ELTVPENLDSTMQLL 58
             L R L+RQ +RQ+S DPRRNNMRFSFGRQSSLDPIRRSP      +L VP+NLD+TMQLL
Sbjct:    21 LRRTLSRQFTRQASHDPRRNNMRFSFGRQSSLDPIRRSPDGSNGPQLAVPDNLDATMQLL 80

Query:    59 FMACSGDVKGVEDLLNEGIDVNSIDLDGRTALHIAACEGHVEVVKLLLSKKANIDARDRW 118
             F+AC GDV+GV+DLL+EGIDVNSIDLDGRTALHIAACEGHV+VVKLLL++KANIDARDRW
Sbjct:    81 FVACRGDVEGVQDLLDEGIDVNSIDLDGRTALHIAACEGHVDVVKLLLTRKANIDARDRW 140

Query:   119 GSTAAADAKYYGNVEVYNILKARGAKVPKTKRTPMTVANPREVPEYELNPLELQVRKADG 178
             GSTAAADAKYYGN++V+NILKARGAKVPKTKRTPM VANPREVPEYELNP ELQVRKADG
Sbjct:   141 GSTAAADAKYYGNMDVFNILKARGAKVPKTKRTPMVVANPREVPEYELNPQELQVRKADG 200

Query:   179 ITK 181
             I+K
Sbjct:   201 ISK 203




GO:0004672 "protein kinase activity" evidence=IEA
GO:0004674 "protein serine/threonine kinase activity" evidence=IEA;IDA
GO:0005524 "ATP binding" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0006468 "protein phosphorylation" evidence=IEA
GO:0009966 "regulation of signal transduction" evidence=IEA
GO:0016301 "kinase activity" evidence=ISS
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0004712 "protein serine/threonine/tyrosine kinase activity" evidence=ISS
GO:0046777 "protein autophosphorylation" evidence=IDA
TAIR|locus:2080517 AT3G59830 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2044034 AT2G43850 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2117129 AT4G18950 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2098999 AT3G58760 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|B7Z509 GLS "Glutaminase kidney isoform, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1NHF5 GLS "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1LR09 Gls "Glutaminase kidney isoform, mitochondrial" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|O94925 GLS "Glutaminase kidney isoform, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:95752 Gls "glutaminase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00034725001
SubName- Full=Chromosome chr5 scaffold_72, whole genome shotgun sequence; (476 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query216
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-25
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 3e-21
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 8e-21
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 1e-19
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 7e-14
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 3e-12
pfam0002333 pfam00023, Ank, Ankyrin repeat 5e-12
PLN03192 823 PLN03192, PLN03192, Voltage-dependent potassium ch 6e-12
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-10
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 4e-10
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 1e-09
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 2e-09
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 5e-09
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 6e-09
PHA03100 422 PHA03100, PHA03100, ankyrin repeat protein; Provis 8e-09
PHA03100 422 PHA03100, PHA03100, ankyrin repeat protein; Provis 1e-08
smart0024830 smart00248, ANK, ankyrin repeats 1e-08
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 5e-08
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 2e-07
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 9e-07
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 2e-06
PHA02874 434 PHA02874, PHA02874, ankyrin repeat protein; Provis 2e-06
TIGR00870 743 TIGR00870, trp, transient-receptor-potential calci 2e-06
PHA02875 413 PHA02875, PHA02875, ankyrin repeat protein; Provis 3e-05
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 4e-05
PHA02878 477 PHA02878, PHA02878, ankyrin repeat protein; Provis 4e-05
PHA02875 413 PHA02875, PHA02875, ankyrin repeat protein; Provis 8e-05
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 2e-04
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 6e-04
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 6e-04
PHA02874 434 PHA02874, PHA02874, ankyrin repeat protein; Provis 6e-04
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 7e-04
PHA02875 413 PHA02875, PHA02875, ankyrin repeat protein; Provis 0.001
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 0.001
PHA02946 446 PHA02946, PHA02946, ankyin-like protein; Provision 0.002
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 0.004
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
 Score = 95.5 bits (238), Expect = 2e-25
 Identities = 48/104 (46%), Positives = 66/104 (63%), Gaps = 4/104 (3%)

Query: 57  LLFMACS-GDVKGVEDLLNEGIDVNSIDLDGRTALHIAACEGHVEVVKLLLSKKANIDAR 115
            L +A S G ++ V+ LL  G DVN+ D DGRT LH+AA  GH+E+VKLLL K A+++AR
Sbjct: 10  PLHLAASNGHLEVVKLLLENGADVNAKDNDGRTPLHLAAKNGHLEIVKLLLEKGADVNAR 69

Query: 116 DRWGSTAAADAKYYGNVEVYNILKARGAKVP---KTKRTPMTVA 156
           D+ G+T    A   GN++V  +L   GA V    K  RTP+ +A
Sbjct: 70  DKDGNTPLHLAARNGNLDVVKLLLKHGADVNARDKDGRTPLHLA 113


The number of ANK repeats in a protein can range from 2 to over 20 (ankyrins, for example). ANK repeats may occur in combinations with other types of domains. The structural repeat unit contains two antiparallel helices and a beta-hairpin, repeats are stacked in a superhelical arrangement; this alignment contains 4 consecutive repeats. Length = 126

>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|233161 TIGR00870, trp, transient-receptor-potential calcium channel protein Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165256 PHA02946, PHA02946, ankyin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 216
KOG4412226 consensus 26S proteasome regulatory complex, subun 99.97
KOG4412226 consensus 26S proteasome regulatory complex, subun 99.95
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.95
PHA02791284 ankyrin-like protein; Provisional 99.94
PHA02791284 ankyrin-like protein; Provisional 99.94
PHA02878 477 ankyrin repeat protein; Provisional 99.92
PHA02875 413 ankyrin repeat protein; Provisional 99.92
PHA02875 413 ankyrin repeat protein; Provisional 99.92
PHA03100 480 ankyrin repeat protein; Provisional 99.91
PHA02859209 ankyrin repeat protein; Provisional 99.91
PHA02874 434 ankyrin repeat protein; Provisional 99.91
PHA02878 477 ankyrin repeat protein; Provisional 99.91
PHA03100 480 ankyrin repeat protein; Provisional 99.9
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.9
PHA03095 471 ankyrin-like protein; Provisional 99.9
PHA02798 489 ankyrin-like protein; Provisional 99.9
PHA02874 434 ankyrin repeat protein; Provisional 99.9
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.9
KOG0508 615 consensus Ankyrin repeat protein [General function 99.9
PHA02946 446 ankyin-like protein; Provisional 99.89
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.89
PHA03095 471 ankyrin-like protein; Provisional 99.88
PHA02859209 ankyrin repeat protein; Provisional 99.88
PHA02946 446 ankyin-like protein; Provisional 99.88
PHA02989 494 ankyrin repeat protein; Provisional 99.87
PHA02798 489 ankyrin-like protein; Provisional 99.87
PHA02989 494 ankyrin repeat protein; Provisional 99.87
PLN03192 823 Voltage-dependent potassium channel; Provisional 99.87
PHA02876 682 ankyrin repeat protein; Provisional 99.87
PLN03192 823 Voltage-dependent potassium channel; Provisional 99.87
PHA02795 437 ankyrin-like protein; Provisional 99.86
PHA02917 661 ankyrin-like protein; Provisional 99.86
KOG0508 615 consensus Ankyrin repeat protein [General function 99.86
PHA02876 682 ankyrin repeat protein; Provisional 99.86
PHA02884300 ankyrin repeat protein; Provisional 99.86
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.86
PHA02741169 hypothetical protein; Provisional 99.86
PHA02743166 Viral ankyrin protein; Provisional 99.86
KOG0510 929 consensus Ankyrin repeat protein [General function 99.84
PHA02743166 Viral ankyrin protein; Provisional 99.83
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.83
PHA02917 661 ankyrin-like protein; Provisional 99.83
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.83
PHA02795 437 ankyrin-like protein; Provisional 99.82
KOG0510 929 consensus Ankyrin repeat protein [General function 99.82
PHA02736154 Viral ankyrin protein; Provisional 99.82
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.82
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.79
KOG0195 448 consensus Integrin-linked kinase [Signal transduct 99.79
KOG0514452 consensus Ankyrin repeat protein [General function 99.78
PHA02884300 ankyrin repeat protein; Provisional 99.78
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.77
KOG0514452 consensus Ankyrin repeat protein [General function 99.77
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.76
PHA02730 672 ankyrin-like protein; Provisional 99.76
PHA02736154 Viral ankyrin protein; Provisional 99.76
KOG0505 527 consensus Myosin phosphatase, regulatory subunit [ 99.75
PHA02730 672 ankyrin-like protein; Provisional 99.75
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.75
PHA02741169 hypothetical protein; Provisional 99.74
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.7
PHA02792 631 ankyrin-like protein; Provisional 99.7
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.69
KOG0505 527 consensus Myosin phosphatase, regulatory subunit [ 99.68
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.67
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.66
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.64
KOG0195 448 consensus Integrin-linked kinase [Signal transduct 99.64
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.62
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.62
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.59
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.58
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.57
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.55
PHA02792 631 ankyrin-like protein; Provisional 99.55
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.53
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.53
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.53
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.51
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.51
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.47
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.42
KOG1710 396 consensus MYND Zn-finger and ankyrin repeat protei 99.41
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.41
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.41
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.38
KOG1710 396 consensus MYND Zn-finger and ankyrin repeat protei 99.32
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.24
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 99.16
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 99.11
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.96
PF1360630 Ank_3: Ankyrin repeat 98.95
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.9
PF1360630 Ank_3: Ankyrin repeat 98.88
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.82
KOG0522 560 consensus Ankyrin repeat protein [General function 98.81
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.81
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.76
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.74
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.69
KOG0511 516 consensus Ankyrin repeat protein [General function 98.55
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.46
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.41
KOG0511 516 consensus Ankyrin repeat protein [General function 98.38
KOG0521785 consensus Putative GTPase activating proteins (GAP 98.37
KOG0521785 consensus Putative GTPase activating proteins (GAP 98.35
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.31
KOG2384223 consensus Major histocompatibility complex protein 98.29
KOG2384223 consensus Major histocompatibility complex protein 98.18
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 98.14
KOG0522 560 consensus Ankyrin repeat protein [General function 98.08
KOG0520 975 consensus Uncharacterized conserved protein, conta 97.91
KOG0520 975 consensus Uncharacterized conserved protein, conta 97.88
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 97.78
KOG2505591 consensus Ankyrin repeat protein [General function 97.51
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 97.27
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 97.18
KOG2505591 consensus Ankyrin repeat protein [General function 96.76
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 95.3
KOG1709 271 consensus Guanidinoacetate methyltransferase and r 88.93
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 88.43
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 86.4
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 81.17
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 80.67
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=99.97  E-value=4e-31  Score=187.10  Aligned_cols=154  Identities=29%  Similarity=0.350  Sum_probs=132.0

Q ss_pred             CCCCCCccchHHHHHHHHcCCHHHHHHHH-hCCCCCCccCCCCchHHHHHHHcCCHHHHHHHHhC-CCCCCCCCCCCCCH
Q 027950           45 LTVPENLDSTMQLLFMACSGDVKGVEDLL-NEGIDVNSIDLDGRTALHIAACEGHVEVVKLLLSK-KANIDARDRWGSTA  122 (216)
Q Consensus        45 ~~~~~~~~~~t~L~~a~~~g~~~~v~~Ll-~~~~~~~~~~~~g~t~L~~a~~~~~~~~~~~Ll~~-g~~~~~~~~~g~t~  122 (216)
                      .+...+.+|.|||||||..|+.+++.+|+ +.+..+|.+|..|+||||.|++.|+.++|+.|+.+ |+++|..++.|.|+
T Consensus        30 L~~r~dqD~Rt~LHwa~S~g~~eiv~fLlsq~nv~~ddkDdaGWtPlhia~s~g~~evVk~Ll~r~~advna~tn~G~T~  109 (226)
T KOG4412|consen   30 LNARDDQDGRTPLHWACSFGHVEIVYFLLSQPNVKPDDKDDAGWTPLHIAASNGNDEVVKELLNRSGADVNATTNGGQTC  109 (226)
T ss_pred             hhccccccCCceeeeeeecCchhHHHHHHhcCCCCCCCccccCCchhhhhhhcCcHHHHHHHhcCCCCCcceecCCCcce
Confidence            34455668999999999999999999999 45778888899999999999999999999999988 99999999999999


Q ss_pred             HHHHHHcCCHHHHHHHHHCCCCCCCC---CCCchhcccCCCCcccccchhhHHHHhhcCCC---CCCCcchHHH------
Q 027950          123 AADAKYYGNVEVYNILKARGAKVPKT---KRTPMTVANPREVPEYELNPLELQVRKADGIT---KAWPVPLIFV------  190 (216)
Q Consensus       123 L~~a~~~g~~~~~~~Ll~~g~~~~~~---g~t~l~~a~~~~~~~~~~~~~~~l~~~g~~~~---~~~~~~l~~~------  190 (216)
                      ||||+..|..+++.+|+++|+.++.+   |+||||.|+..+.    ++.+++|+..|+.++   ..++||+|.+      
T Consensus       110 LHyAagK~r~eIaqlLle~ga~i~~kD~~~qtplHRAAavGk----lkvie~Li~~~a~~n~qDk~G~TpL~~al~e~~~  185 (226)
T KOG4412|consen  110 LHYAAGKGRLEIAQLLLEKGALIRIKDKQGQTPLHRAAAVGK----LKVIEYLISQGAPLNTQDKYGFTPLHHALAEGHP  185 (226)
T ss_pred             ehhhhcCChhhHHHHHHhcCCCCcccccccCchhHHHHhccc----hhhHHHHHhcCCCCCcccccCccHHHHHHhccCc
Confidence            99999999999999999999998766   9999999888773    345788888888775   6788998888      


Q ss_pred             HHHHHHHHcCCC
Q 027950          191 HYVILLRQAGSF  202 (216)
Q Consensus       191 ~~~~~l~~~g~~  202 (216)
                      ..+.+|...|+.
T Consensus       186 d~a~lLV~~gAd  197 (226)
T KOG4412|consen  186 DVAVLLVRAGAD  197 (226)
T ss_pred             hHHHHHHHhccc
Confidence            567788888864



>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>KOG1709 consensus Guanidinoacetate methyltransferase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query216
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 2e-14
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 4e-14
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 2e-13
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 2e-13
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 3e-13
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 4e-13
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 5e-13
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 7e-13
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 2e-12
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 5e-12
2xeh_A157 Structural Determinants For Improved Thermal Stabil 5e-12
2xee_A157 Structural Determinants For Improved Thermal Stabil 6e-12
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 8e-12
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 8e-12
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 2e-11
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 5e-11
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 7e-11
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 8e-11
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 2e-10
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 2e-10
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 3e-10
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 4e-10
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 4e-10
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 4e-10
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 5e-10
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 6e-10
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 8e-10
2xen_A91 Structural Determinants For Improved Thermal Stabil 1e-09
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 1e-09
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 1e-09
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 2e-09
3hg0_D136 Crystal Structure Of A Darpin In Complex With Orf49 3e-09
2jab_A136 A Designed Ankyrin Repeat Protein Evolved To Picomo 3e-09
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 5e-09
2zgg_A92 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 1e-08
2zgd_A110 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 2e-08
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 2e-08
4grg_A135 Crystal Structure Of Ige Complexed With E2_79, An A 2e-08
1s70_B299 Complex Between Protein Ser/thr Phosphatase-1 (delt 4e-08
3twu_A167 Crystal Structure Of Arc4 From Human Tankyrase 2 In 9e-08
1mx4_A168 Structure Of P18ink4c (F82q) Length = 168 9e-08
3twr_A165 Crystal Structure Of Arc4 From Human Tankyrase 2 In 1e-07
3twq_A175 Crystal Structure Of Arc4 From Human Tankyrase 2 (A 1e-07
1mx6_A168 Structure Of P18ink4c (F92n) Length = 168 1e-07
3c5r_A137 Crystal Structure Of The Bard1 Ankyrin Repeat Domai 2e-07
1ihb_A162 Crystal Structure Of P18-Ink4c(Ink6) Length = 162 2e-07
1bu9_A168 Solution Structure Of P18-Ink4c, 21 Structures Leng 2e-07
1mx2_A168 Structure Of F71n Mutant Of P18ink4c Length = 168 3e-07
3aaa_C123 Crystal Structure Of Actin Capping Protein In Compl 3e-07
3utm_A 351 Crystal Structure Of A Mouse Tankyrase-Axin Complex 3e-07
1myo_A118 Solution Structure Of Myotrophin, Nmr, 44 Structure 4e-07
2rfm_A192 Structure Of A Thermophilic Ankyrin Repeat Protein 6e-07
1uoh_A226 Human Gankyrin Length = 226 1e-06
1uoh_A226 Human Gankyrin Length = 226 4e-04
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 2e-06
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 4e-04
1ycs_B239 P53-53bp2 Complex Length = 239 2e-06
1wdy_A285 Crystal Structure Of Ribonuclease Length = 285 2e-06
4a63_B239 Crystal Structure Of The P73-Aspp2 Complex At 2.6a 2e-06
4g8k_A337 Intact Sensor Domain Of Human Rnase L In The Inacti 2e-06
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 2e-06
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 3e-06
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 3e-06
4b93_B269 Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri 3e-06
3f6q_A179 Crystal Structure Of Integrin-Linked Kinase Ankyrin 7e-06
2kbx_A171 Solution Structure Of Ilk-Pinch Complex Length = 17 7e-06
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 1e-05
1awc_B153 Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 1 1e-05
4hbd_A276 Crystal Structure Of Kank2 Ankyrin Repeats Length = 3e-05
1ot8_A239 Structure Of The Ankyrin Domain Of The Drosophila N 3e-05
3uxg_A172 Crystal Structure Of Rfxank Length = 172 1e-04
3ehq_A222 Crystal Structure Of Human Osteoclast Stimulating F 1e-04
3t9k_A390 Crystal Structure Of Acap1 C-portion Mutant S554d F 1e-04
3jue_A368 Crystal Structure Of Arfgap And Ank Repeat Domain O 1e-04
4f1p_A368 Crystal Structure Of Mutant S554d For Arfgap And An 1e-04
3v30_A172 Crystal Structure Of The Peptide Bound Complex Of T 3e-04
3d9h_A285 Crystal Structure Of The Splice Variant Of Human As 6e-04
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure

Iteration: 1

Score = 75.5 bits (184), Expect = 2e-14, Method: Compositional matrix adjust. Identities = 45/104 (43%), Positives = 64/104 (61%), Gaps = 3/104 (2%) Query: 56 QLLFMACSGDVKGVEDLLNEGIDVNSIDLDGRTALHIAACEGHVEVVKLLLSKKANIDAR 115 +L+ A +G+ V+DL+ G DVN+ D DGRT LH AA EGH E+VKLL+SK A+++A+ Sbjct: 7 RLIEAAENGNKDRVKDLIENGADVNASDSDGRTPLHYAAKEGHKEIVKLLISKGADVNAK 66 Query: 116 DRWGSTAAADAKYYGNVEVYNILKARGAKV---PKTKRTPMTVA 156 D G T A G+ E+ +L ++GA V RTP+ A Sbjct: 67 DSDGRTPLHYAAKEGHKEIVKLLISKGADVNAKDSDGRTPLHYA 110
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|2XEN|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module Length = 91 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 Back     alignment and structure
>pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|2ZGG|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 92 Back     alignment and structure
>pdb|2ZGD|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 110 Back     alignment and structure
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 Back     alignment and structure
>pdb|1S70|B Chain B, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 299 Back     alignment and structure
>pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 Back     alignment and structure
>pdb|1MX4|A Chain A, Structure Of P18ink4c (F82q) Length = 168 Back     alignment and structure
>pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 Back     alignment and structure
>pdb|3TWQ|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 (Apo Form) Length = 175 Back     alignment and structure
>pdb|1MX6|A Chain A, Structure Of P18ink4c (F92n) Length = 168 Back     alignment and structure
>pdb|3C5R|A Chain A, Crystal Structure Of The Bard1 Ankyrin Repeat Domain And Its Functional Consequences Length = 137 Back     alignment and structure
>pdb|1IHB|A Chain A, Crystal Structure Of P18-Ink4c(Ink6) Length = 162 Back     alignment and structure
>pdb|1BU9|A Chain A, Solution Structure Of P18-Ink4c, 21 Structures Length = 168 Back     alignment and structure
>pdb|1MX2|A Chain A, Structure Of F71n Mutant Of P18ink4c Length = 168 Back     alignment and structure
>pdb|3AAA|C Chain C, Crystal Structure Of Actin Capping Protein In Complex With V-1 Length = 123 Back     alignment and structure
>pdb|3UTM|A Chain A, Crystal Structure Of A Mouse Tankyrase-Axin Complex Length = 351 Back     alignment and structure
>pdb|1MYO|A Chain A, Solution Structure Of Myotrophin, Nmr, 44 Structures Length = 118 Back     alignment and structure
>pdb|2RFM|A Chain A, Structure Of A Thermophilic Ankyrin Repeat Protein Length = 192 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|1YCS|B Chain B, P53-53bp2 Complex Length = 239 Back     alignment and structure
>pdb|1WDY|A Chain A, Crystal Structure Of Ribonuclease Length = 285 Back     alignment and structure
>pdb|4A63|B Chain B, Crystal Structure Of The P73-Aspp2 Complex At 2.6a Resolution Length = 239 Back     alignment and structure
>pdb|4G8K|A Chain A, Intact Sensor Domain Of Human Rnase L In The Inactive Signaling State Length = 337 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 Back     alignment and structure
>pdb|3F6Q|A Chain A, Crystal Structure Of Integrin-Linked Kinase Ankyrin Repeat Domain In Complex With Pinch1 Lim1 Domain Length = 179 Back     alignment and structure
>pdb|2KBX|A Chain A, Solution Structure Of Ilk-Pinch Complex Length = 171 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|1AWC|B Chain B, Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 153 Back     alignment and structure
>pdb|4HBD|A Chain A, Crystal Structure Of Kank2 Ankyrin Repeats Length = 276 Back     alignment and structure
>pdb|1OT8|A Chain A, Structure Of The Ankyrin Domain Of The Drosophila Notch Receptor Length = 239 Back     alignment and structure
>pdb|3UXG|A Chain A, Crystal Structure Of Rfxank Length = 172 Back     alignment and structure
>pdb|3EHQ|A Chain A, Crystal Structure Of Human Osteoclast Stimulating Factor Length = 222 Back     alignment and structure
>pdb|3T9K|A Chain A, Crystal Structure Of Acap1 C-portion Mutant S554d Fused With Integrin Beta1 Peptide Length = 390 Back     alignment and structure
>pdb|3JUE|A Chain A, Crystal Structure Of Arfgap And Ank Repeat Domain Of Acap1 Length = 368 Back     alignment and structure
>pdb|4F1P|A Chain A, Crystal Structure Of Mutant S554d For Arfgap And Ank Repeat Domain Of Acap1 Length = 368 Back     alignment and structure
>pdb|3V30|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Rfxank Length = 172 Back     alignment and structure
>pdb|3D9H|A Chain A, Crystal Structure Of The Splice Variant Of Human Asb9 (Hasb9-2), An Ankyrin Repeat Protein Length = 285 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query216
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 1e-28
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-25
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 4e-22
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 8e-13
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 4e-28
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 5e-23
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 7e-19
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 2e-09
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 6e-28
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-24
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-21
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-21
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-18
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-17
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 3e-27
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-23
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-23
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 7e-22
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-19
3d9h_A 285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-08
3v31_A167 Ankyrin repeat family A protein 2; structural geno 4e-27
3v31_A167 Ankyrin repeat family A protein 2; structural geno 4e-27
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-25
3v31_A167 Ankyrin repeat family A protein 2; structural geno 7e-19
3v31_A167 Ankyrin repeat family A protein 2; structural geno 8e-19
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 5e-27
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 7e-24
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 1e-19
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 7e-27
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-23
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-22
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 3e-22
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 2e-17
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 3e-14
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 3e-12
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 1e-26
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 3e-24
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 9e-22
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 1e-08
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 1e-05
3v30_A172 DNA-binding protein rfxank; structural genomics co 1e-26
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-26
3v30_A172 DNA-binding protein rfxank; structural genomics co 9e-25
3v30_A172 DNA-binding protein rfxank; structural genomics co 3e-16
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 3e-26
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 4e-24
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-22
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-15
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 7e-26
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-25
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 6e-23
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-14
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-12
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 7e-26
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 9e-24
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 4e-19
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 9e-13
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 8e-26
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-24
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-23
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 4e-23
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-22
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-20
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-19
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 5e-17
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 5e-14
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 8e-26
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-22
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 3e-21
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 8e-26
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 3e-25
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 4e-24
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-16
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-16
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-25
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-24
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 8e-20
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 6e-19
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-16
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 5e-13
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 6e-05
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-25
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-24
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-23
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 7e-19
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-13
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-25
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 7e-25
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-24
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-24
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-24
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 4e-24
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 5e-24
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-23
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-23
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 4e-20
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 4e-16
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 3e-25
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-24
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 9e-20
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 3e-25
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-18
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 6e-16
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 3e-15
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 3e-14
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 5e-10
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 3e-25
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 6e-25
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 7e-21
1ycs_B 239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 8e-15
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 3e-25
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-20
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 3e-25
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 7e-20
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-15
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 1e-09
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 6e-25
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-23
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 6e-22
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 6e-21
2f8y_A 223 Notch homolog 1, translocation-associated (drosoph 1e-06
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 6e-25
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-24
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-23
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 8e-22
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-21
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 3e-13
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 8e-25
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 3e-24
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-23
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 1e-17
3deo_A183 Signal recognition particle 43 kDa protein; chloro 8e-25
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-24
3deo_A183 Signal recognition particle 43 kDa protein; chloro 2e-21
3deo_A183 Signal recognition particle 43 kDa protein; chloro 3e-15
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 8e-25
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 3e-24
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 3e-24
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 1e-17
3hra_A201 Ankyrin repeat family protein; structural protein; 9e-25
3hra_A201 Ankyrin repeat family protein; structural protein; 6e-20
3hra_A201 Ankyrin repeat family protein; structural protein; 9e-20
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-17
3hra_A201 Ankyrin repeat family protein; structural protein; 7e-13
1awc_B153 Protein (GA binding protein beta 1); complex (tran 1e-24
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-24
1awc_B153 Protein (GA binding protein beta 1); complex (tran 3e-24
1awc_B153 Protein (GA binding protein beta 1); complex (tran 6e-16
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-24
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 3e-22
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-20
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 4e-16
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 3e-14
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-24
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-23
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-21
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-20
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 5e-15
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-14
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 2e-24
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 3e-24
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 3e-10
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 9e-24
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 8e-23
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-22
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-20
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-18
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-18
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 9e-16
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-23
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-23
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 4e-22
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 6e-22
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 4e-21
3eu9_A 240 Huntingtin-interacting protein 14; epigenetics, an 4e-19
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 4e-16
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-23
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-22
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-22
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 4e-22
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-17
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 6e-13
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-10
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 3e-23
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 6e-23
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 7e-23
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-20
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 6e-13
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 5e-09
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 4e-23
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 7e-23
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 4e-22
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-20
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 6e-20
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-15
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 4e-23
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-21
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 5e-20
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-19
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 7e-16
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 6e-13
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 6e-23
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 6e-21
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 7e-21
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-18
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-18
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-15
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-15
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-15
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 6e-15
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 3e-22
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 6e-21
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 1e-20
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 3e-20
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 7e-20
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 3e-19
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-16
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-21
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 3e-21
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-20
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-14
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-07
2rfa_A232 Transient receptor potential cation channel subfa 3e-21
2rfa_A232 Transient receptor potential cation channel subfa 1e-18
2rfa_A232 Transient receptor potential cation channel subfa 2e-18
2rfa_A232 Transient receptor potential cation channel subfa 1e-17
2rfa_A232 Transient receptor potential cation channel subfa 2e-14
2rfa_A232 Transient receptor potential cation channel subfa 9e-14
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 2e-19
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 3e-16
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 7e-15
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-09
1sw6_A327 Regulatory protein SWI6; transcription regulation, 4e-18
1sw6_A327 Regulatory protein SWI6; transcription regulation, 1e-15
1sw6_A327 Regulatory protein SWI6; transcription regulation, 3e-08
1sw6_A327 Regulatory protein SWI6; transcription regulation, 7e-06
1sw6_A327 Regulatory protein SWI6; transcription regulation, 1e-04
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 7e-18
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 3e-14
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-11
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-11
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 6e-11
2pnn_A273 Transient receptor potential cation channel subfa 1e-17
2pnn_A273 Transient receptor potential cation channel subfa 1e-13
2pnn_A273 Transient receptor potential cation channel subfa 3e-12
2pnn_A273 Transient receptor potential cation channel subfa 1e-11
2pnn_A 273 Transient receptor potential cation channel subfa 3e-08
2etb_A256 Transient receptor potential cation channel subfam 4e-16
2etb_A256 Transient receptor potential cation channel subfam 2e-15
2etb_A256 Transient receptor potential cation channel subfam 2e-14
2etb_A256 Transient receptor potential cation channel subfam 1e-12
2etb_A 256 Transient receptor potential cation channel subfam 2e-05
3jxi_A260 Vanilloid receptor-related osmotically activated p 2e-15
3jxi_A260 Vanilloid receptor-related osmotically activated p 2e-13
3jxi_A260 Vanilloid receptor-related osmotically activated p 2e-11
3jxi_A 260 Vanilloid receptor-related osmotically activated p 3e-07
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 1e-14
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 2e-09
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 3e-05
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-14
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-09
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-05
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 4e-13
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 4e-09
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 5e-11
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 7e-11
3uo9_A534 Glutaminase kidney isoform, mitochondrial; hydrola 6e-06
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
 Score =  103 bits (260), Expect = 1e-28
 Identities = 34/103 (33%), Positives = 48/103 (46%), Gaps = 4/103 (3%)

Query: 58  LFMACS-GDVKGVEDLLNEGIDVNSIDLDGRTALHIAACEGHVEVVKLLLSKKANIDARD 116
           L +A   GD+  VE LL  G D N  D  G T LH A   GH++VV+LLL  KA ++   
Sbjct: 14  LHIASIKGDIPSVEYLLQNGSDPNVKDHAGWTPLHEACNHGHLKVVELLLQHKALVNTTG 73

Query: 117 RWGSTAAADAKYYGNVEVYNILKARGAKV-PKTK--RTPMTVA 156
               +   DA   G+V++  +L + GA           P+   
Sbjct: 74  YQNDSPLHDAAKNGHVDIVKLLLSYGASRNAVNIFGLRPVDYT 116


>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3uo9_A Glutaminase kidney isoform, mitochondrial; hydrolase-hydrolase inhibitor complex; HET: 04A; 2.30A {Homo sapiens} PDB: 3unw_A* 3ss3_A 3ss4_A 3ss5_A* Length = 534 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query216
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.97
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.97
2rfa_A232 Transient receptor potential cation channel subfa 99.96
3hra_A201 Ankyrin repeat family protein; structural protein; 99.96
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.95
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.95
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.95
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.95
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.95
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.95
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.95
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.95
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.95
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.95
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.95
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.95
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.95
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.95
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.94
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.94
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.94
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.94
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.94
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.94
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.94
2etb_A256 Transient receptor potential cation channel subfam 99.94
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.94
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.94
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.94
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.94
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.94
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.94
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.94
2pnn_A273 Transient receptor potential cation channel subfa 99.94
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.94
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.94
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 99.94
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.94
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.94
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.94
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.94
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.94
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.94
2rfa_A232 Transient receptor potential cation channel subfa 99.94
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.94
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.93
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.93
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.93
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.93
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.93
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.93
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.93
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.93
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.93
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.93
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.93
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.93
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.93
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.93
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.93
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.93
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.93
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.93
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.93
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.93
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.93
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.93
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.92
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.92
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 99.92
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.92
3hra_A201 Ankyrin repeat family protein; structural protein; 99.92
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.92
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.92
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.92
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.91
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.91
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.91
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.91
2etb_A256 Transient receptor potential cation channel subfam 99.91
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.91
2pnn_A273 Transient receptor potential cation channel subfa 99.91
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.91
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.91
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.91
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.9
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.9
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.9
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.9
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.89
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.89
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.89
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.89
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.88
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.88
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.88
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.88
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.87
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.86
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.86
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.86
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.85
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.85
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.84
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.83
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.83
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.81
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.81
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.81
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.8
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.8
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.79
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.77
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.7
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
Probab=99.97  E-value=2.5e-31  Score=194.35  Aligned_cols=142  Identities=39%  Similarity=0.521  Sum_probs=85.2

Q ss_pred             HHHHHHHcCCHHHHHHHHhCCCCCCccCCCCchHHHHHHHcCCHHHHHHHHhCCCCCCCCCCCCCCHHHHHHHcCCHHHH
Q 027950           56 QLLFMACSGDVKGVEDLLNEGIDVNSIDLDGRTALHIAACEGHVEVVKLLLSKKANIDARDRWGSTAAADAKYYGNVEVY  135 (216)
Q Consensus        56 ~L~~a~~~g~~~~v~~Ll~~~~~~~~~~~~g~t~L~~a~~~~~~~~~~~Ll~~g~~~~~~~~~g~t~L~~a~~~g~~~~~  135 (216)
                      +|+.||..|+.++|+.|+++|+++|.+|..|.||||+|+..++.+++++|++.|++++.+|..|+||||+|+..|+.+++
T Consensus         7 ~L~~Aa~~G~~~~v~~Ll~~Gadvn~~d~~g~t~l~~a~~~~~~~~~~~ll~~gad~~~~d~~g~TpLh~A~~~g~~~~v   86 (169)
T 4gpm_A            7 RLIEAAENGNKDRVKDLIENGADVNASDSDGRTPLHHAAENGHKEVVKLLISKGADVNAKDSDGRTPLHHAAENGHKEVV   86 (169)
T ss_dssp             HHHHHHHTTCHHHHHHHHHTTCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTSCCHHHHHHHTTCHHHH
T ss_pred             HHHHHHHcCCHHHHHHHHHCCCCCCCcCCCCCCHHHHHHHcCCHHHHHHHHhcccchhhhccCCCCHHHHHHHcCCHHHH
Confidence            46666666666666666666666666666666666666666666666666666666666666666666666666666666


Q ss_pred             HHHHHCCCCCCCC---CCCchhcccCCCCcccccchhhHHHHhhcCCC---CCCCcchHHH------HHHHHHHHcCC
Q 027950          136 NILKARGAKVPKT---KRTPMTVANPREVPEYELNPLELQVRKADGIT---KAWPVPLIFV------HYVILLRQAGS  201 (216)
Q Consensus       136 ~~Ll~~g~~~~~~---g~t~l~~a~~~~~~~~~~~~~~~l~~~g~~~~---~~~~~~l~~~------~~~~~l~~~g~  201 (216)
                      ++|+++|+++|..   |+||||+|+..+..+    ++++|++.|++++   ..+.||++.|      .++++|++.|+
T Consensus        87 ~~Ll~~gadvn~~d~~G~TpLh~A~~~g~~~----~v~~Ll~~gad~~~~d~~G~TpL~~A~~~g~~~iv~~Ll~~GA  160 (169)
T 4gpm_A           87 KLLISKGADVNAKDSDGRTPLHHAAENGHKE----VVKLLISKGADVNTSDSDGRTPLDLAREHGNEEVVKLLEKQGG  160 (169)
T ss_dssp             HHHHHTTCCTTCCCTTSCCHHHHHHHTTCHH----HHHHHHHTTCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHTC--
T ss_pred             HHHHHCcCCCCCCCCCCCCHHHHHHHcCCHH----HHHHHHHcCCCccccCCCCCCHHHHHHHcCCHHHHHHHHHCCC
Confidence            6666666665543   666666666555433    3555666666553   3455666555      45566666655



>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 216
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-23
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 6e-18
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 5e-15
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 6e-14
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-12
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 7e-12
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-10
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 4e-10
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 5e-08
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-18
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-16
d1wdya_ 285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 6e-11
d1wdya_ 285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 6e-10
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-09
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 4e-09
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 8e-17
d2fo1e1 277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-13
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-12
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 1e-05
d2fo1e1 277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 3e-05
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 0.002
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 1e-15
d2ajaa1 346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 5e-14
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 3e-08
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 4e-07
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 1e-06
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 8e-05
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 0.001
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 5e-15
d1s70b_ 291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 6e-12
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 6e-10
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 8e-10
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 3e-07
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 6e-15
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 2e-14
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 1e-08
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 7e-05
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-13
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-13
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 5e-11
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-10
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-10
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-13
d1oy3d_ 255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 8e-13
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-12
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-09
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 3e-13
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9e-12
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 2e-11
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 8e-06
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 4e-11
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 8e-11
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 7e-10
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 9e-05
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 8e-11
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 6e-10
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 8e-09
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 0.002
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 2e-10
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 2e-08
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 0.003
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 4e-10
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 9e-09
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 8e-08
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-07
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 5e-10
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 5e-09
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 2e-05
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 8e-09
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 6e-07
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 1e-04
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 1e-08
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 4e-07
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 8e-07
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 2e-06
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 3e-06
d1myoa_118 d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) 0.001
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 93.9 bits (232), Expect = 3e-23
 Identities = 28/97 (28%), Positives = 42/97 (43%), Gaps = 1/97 (1%)

Query: 58  LFMACS-GDVKGVEDLLNEGIDVNSIDLDGRTALHIAACEGHVEVVKLLLSKKANIDARD 116
           L +A   G +  V++LL  G   N  ++   T LH+AA  GH EV K LL  KA ++A+ 
Sbjct: 4   LHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKA 63

Query: 117 RWGSTAAADAKYYGNVEVYNILKARGAKVPKTKRTPM 153
           +   T    A   G+  +  +L    A          
Sbjct: 64  KDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGH 100


>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 118 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query216
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.94
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.93
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.93
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.93
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.92
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.92
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.91
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.91
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.9
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.89
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.89
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.88
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.88
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.88
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.88
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.88
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.87
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.87
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.87
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.87
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.86
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.85
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.85
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.85
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.85
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.84
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.84
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.84
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.83
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.83
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.83
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.82
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.82
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.79
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.78
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.76
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.75
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.69
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Myotrophin
species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=99.94  E-value=2.9e-27  Score=161.06  Aligned_cols=107  Identities=30%  Similarity=0.440  Sum_probs=102.0

Q ss_pred             hHHHHHHHHcCCHHHHHHHHhCCCCCCccCCCCchHHHHHHHcCCHHHHHHHHhCCCCCCCCCCCCCCHHHHHHHcCCHH
Q 027950           54 TMQLLFMACSGDVKGVEDLLNEGIDVNSIDLDGRTALHIAACEGHVEVVKLLLSKKANIDARDRWGSTAAADAKYYGNVE  133 (216)
Q Consensus        54 ~t~L~~a~~~g~~~~v~~Ll~~~~~~~~~~~~g~t~L~~a~~~~~~~~~~~Ll~~g~~~~~~~~~g~t~L~~a~~~g~~~  133 (216)
                      .|||++|+..|+.++|+.|+++|++++.++..|.||||+|+..|+.+++++|++.|++++.+|..|+||||+|+..|+.+
T Consensus         3 ~tpL~~A~~~g~~~~v~~Ll~~g~d~n~~~~~g~t~lh~A~~~~~~~~~~~ll~~g~din~~d~~g~tpLh~A~~~~~~~   82 (118)
T d1myoa_           3 DKEFMWALKNGDLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVS   82 (118)
T ss_dssp             HHHHHHHHHTTCHHHHHHHHTTTCCCCCCSSSSCCTTHHHHHHSTTTHHHHHHHSSCTTTCCSSSCSCHHHHHHTTTCCH
T ss_pred             ChHHHHHHHCCCHHHHHHHHHhhhccccccccccccccccccccccccccccccccceeeecccccccchhhhhhcCchh
Confidence            58999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHCCCCCCCC---CCCchhcccCCC
Q 027950          134 VYNILKARGAKVPKT---KRTPMTVANPRE  160 (216)
Q Consensus       134 ~~~~Ll~~g~~~~~~---g~t~l~~a~~~~  160 (216)
                      ++++|+++|++++..   |.||||+|....
T Consensus        83 ~v~~Ll~~Gad~~~~d~~G~t~l~~a~~~~  112 (118)
T d1myoa_          83 CVKLLLSKGADKTVKGPDGLTALEATDNQA  112 (118)
T ss_dssp             HHHHHHTTCCCSSSSSSSTCCCCCTCSSTT
T ss_pred             hhhhhhcccccceeeCCCCCCHHHHHhHHH
Confidence            999999999999765   999999996543



>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure