Citrus Sinensis ID: 027961

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210------

MGTPTREQYVYLAKLAEQAERYEEMVKFMDSLVTSSTPATELTVEERNLLSVAYKNVIGSLRAAWRIISSIEQKEEGRKNEEHVSLVKDYRSKVESELSDVCGSILKLLDSHLVPSATAGESKVFYLKMKGDYYRYLAEFKVGDERKAAAENTMLSYKAAQDIALTDLAPTHPIRLGLALNFSVFYYEILNSSEKACTMAKQEKTLTRLVSPFLGF

ccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHEEEEcccccccEEccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHccccccc

****TRE*YVYLAKLAEQAERYEEMVKFMDSLVTSSTPATELTVEERNLLSVAYKNVIGSLRAAWRIISSI**************LVKDYRSKVESELSDVCGSILKLLDSHLVPSATAGESKVFYLKMKGDYYRYLAEFKVGDERKAAAENTMLSYKAAQDIALTDLAPTHPIRLGLALNFSVFYYEILNSSEKACTMAKQEKTLTRLVSPFL**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MGTPTREQYVYxxxxxxxxxxxxxxxxxxxxxVTSSTPATELTVEERNLLSVAYKNVIGSLRAAWRIISSIEQKEEGRKNEEHVSLVKDYRSKVESELSDVCGSILKLLDSHLVPSATAGESKVFYLKMKGDYYRYLAEFKVGDERKAAAENTMLSYKAAQDIALTDLAPTHPIRLGLALNFSVFYYEILNSSEKACTMAKQEKTLTRLVSPFLGF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
14-3-3-like protein B (Fragment)		confident	Q96451
14-3-3-like protein GF14 kappa	Is associated with a DNA binding complex that binds to the G box, a well-characterized cis-acting DNA regulatory element found in plant genes.	confident	P48348
14-3-3-like protein GF14-C	Is associated with a DNA binding complex that binds to the G box, a well-characterized cis-acting DNA regulatory element found in plant genes.	probable	Q6ZKC0

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2BR9, chain A
Confidence level:very confident
Coverage over the Query: 5-215
View the alignment between query and template
View the model in PyMOL