Citrus Sinensis ID: 027966


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210------
MHCVLLNMLQATHMFDCFYIDGATNTVTINMAIFFVMTDLDFLFHMFFLARYCKLLEENSFRGRTADFLYMLLFGATFLTGTVLIGGMIPYLSESFAKIIFLSNSLTLMMVYVWSKQNPFIHMSFLGLFTFTAAYLPWVLLGFSVFVGASAWVDLLGMIAGHAYYFLEDVYPRMTGRRPLKTPSFIKALFADEAVVVARPANVRFAPPPAEEVHQD
cEEEEEccccccEEcHHHHHcccEEEEEEEEccccccccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEEEcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHcccccccccccccccccccccccccc
MHCVLLNMLQATHMFDCFYIDGATNTVTINMAIFFVMTDLDFLFHMFFLARYCKLLEENSFRGRTADFLYMLLFGATFLTGTVLIGGMIPYLSESFAKIIFLSNSLTLMMVYVWSKQNPFIHMSFLGLFTFTAAYLPWVLLGFSVFVGASAWVDLLGMIAGHAYYFLEDVYPRMTGRRPLKTPSFIKALFADEAV*********************
xxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHCVLLNMLQATHMFDCFYIDGATNTVTINMAIFFVMTDLDFLFHMFFLARYCKLLEENSFRGRTADFLYMLLFGATFLTGTVLIGGMIPYLSESFAKIIFLSNSLTLMMVYVWSKQNPFIHMSFLGLFTFTAAYLPWVLLGFSVFVGASAWVDLLGMIAGHAYYFLEDVYPRMTGRRPLKTPSFIKALFADEAVVVARPANVRFAPPPAEEVHQD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Derlin-2 May be involved in the degradation process of specific misfolded endoplasmic reticulum (ER) luminal proteins.probableQ851X7
Derlin-2.2 May be involved in the degradation process of specific misfolded endoplasmic reticulum (ER) luminal proteins.probableQ9ZS88
Derlin-2.1 May be involved in the degradation process of specific misfolded endoplasmic reticulum (ER) luminal proteins.probableQ4G2J4

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2NR9, chain A
Confidence level:probable
Coverage over the Query: 20-168
View the alignment between query and template
View the model in PyMOL