Citrus Sinensis ID: 027973

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210------
MAKPKAPRRTLESYTVKSISKTIKPGDCVLMRPSEPSKPSYVAKIERIESDARGANVKVHVRWYYRPEESIGGRRQFHGSKEVFLSDHHDIQSADTIEGKCTVHSFKSYTKLDAVGNDDFFCRFEYNSSSGAFNPDRVAVYCKCEMPYNPDDLMVQCEGCSDWFHPNCINMTAEEAKRLDHFFCESCSTEGQKKLQNSQANGRHSDAKVETKRRRR
ccccccccccccEEEEEEccEEEEEccEEEEEccccccccEEEEEEEEEEcccccEEEEEEEEEEccccccccccccccccEEEEcccccccccccEEEEEEEEEcccccccccccccccEEEEEEcccccccccccccccccccccccccccEEEccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccc
ccccccccccccEEEEEcccEEEEcccEEEEEccccccccEEEEEEEEEEccccccEEEEEEEEEccccccccccccccccEEEEcccccccccEEEcccEEEEEHHHHHHccccccccEEEEEEEccccccccccccEEEEEEcccccccccEEEcccccccccHHHccccHHHHHHHccccccccccccccccccccccccccccccccccccc
makpkaprrtlesytvksisktikpgdcvlmrpsepskpsyVAKIERIEsdarganvkvhvrwyyrpeesiggrrqfhgskevflsdhhdiqsadtiegkctvhsfksytkldavgnddffcrfeynsssgafnpdrvavyckcempynpddlmvqcegcsdwfhpncinMTAEEAKRLdhffcescstegQKKLqnsqangrhsdakVETKRRRR
makpkaprrtlesytvksisktikpgdcvlmrpsepskpsyVAKIEriesdarganvkvhvRWYYRpeesiggrrqfHGSKEVFLSDHHDIQSADTIEGKCTVHSFKSYTKLDAVGNDDFFCRFEynsssgafnpdRVAVYCKCEMPYNPDDLMVQCEGCSDWFHPNCINMTAEEAKRLDHFFCESCSTEGQkklqnsqangrhsdakvetkrrrr
MAKPKAPRRTLESYTVKSISKTIKPGDCVLMRPSEPSKPSYVAKIERIESDARGANVKVHVRWYYRPEESIGGRRQFHGSKEVFLSDHHDIQSADTIEGKCTVHSFKSYTKLDAVGNDDFFCRFEYNSSSGAFNPDRVAVYCKCEMPYNPDDLMVQCEGCSDWFHPNCINMTAEEAKRLDHFFCESCSTEGQKKLQNSQANGRHSDAKVETKRRRR
********************************************I*RIE*DARGANVKVHVRWYYRPEESIGGRRQFHGSKEVFLSDHHDIQSADTIEGKCTVHSFKSYTKLDAVGNDDFFCRFEYNSSSGAFNPDRVAVYCKCEMPYNPDDLMVQCEGCSDWFHPNCINMTAEEAKRLDHFFCESC*****************************
************SYTVKSISKTIKPGDCVLMRPSEPSKPSYVAKIERIESDARGANVKVHVRWYYRPEESIGGRRQFHGSKEVFLSDHHDIQSADTIEGKCTVHSFKSYTKLDAVGNDDFFCRFEYNSSSGAFNPDRVAVYCKCEMPYNPDDLMVQCEGCSDWFHPNCINMTAEEAKRLDHFFC********************************
*************YTVKSISKTIKPGDCVLMRPSEPSKPSYVAKIERIESDARGANVKVHVRWYYRPEESIGGRRQFHGSKEVFLSDHHDIQSADTIEGKCTVHSFKSYTKLDAVGNDDFFCRFEYNSSSGAFNPDRVAVYCKCEMPYNPDDLMVQCEGCSDWFHPNCINMTAEEAKRLDHFFCESCST***************************
********RTLESYTVKSISKTIKPGDCVLMRPSEPSKPSYVAKIERIESDARGANVKVHVRWYYRPEESIGGRRQFHGSKEVFLSDHHDIQSADTIEGKCTVHSFKSYTKLDAVGNDDFFCRFEYNSSSGAFNPDRVAVYCKCEMPYNPDDLMVQCEGCSDWFHPNCINMTAEEAKRLDHFFCESCS****************************
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAKPKAPRRTLESYTVKSISKTIKPGDCVLMRPSEPSKPSYVAKIERIESDARGANVKVHVRWYYRPEESIGGRRQFHGSKEVFLSDHHDIQSADTIEGKCTVHSFKSYTKLDAVGNDDFFCRFEYNSSSGAFNPDRVAVYCKCEMPYNPDDLMVQCEGCSDWFHPNCINMTAEEAKRLDHFFCESCSTEGQKKLQNSQANGRHSDAKVETKRRRR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query216 2.2.26 [Sep-21-2011]
Q6P949 1063 Lysine-specific demethyla yes no 0.310 0.063 0.352 1e-09
O75151 1096 Lysine-specific demethyla yes no 0.310 0.061 0.367 1e-09
Q9WTU0 1096 Lysine-specific demethyla yes no 0.310 0.061 0.367 1e-09
P0CH95 1032 Histone lysine demethylas no no 0.333 0.069 0.315 5e-09
E6ZGB4 1081 Lysine-specific demethyla N/A no 0.310 0.061 0.338 6e-09
Q9UPP1 1060 Histone lysine demethylas no no 0.231 0.047 0.4 2e-08
Q80TJ7 1023 Histone lysine demethylas no no 0.231 0.048 0.4 3e-08
Q9W0T1 2669 Nucleosome-remodeling fac yes no 0.328 0.026 0.355 3e-08
Q9P2812608 BAH and coiled-coil domai no no 0.416 0.034 0.344 5e-08
Q3UHR02643 BAH and coiled-coil domai no no 0.416 0.034 0.344 8e-08
>sp|Q6P949|PHF2_DANRE Lysine-specific demethylase phf2 OS=Danio rerio GN=phf2 PE=2 SV=3 Back     alignment and function desciption
 Score = 63.2 bits (152), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 41/68 (60%), Gaps = 1/68 (1%)

Query: 138 VAVYCKCEMPYNPDDLMVQCEGCSDWFHPNCINMTAEEAKRLDHFFCESCS-TEGQKKLQ 196
           V VYC C +PY+    M++C+ C DWFH +C+ +  +EA  +D + C +C  T G+  L+
Sbjct: 4   VPVYCICRLPYDVTQFMIECDACKDWFHGSCVGVDEDEAPDIDIYHCPNCEKTHGKSTLK 63

Query: 197 NSQANGRH 204
             ++  +H
Sbjct: 64  KKKSWNKH 71
Lysine demethylase that demethylates both histones and non-histone proteins. Mediates demethylation of dimethylated 'Lys-9' of histone H3 (H3K9me2). Recruited to trimethylated 'Lys-4' of histone H3 (H3K4me3) at rDNA promoters and promotes expression of rDNA.
Danio rerio (taxid: 7955)
EC: 1EC: .EC: 1EC: 4EC: .EC: 1EC: 1EC: .EC: -
>sp|O75151|PHF2_HUMAN Lysine-specific demethylase PHF2 OS=Homo sapiens GN=PHF2 PE=1 SV=4 Back     alignment and function description
>sp|Q9WTU0|PHF2_MOUSE Lysine-specific demethylase PHF2 OS=Mus musculus GN=Phf2 PE=1 SV=2 Back     alignment and function description
>sp|P0CH95|PHF8_DANRE Histone lysine demethylase PHF8 OS=Danio rerio GN=phf8 PE=1 SV=1 Back     alignment and function description
>sp|E6ZGB4|PHF2_DICLA Lysine-specific demethylase phf2 OS=Dicentrarchus labrax GN=phf2 PE=3 SV=1 Back     alignment and function description
>sp|Q9UPP1|PHF8_HUMAN Histone lysine demethylase PHF8 OS=Homo sapiens GN=PHF8 PE=1 SV=3 Back     alignment and function description
>sp|Q80TJ7|PHF8_MOUSE Histone lysine demethylase PHF8 OS=Mus musculus GN=Phf8 PE=1 SV=2 Back     alignment and function description
>sp|Q9W0T1|NU301_DROME Nucleosome-remodeling factor subunit NURF301 OS=Drosophila melanogaster GN=E(bx) PE=1 SV=2 Back     alignment and function description
>sp|Q9P281|BAHC1_HUMAN BAH and coiled-coil domain-containing protein 1 OS=Homo sapiens GN=BAHCC1 PE=1 SV=3 Back     alignment and function description
>sp|Q3UHR0|BAHC1_MOUSE BAH and coiled-coil domain-containing protein 1 OS=Mus musculus GN=Bahcc1 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query216
356516937216 PREDICTED: BAH and coiled-coil domain-co 1.0 1.0 0.888 1e-114
351726182216 uncharacterized protein LOC100526926 [Gl 1.0 1.0 0.879 1e-113
255543795216 phd finger transcription factor, putativ 1.0 1.0 0.879 1e-112
224077882215 ebs-bah-phd domain-containing protein [P 0.995 1.0 0.884 1e-111
449461597216 PREDICTED: BAH and coiled-coil domain-co 1.0 1.0 0.847 1e-110
224105329215 predicted protein [Populus trichocarpa] 0.995 1.0 0.870 1e-108
297744763215 unnamed protein product [Vitis vinifera] 0.995 1.0 0.847 1e-108
225427692224 PREDICTED: chromatin structure-remodelin 0.995 0.959 0.847 1e-108
357467401218 Ebs-bah-phd domain-containing protein [M 1.0 0.990 0.839 1e-107
289540938292 zinc-mediated transcriptional activator 1.0 0.739 0.665 2e-98
>gi|356516937|ref|XP_003527148.1| PREDICTED: BAH and coiled-coil domain-containing protein 1-like [Glycine max] Back     alignment and taxonomy information
 Score =  417 bits (1072), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 192/216 (88%), Positives = 205/216 (94%)

Query: 1   MAKPKAPRRTLESYTVKSISKTIKPGDCVLMRPSEPSKPSYVAKIERIESDARGANVKVH 60
           MAKPKAPRRTLESY+VK ISKTI+ GDC+LMRPS+PSKPSYVA+IERIE+DARGANVK+H
Sbjct: 1   MAKPKAPRRTLESYSVKHISKTIRAGDCILMRPSDPSKPSYVARIERIEADARGANVKIH 60

Query: 61  VRWYYRPEESIGGRRQFHGSKEVFLSDHHDIQSADTIEGKCTVHSFKSYTKLDAVGNDDF 120
           VRWYYRPEESIGGRRQFHGSKEVFLSDH D+QSADTIE KCTVHSFKSYTKLDAVGNDDF
Sbjct: 61  VRWYYRPEESIGGRRQFHGSKEVFLSDHFDVQSADTIEAKCTVHSFKSYTKLDAVGNDDF 120

Query: 121 FCRFEYNSSSGAFNPDRVAVYCKCEMPYNPDDLMVQCEGCSDWFHPNCINMTAEEAKRLD 180
           FCRFEYNSS+GAFNPDRVAVYCKCEMPYNPDDLMVQCEGC+DWFHP CI+MT EEAKRLD
Sbjct: 121 FCRFEYNSSTGAFNPDRVAVYCKCEMPYNPDDLMVQCEGCTDWFHPACIDMTVEEAKRLD 180

Query: 181 HFFCESCSTEGQKKLQNSQANGRHSDAKVETKRRRR 216
           HFFCESCS EGQKKLQNS +  RHSD KV+TKRRRR
Sbjct: 181 HFFCESCSAEGQKKLQNSHSASRHSDTKVDTKRRRR 216

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|351726182|ref|NP_001236094.1| uncharacterized protein LOC100526926 [Glycine max] gi|255631163|gb|ACU15947.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|255543795|ref|XP_002512960.1| phd finger transcription factor, putative [Ricinus communis] gi|223547971|gb|EEF49463.1| phd finger transcription factor, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224077882|ref|XP_002305450.1| ebs-bah-phd domain-containing protein [Populus trichocarpa] gi|222848414|gb|EEE85961.1| ebs-bah-phd domain-containing protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449461597|ref|XP_004148528.1| PREDICTED: BAH and coiled-coil domain-containing protein 1-like [Cucumis sativus] gi|449516389|ref|XP_004165229.1| PREDICTED: BAH and coiled-coil domain-containing protein 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224105329|ref|XP_002313771.1| predicted protein [Populus trichocarpa] gi|222850179|gb|EEE87726.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297744763|emb|CBI38025.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225427692|ref|XP_002263493.1| PREDICTED: chromatin structure-remodeling complex subunit RSC1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|357467401|ref|XP_003603985.1| Ebs-bah-phd domain-containing protein [Medicago truncatula] gi|355493033|gb|AES74236.1| Ebs-bah-phd domain-containing protein [Medicago truncatula] gi|388498190|gb|AFK37161.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|289540938|gb|ADD09609.1| zinc-mediated transcriptional activator [Trifolium repens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query216
TAIR|locus:2120252228 SHL1 "short life" [Arabidopsis 0.981 0.929 0.718 2.4e-85
TAIR|locus:2120693234 EBS "EARLY BOLTING IN SHORT DA 0.958 0.884 0.655 8.7e-79
TAIR|locus:2137256193 AT4G04260 [Arabidopsis thalian 0.837 0.937 0.567 1.6e-54
UNIPROTKB|E7ET14 327 PHF2 "Lysine-specific demethyl 0.310 0.204 0.367 2.1e-11
UNIPROTKB|F1NFN2473 BAHD1 "Uncharacterized protein 0.476 0.217 0.373 1e-10
ZFIN|ZDB-GENE-050302-10 1093 phf2 "PHD finger protein 2" [D 0.310 0.061 0.352 1.3e-10
UNIPROTKB|B0QZE1148 PHF8 "Histone lysine demethyla 0.342 0.5 0.329 1.5e-10
UNIPROTKB|B0QZZ2115 PHF8 "Histone lysine demethyla 0.342 0.643 0.329 1.5e-10
UNIPROTKB|B0QZZ3126 PHF8 "Histone lysine demethyla 0.342 0.587 0.329 1.5e-10
UNIPROTKB|B0QZZ497 PHF8 "Histone lysine demethyla 0.342 0.762 0.329 1.5e-10
TAIR|locus:2120252 SHL1 "short life" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 854 (305.7 bits), Expect = 2.4e-85, P = 2.4e-85
 Identities = 153/213 (71%), Positives = 179/213 (84%)

Query:     1 MAKPKAPRRTLESYTVKSISKTIKPGDCVLMRPSEPSKPSYVAKIERIESDARGANVKVH 60
             M K KAPR+ L+SY +K I+K+I+ GD VLMR SEP KPSYVA++E IE+DARG++ KV 
Sbjct:     1 MPKQKAPRKQLKSYKLKHINKSIQEGDAVLMRSSEPGKPSYVARVEAIETDARGSHAKVR 60

Query:    61 VRWYYRPEESIGGRRQFHGSKEVFLSDHHDIQSADTIEGKCTVHSFKSYTKLDAVGNDDF 120
             VRWYYRPEESIGGRRQFHG+KEVFLSDH D QSADTIEGKC VHSF SYTKLD+VGNDDF
Sbjct:    61 VRWYYRPEESIGGRRQFHGAKEVFLSDHFDFQSADTIEGKCKVHSFSSYTKLDSVGNDDF 120

Query:   121 FCRFEYNSSSGAFNPDRVAVYCKCEMPYNPDDLMVQCEGCSDWFHPNCINMTAEEAKRLD 180
             FCRFEYNS++GAF+PDRV V+CKCEMPYNPDDLMVQCE CS+WFHP+CI  T EEAK+ D
Sbjct:   121 FCRFEYNSTTGAFDPDRVTVFCKCEMPYNPDDLMVQCEECSEWFHPSCIGTTIEEAKKPD 180

Query:   181 HFFCESCSTEGQKKLQNSQANGRHSDAKVETKR 213
             +F+CE CS + Q+ L NS +   + DAKV  KR
Sbjct:   181 NFYCEECSPQ-QQNLHNSNSTSNNRDAKVNGKR 212
GO:0003677 "DNA binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM;IDA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0009791 "post-embryonic development" evidence=IMP
GO:0006096 "glycolysis" evidence=RCA
GO:0006333 "chromatin assembly or disassembly" evidence=RCA
GO:0006635 "fatty acid beta-oxidation" evidence=RCA
GO:0006833 "water transport" evidence=RCA
GO:0006972 "hyperosmotic response" evidence=RCA
GO:0007030 "Golgi organization" evidence=RCA
GO:0009266 "response to temperature stimulus" evidence=RCA
GO:0009651 "response to salt stress" evidence=RCA
GO:0016558 "protein import into peroxisome matrix" evidence=RCA
GO:0042744 "hydrogen peroxide catabolic process" evidence=RCA
GO:0046686 "response to cadmium ion" evidence=RCA
GO:0048767 "root hair elongation" evidence=RCA
TAIR|locus:2120693 EBS "EARLY BOLTING IN SHORT DAYS" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2137256 AT4G04260 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|E7ET14 PHF2 "Lysine-specific demethylase PHF2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1NFN2 BAHD1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050302-10 phf2 "PHD finger protein 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|B0QZE1 PHF8 "Histone lysine demethylase PHF8" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|B0QZZ2 PHF8 "Histone lysine demethylase PHF8" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|B0QZZ3 PHF8 "Histone lysine demethylase PHF8" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|B0QZZ4 PHF8 "Histone lysine demethylase PHF8" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query216
cd04714121 cd04714, BAH_BAHCC1, BAH, or Bromo Adjacent Homolo 6e-47
smart00439121 smart00439, BAH, Bromo adjacent homology domain 1e-37
pfam01426120 pfam01426, BAH, BAH domain 2e-35
cd04370123 cd04370, BAH, BAH, or Bromo Adjacent Homology doma 1e-25
cd04717121 cd04717, BAH_polybromo, BAH, or Bromo Adjacent Hom 4e-17
cd04713146 cd04713, BAH_plant_3, BAH, or Bromo Adjacent Homol 1e-11
pfam0062851 pfam00628, PHD, PHD-finger 1e-10
cd04721130 cd04721, BAH_plant_1, BAH, or Bromo Adjacent Homol 9e-09
cd04712130 cd04712, BAH_DCM_I, BAH, or Bromo Adjacent Homolog 9e-08
cd04718148 cd04718, BAH_plant_2, BAH, or Bromo Adjacent Homol 9e-08
smart0024947 smart00249, PHD, PHD zinc finger 5e-07
cd04710135 cd04710, BAH_fungalPHD, BAH, or Bromo Adjacent Hom 1e-06
cd04709164 cd04709, BAH_MTA, BAH, or Bromo Adjacent Homology 2e-06
cd04760124 cd04760, BAH_Dnmt1_I, BAH, or Bromo Adjacent Homol 4e-05
cd04720179 cd04720, BAH_Orc1p_Yeast, BAH, or Bromo Adjacent H 1e-04
cd04719128 cd04719, BAH_Orc1p_animal, BAH, or Bromo Adjacent 0.001
cd04716122 cd04716, BAH_plantDCM_I, BAH, or Bromo Adjacent Ho 0.002
>gnl|CDD|240065 cd04714, BAH_BAHCC1, BAH, or Bromo Adjacent Homology domain, as present in mammalian BAHCC1 and similar proteins Back     alignment and domain information 
 Score =  150 bits (381), Expect = 6e-47
 Identities = 54/136 (39%), Positives = 68/136 (50%), Gaps = 17/136 (12%)

Query: 22  TIKPGDCVLMRPSEPSKPSYVAKIERIESDARGANVKVHVRWYYRPEESIGGRRQFHGSK 81
            I+ GDCVL +        YVA+IE +  D  G N+ V V+WYYRPEE+ GGR+  HG K
Sbjct: 3   IIRVGDCVLFKSPGRPSLPYVARIESLWEDPEG-NMVVRVKWYYRPEETKGGRKPNHGEK 61

Query: 82  EVFLSDHHDIQSADTIEGKCTVHSFKSYTKLDAVGNDDFFCRFEYNSSSGAFNPDRVAVY 141
           E+F SDH D  S  TIE KC V +F  Y +L  V                   P     +
Sbjct: 62  ELFASDHQDENSVQTIEHKCYVLTFAEYERLARVKK----------------KPQDGVDF 105

Query: 142 CKCEMPYNPDDLMVQC 157
             C   YNPD  M++C
Sbjct: 106 YYCAGTYNPDTGMLKC 121

BAHCC1 stands for BAH domain and coiled-coil containing 1. BAH domains are found in a variety of proteins playing roles in transcriptional silencing and the remodeling of chromatin. It is assumed that in most or all of these instances the BAH domain mediates protein-protein interactions. Length = 121
>gnl|CDD|214664 smart00439, BAH, Bromo adjacent homology domain Back     alignment and domain information
>gnl|CDD|216495 pfam01426, BAH, BAH domain Back     alignment and domain information
>gnl|CDD|239835 cd04370, BAH, BAH, or Bromo Adjacent Homology domain (also called ELM1 and BAM for Bromo Adjacent Motif) Back     alignment and domain information
>gnl|CDD|240068 cd04717, BAH_polybromo, BAH, or Bromo Adjacent Homology domain, as present in polybromo and yeast RSC1/2 Back     alignment and domain information
>gnl|CDD|240064 cd04713, BAH_plant_3, BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information
>gnl|CDD|201356 pfam00628, PHD, PHD-finger Back     alignment and domain information
>gnl|CDD|240072 cd04721, BAH_plant_1, BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information
>gnl|CDD|240063 cd04712, BAH_DCM_I, BAH, or Bromo Adjacent Homology domain, as present in DNA (Cytosine-5)-methyltransferases (DCM) 1 Back     alignment and domain information
>gnl|CDD|240069 cd04718, BAH_plant_2, BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information
>gnl|CDD|214584 smart00249, PHD, PHD zinc finger Back     alignment and domain information
>gnl|CDD|240061 cd04710, BAH_fungalPHD, BAH, or Bromo Adjacent Homology domain, as present in fungal proteins containing PHD domains Back     alignment and domain information
>gnl|CDD|240060 cd04709, BAH_MTA, BAH, or Bromo Adjacent Homology domain, as present in MTA1 and similar proteins Back     alignment and domain information
>gnl|CDD|240107 cd04760, BAH_Dnmt1_I, BAH, or Bromo Adjacent Homology domain, first copy present in DNA (Cytosine-5)-methyltransferases from Bilateria, Dnmt1 and similar proteins Back     alignment and domain information
>gnl|CDD|240071 cd04720, BAH_Orc1p_Yeast, BAH, or Bromo Adjacent Homology domain, as present in Orc1p, which again is part of the Saccharomyces cerevisiae Sir1-origin recognition complex, and as present in Sir3p Back     alignment and domain information
>gnl|CDD|240070 cd04719, BAH_Orc1p_animal, BAH, or Bromo Adjacent Homology domain, as present in animal homologs of Saccharomyces cerevisiae Orc1p Back     alignment and domain information
>gnl|CDD|240067 cd04716, BAH_plantDCM_I, BAH, or Bromo Adjacent Homology domain, first copy present in DNA (Cytosine-5)-methyltransferases (DCM) from plants Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 216
cd04714121 BAH_BAHCC1 BAH, or Bromo Adjacent Homology domain, 100.0
cd04713146 BAH_plant_3 BAH, or Bromo Adjacent Homology domain 99.98
cd04716122 BAH_plantDCM_I BAH, or Bromo Adjacent Homology dom 99.97
cd04717121 BAH_polybromo BAH, or Bromo Adjacent Homology doma 99.97
cd04710135 BAH_fungalPHD BAH, or Bromo Adjacent Homology doma 99.96
smart00439120 BAH Bromo adjacent homology domain. 99.96
cd04709164 BAH_MTA BAH, or Bromo Adjacent Homology domain, as 99.96
cd04370123 BAH BAH, or Bromo Adjacent Homology domain (also c 99.96
PF01426119 BAH: BAH domain; InterPro: IPR001025 The BAH (brom 99.96
cd04721130 BAH_plant_1 BAH, or Bromo Adjacent Homology domain 99.95
cd04760124 BAH_Dnmt1_I BAH, or Bromo Adjacent Homology domain 99.94
cd04715159 BAH_Orc1p_like BAH, or Bromo Adjacent Homology dom 99.94
cd04708202 BAH_plantDCM_II BAH, or Bromo Adjacent Homology do 99.93
cd04712130 BAH_DCM_I BAH, or Bromo Adjacent Homology domain, 99.93
cd04718148 BAH_plant_2 BAH, or Bromo Adjacent Homology domain 99.93
KOG1886 464 consensus BAH domain proteins [Transcription] 99.92
cd04720179 BAH_Orc1p_Yeast BAH, or Bromo Adjacent Homology do 99.92
cd04711137 BAH_Dnmt1_II BAH, or Bromo Adjacent Homology domai 99.9
cd04719128 BAH_Orc1p_animal BAH, or Bromo Adjacent Homology d 99.89
KOG1827 629 consensus Chromatin remodeling complex RSC, subuni 99.55
KOG1973274 consensus Chromatin remodeling protein, contains P 99.04
KOG3554 693 consensus Histone deacetylase complex, MTA1 compon 99.01
PF0062851 PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( 98.99
COG5034271 TNG2 Chromatin remodeling protein, contains PhD zi 98.89
smart0024947 PHD PHD zinc finger. The plant homeodomain (PHD) f 98.77
KOG1632 345 consensus Uncharacterized PHD Zn-finger protein [G 98.51
KOG4323 464 consensus Polycomb-like PHD Zn-finger protein [Gen 98.0
KOG2752 345 consensus Uncharacterized conserved protein, conta 97.15
KOG0955 1051 consensus PHD finger protein BR140/LIN-49 [General 96.98
PF1383136 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A. 96.59
KOG1244336 consensus Predicted transcription factor Requiem/N 95.82
KOG1512381 consensus PHD Zn-finger protein [General function 95.51
KOG0954 893 consensus PHD finger protein [General function pre 95.46
KOG0825 1134 consensus PHD Zn-finger protein [General function 95.26
KOG1844 508 consensus PHD Zn-finger proteins [General function 95.16
KOG0957707 consensus PHD finger protein [General function pre 94.73
KOG4299 613 consensus PHD Zn-finger protein [General function 93.67
cd04718148 BAH_plant_2 BAH, or Bromo Adjacent Homology domain 93.23
KOG1632345 consensus Uncharacterized PHD Zn-finger protein [G 93.19
KOG0957 707 consensus PHD finger protein [General function pre 91.65
PF07227 446 DUF1423: Protein of unknown function (DUF1423); In 91.41
KOG1512381 consensus PHD Zn-finger protein [General function 89.83
COG5076371 Transcription factor involved in chromatin remodel 89.32
PF0992653 DUF2158: Uncharacterized small protein (DUF2158); 88.92
KOG0956 900 consensus PHD finger protein AF10 [General functio 88.51
KOG0383 696 consensus Predicted helicase [General function pre 87.8
cd0583483 HDGF_related The PWWP domain is an essential part 87.65
cd0583587 Dnmt3b_related The PWWP domain is an essential com 86.82
PF1130275 DUF3104: Protein of unknown function (DUF3104); In 86.56
KOG1245 1404 consensus Chromatin remodeling complex WSTF-ISWI, 86.43
PF0749650 zf-CW: CW-type Zinc Finger; InterPro: IPR011124 Zi 85.51
PF1078162 DSRB: Dextransucrase DSRB; InterPro: IPR019717 DSR 85.42
PRK1070862 hypothetical protein; Provisional 85.29
cd0608080 MUM1_like Mutated melanoma-associated antigen 1 (M 85.2
KOG2626 544 consensus Histone H3 (Lys4) methyltransferase comp 84.94
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 83.72
>cd04714 BAH_BAHCC1 BAH, or Bromo Adjacent Homology domain, as present in mammalian BAHCC1 and similar proteins Back     alignment and domain information 
Probab=100.00  E-value=3.3e-33  Score=209.39  Aligned_cols=121  Identities=45%  Similarity=0.824  Sum_probs=108.5

Q ss_pred             CcEEccCCEEEEecCCCCCCCeEEEEEEEEecCCCCeEEEEEEEEeecCCCCCCcccccCCCeEEEeCcccccccccEee
Q 027973           20 SKTIKPGDCVLMRPSEPSKPSYVAKIERIESDARGANVKVHVRWYYRPEESIGGRRQFHGSKEVFLSDHHDIQSADTIEG   99 (216)
Q Consensus        20 ~~~~~vGD~V~v~~~~~~~~~~IarI~~i~~~~~~~~~~v~v~WfyRp~d~~~~~~~~~~~~ELf~s~~~d~~~~~~I~g   99 (216)
                      |++|++||+|||.+++.+.++|||+|++||++.+| .++|+|+|||||+||.+++++.++++|||+|++.|++|+++|.|
T Consensus         1 ~~~~~vGD~V~v~~~~~~~~pyIgrI~~i~e~~~g-~~~~~v~WfyrPeEt~~~~~~~~~~~EvF~S~~~d~~~~~~I~g   79 (121)
T cd04714           1 KEIIRVGDCVLFKSPGRPSLPYVARIESLWEDPEG-NMVVRVKWYYRPEETKGGRKPNHGEKELFASDHQDENSVQTIEH   79 (121)
T ss_pred             CCEEEcCCEEEEeCCCCCCCCEEEEEEEEEEcCCC-CEEEEEEEEEcHHHccCcccccCCCCceEecCCcccccHHHhCc
Confidence            45999999999999886678999999999998887 89999999999999999988889999999999999999999999


Q ss_pred             eeEEeeccccccccCCCCCceEEeeeecCCCCCCCCCCceeEEEecCCCCCCCceEEC
Q 027973          100 KCTVHSFKSYTKLDAVGNDDFFCRFEYNSSSGAFNPDRVAVYCKCEMPYNPDDLMVQC  157 (216)
Q Consensus       100 kc~V~~~~~~~~~~~~~~~~ff~r~~yd~~~~~f~p~~~~~~C~C~~~~~~~~~~i~C  157 (216)
                      ||.|+++++|.++....+                .+..+..+|+|..+||++..||+|
T Consensus        80 kc~V~~~~ey~~~~~~~~----------------~~~~~~d~~~Ce~~yn~~~~~~~c  121 (121)
T cd04714          80 KCYVLTFAEYERLARVKK----------------KPQDGVDFYYCAGTYNPDTGMLKC  121 (121)
T ss_pred             ccEEEehhHheecccccC----------------CCCcCCCEEEEeccCCCCcCcccC
Confidence            999999999998765322                344677889999999999999998

BAHCC1 stands for BAH domain and coiled-coil containing 1. BAH domains are found in a variety of proteins playing roles in transcriptional silencing and the remodeling of chromatin. It is assumed that in most or all of these instances the BAH domain mediates protein-protein interactions.
>cd04713 BAH_plant_3 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information
>cd04716 BAH_plantDCM_I BAH, or Bromo Adjacent Homology domain, first copy present in DNA (Cytosine-5)-methyltransferases (DCM) from plants Back     alignment and domain information
>cd04717 BAH_polybromo BAH, or Bromo Adjacent Homology domain, as present in polybromo and yeast RSC1/2 Back     alignment and domain information
>cd04710 BAH_fungalPHD BAH, or Bromo Adjacent Homology domain, as present in fungal proteins containing PHD domains Back     alignment and domain information
>smart00439 BAH Bromo adjacent homology domain Back     alignment and domain information
>cd04709 BAH_MTA BAH, or Bromo Adjacent Homology domain, as present in MTA1 and similar proteins Back     alignment and domain information
>cd04370 BAH BAH, or Bromo Adjacent Homology domain (also called ELM1 and BAM for Bromo Adjacent Motif) Back     alignment and domain information
>PF01426 BAH: BAH domain; InterPro: IPR001025 The BAH (bromo-adjacent homology) family contains proteins such as eukaryotic DNA (cytosine-5) methyltransferases IPR001525 from INTERPRO, the origin recognition complex 1 (Orc1) proteins, as well as several proteins involved in transcriptional regulation Back     alignment and domain information
>cd04721 BAH_plant_1 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information
>cd04760 BAH_Dnmt1_I BAH, or Bromo Adjacent Homology domain, first copy present in DNA (Cytosine-5)-methyltransferases from Bilateria, Dnmt1 and similar proteins Back     alignment and domain information
>cd04715 BAH_Orc1p_like BAH, or Bromo Adjacent Homology domain, as present in the Schizosaccharomyces pombe homolog of Saccharomyces cerevisiae Orc1p and similar proteins Back     alignment and domain information
>cd04708 BAH_plantDCM_II BAH, or Bromo Adjacent Homology domain, second copy present in DNA (Cytosine-5)-methyltransferases (DCM) from plants Back     alignment and domain information
>cd04712 BAH_DCM_I BAH, or Bromo Adjacent Homology domain, as present in DNA (Cytosine-5)-methyltransferases (DCM) 1 Back     alignment and domain information
>cd04718 BAH_plant_2 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information
>KOG1886 consensus BAH domain proteins [Transcription] Back     alignment and domain information
>cd04720 BAH_Orc1p_Yeast BAH, or Bromo Adjacent Homology domain, as present in Orc1p, which again is part of the Saccharomyces cerevisiae Sir1-origin recognition complex, and as present in Sir3p Back     alignment and domain information
>cd04711 BAH_Dnmt1_II BAH, or Bromo Adjacent Homology domain, second copy present in DNA (Cytosine-5)-methyltransferases from Bilateria, Dnmt1 and similar proteins Back     alignment and domain information
>cd04719 BAH_Orc1p_animal BAH, or Bromo Adjacent Homology domain, as present in animal homologs of Saccharomyces cerevisiae Orc1p Back     alignment and domain information
>KOG1827 consensus Chromatin remodeling complex RSC, subunit RSC1/Polybromo and related proteins [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG1973 consensus Chromatin remodeling protein, contains PHD Zn-finger [Chromatin structure and dynamics] Back     alignment and domain information
>KOG3554 consensus Histone deacetylase complex, MTA1 component [Chromatin structure and dynamics] Back     alignment and domain information
>PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5034 TNG2 Chromatin remodeling protein, contains PhD zinc finger [Chromatin structure and dynamics] Back     alignment and domain information
>smart00249 PHD PHD zinc finger Back     alignment and domain information
>KOG1632 consensus Uncharacterized PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG4323 consensus Polycomb-like PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG2752 consensus Uncharacterized conserved protein, contains N-recognin-type Zn-finger [General function prediction only] Back     alignment and domain information
>KOG0955 consensus PHD finger protein BR140/LIN-49 [General function prediction only] Back     alignment and domain information
>PF13831 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A Back     alignment and domain information
>KOG1244 consensus Predicted transcription factor Requiem/NEURO-D4 [Transcription] Back     alignment and domain information
>KOG1512 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0954 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1844 consensus PHD Zn-finger proteins [General function prediction only] Back     alignment and domain information
>KOG0957 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>KOG4299 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>cd04718 BAH_plant_2 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information
>KOG1632 consensus Uncharacterized PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0957 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>PF07227 DUF1423: Protein of unknown function (DUF1423); InterPro: IPR004082 A total of 715 potential protein-coding genes have been identified in the nucleotide sequence of Arabidopsis thaliana chromosome 5, with an average gene density of 1 gene per 4001 bp [] Back     alignment and domain information
>KOG1512 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>COG5076 Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>PF09926 DUF2158: Uncharacterized small protein (DUF2158); InterPro: IPR019226 This entry represents a family of predominantly prokaryotic proteins with no known function Back     alignment and domain information
>KOG0956 consensus PHD finger protein AF10 [General function prediction only] Back     alignment and domain information
>KOG0383 consensus Predicted helicase [General function prediction only] Back     alignment and domain information
>cd05834 HDGF_related The PWWP domain is an essential part of the Hepatoma Derived Growth Factor (HDGF) family of proteins, and is necessary for DNA binding by HDGF Back     alignment and domain information
>cd05835 Dnmt3b_related The PWWP domain is an essential component of DNA methyltransferase 3 B (Dnmt3b) which is responsible for establishing DNA methylation patterns during embryogenesis and gametogenesis Back     alignment and domain information
>PF11302 DUF3104: Protein of unknown function (DUF3104); InterPro: IPR021453 This family of proteins with unknown function appears to be restricted to Cyanobacteria Back     alignment and domain information
>KOG1245 consensus Chromatin remodeling complex WSTF-ISWI, large subunit (contains heterochromatin localization, PHD and BROMO domains) [Chromatin structure and dynamics] Back     alignment and domain information
>PF07496 zf-CW: CW-type Zinc Finger; InterPro: IPR011124 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF10781 DSRB: Dextransucrase DSRB; InterPro: IPR019717 DSRB is a novel dextransucrase which produces a dextran different from the typical dextran, as it contains (1-6) and (1-2) linkages, when this strain is grown in the presence of sucrose [] Back     alignment and domain information
>PRK10708 hypothetical protein; Provisional Back     alignment and domain information
>cd06080 MUM1_like Mutated melanoma-associated antigen 1 (MUM-1) is a melanoma-associated antigen (MAA) Back     alignment and domain information
>KOG2626 consensus Histone H3 (Lys4) methyltransferase complex, subunit CPS60/ASH2/BRE2 [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query216
3kqi_A75 Crystal Structure Of Phf2 Phd Domain Complexed With 2e-09
3kv4_A 447 Structure Of Phf8 In Complex With Histone H3 Length 5e-09
1wep_A79 Solution Structure Of Phd Domain In Phf8 Length = 7 1e-08
3kv5_D 488 Structure Of Kiaa1718, Human Jumonji Demethylase, I 4e-08
1w4s_A174 Crystal Structure Of The Proximal Bah Domain Of Pol 6e-08
2f6j_A174 Crystal Structure Of Phd Finger-Linker-Bromodomain 3e-06
3qzv_A174 Crystal Structure Of Bptf Phd-Linker-Bromo In Compl 4e-06
2fui_A62 Nmr Solution Structure Of Phd Finger Fragment Of Hu 1e-05
2ri7_A174 Crystal Structure Of Phd Finger-Linker-Bromodomain 5e-05
>pdb|3KQI|A Chain A, Crystal Structure Of Phf2 Phd Domain Complexed With H3k4me3 Peptide Length = 75 Back     alignment and structure 
Iteration: 1

 Score = 58.9 bits (141), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 38/64 (59%), Gaps = 1/64 (1%)
Query: 138 VAVYCKCEMPYNPDDLMVQCEGCSDWFHPNCINMTAEEAKRLDHFFCESCS-TEGQKKLQ 196
           V VYC C +PY+    M++C+ C DWFH +C+ +  EEA  +D + C +C  T G+  L+
Sbjct: 9   VPVYCVCRLPYDVTRFMIECDACKDWFHGSCVGVEEEEAPDIDIYHCPNCEKTHGKSTLK 68
Query: 197 NSQA 200
             + 
Sbjct: 69  KKRT 72
>pdb|3KV4|A Chain A, Structure Of Phf8 In Complex With Histone H3 Length = 447 Back     alignment and structure
>pdb|1WEP|A Chain A, Solution Structure Of Phd Domain In Phf8 Length = 79 Back     alignment and structure
>pdb|3KV5|D Chain D, Structure Of Kiaa1718, Human Jumonji Demethylase, In Complex With N-Oxalylglycine Length = 488 Back     alignment and structure
>pdb|2F6J|A Chain A, Crystal Structure Of Phd Finger-Linker-Bromodomain Fragment Of Human Bptf In The H3(1-15)k4me3 Bound State Length = 174 Back     alignment and structure
>pdb|3QZV|A Chain A, Crystal Structure Of Bptf Phd-Linker-Bromo In Complex With Histone H4k12ac Peptide Length = 174 Back     alignment and structure
>pdb|2FUI|A Chain A, Nmr Solution Structure Of Phd Finger Fragment Of Human Bptf In Free State Length = 62 Back     alignment and structure
>pdb|2RI7|A Chain A, Crystal Structure Of Phd Finger-Linker-Bromodomain Y17e Mutant From Human Bptf In The H3(1-9)k4me2 Bound State Length = 174 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query216
1w4s_A174 Polybromo, polybromo 1 protein; BAH, bromo-associa 2e-45
1wep_A79 PHF8; structural genomics, PHD domain, riken struc 7e-23
4dov_A163 ORC1, origin recognition complex subunit 1; DNA re 2e-21
3kqi_A75 GRC5, PHD finger protein 2; metal-binding, zinc-fi 1e-19
3kv5_D 488 JMJC domain-containing histone demethylation prote 2e-17
3kv4_A 447 PHD finger protein 8; epigenetics, histone CODE, c 2e-17
1wem_A76 Death associated transcription factor 1; structura 4e-16
1we9_A64 PHD finger family protein; structural genomics, PH 9e-16
3swr_A 1002 DNA (cytosine-5)-methyltransferase 1; epigenetics, 5e-15
3swr_A 1002 DNA (cytosine-5)-methyltransferase 1; epigenetics, 3e-10
3av4_A 1330 DNA (cytosine-5)-methyltransferase 1; CXXC-type zi 6e-15
3av4_A 1330 DNA (cytosine-5)-methyltransferase 1; CXXC-type zi 7e-12
3o70_A68 PHD finger protein 13; PHF13, structural genomics 3e-13
1wee_A72 PHD finger family protein; structural genomics, PH 6e-13
3o7a_A52 PHD finger protein 13 variant; PHF13, zinc finger, 2e-12
2kgg_A52 Histone demethylase jarid1A; PHD finger, histone m 3e-12
3pur_A 528 Lysine-specific demethylase 7 homolog; oxidoreduct 2e-11
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 3e-10
2k16_A75 Transcription initiation factor TFIID subunit 3; p 7e-10
3rsn_A177 SET1/ASH2 histone methyltransferase complex subun; 1e-08
2xb1_A105 Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; 1e-08
2rsd_A68 E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant 2e-07
1wew_A78 DNA-binding family protein; structural genomics, P 3e-07
2fl7_A232 Regulatory protein SIR3; ORC, silencing, chromatin 8e-07
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 1e-06
2vpb_A65 Hpygo1, pygopus homolog 1; gene regulation, WNT si 5e-06
1x4i_A70 Inhibitor of growth protein 3; structural genomics 1e-05
1wen_A71 Inhibitor of growth family, member 4; ING1-like pr 2e-05
3c6w_A59 P28ING5, inhibitor of growth protein 5; chromatin, 4e-05
2vnf_A60 ING 4, P29ING4, inhibitor of growth protein 4; ace 6e-05
1weu_A91 Inhibitor of growth family, member 4; structural g 2e-04
1m4z_A238 Origin recognition complex subunit 1; DNA replicat 5e-04
>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Length = 79 Back     alignment and structure
>4dov_A ORC1, origin recognition complex subunit 1; DNA replication, replication; 1.70A {Mus musculus} PDB: 4dow_A* Length = 163 Back     alignment and structure
>3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} Length = 75 Back     alignment and structure
>3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* Length = 488 Back     alignment and structure
>3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} Length = 447 Back     alignment and structure
>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Length = 76 Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Length = 64 Back     alignment and structure
>3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* Length = 1002 Back     alignment and structure
>3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* Length = 1002 Back     alignment and structure
>3av4_A DNA (cytosine-5)-methyltransferase 1; CXXC-type zinc finger/C5-methyltransferase family; HET: DNA; 2.75A {Mus musculus} PDB: 3av5_A* 3av6_A* Length = 1330 Back     alignment and structure
>3av4_A DNA (cytosine-5)-methyltransferase 1; CXXC-type zinc finger/C5-methyltransferase family; HET: DNA; 2.75A {Mus musculus} PDB: 3av5_A* 3av6_A* Length = 1330 Back     alignment and structure
>3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} Length = 68 Back     alignment and structure
>1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Length = 72 Back     alignment and structure
>3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} Length = 52 Back     alignment and structure
>2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* Length = 52 Back     alignment and structure
>3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* Length = 528 Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Length = 174 Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Length = 75 Back     alignment and structure
>3rsn_A SET1/ASH2 histone methyltransferase complex subun; PHD domain, winged helix domain, binding, transcription; 2.10A {Homo sapiens} PDB: 3s32_A Length = 177 Back     alignment and structure
>2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Length = 105 Back     alignment and structure
>2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} Length = 68 Back     alignment and structure
>1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Length = 78 Back     alignment and structure
>2fl7_A Regulatory protein SIR3; ORC, silencing, chromatin, transcription; 1.85A {Saccharomyces cerevisiae} PDB: 2fvu_A 3tu4_K* Length = 232 Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Length = 183 Back     alignment and structure
>2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* Length = 65 Back     alignment and structure
>1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Length = 71 Back     alignment and structure
>3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* Length = 59 Back     alignment and structure
>2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* Length = 60 Back     alignment and structure
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Length = 91 Back     alignment and structure
>1m4z_A Origin recognition complex subunit 1; DNA replication, transcriptional silencing, chromatin, BAH D gene regulation; 2.20A {Saccharomyces cerevisiae} SCOP: b.34.12.1 PDB: 1zhi_A 1zbx_A Length = 238 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query216
1w4s_A174 Polybromo, polybromo 1 protein; BAH, bromo-associa 99.98
3swr_A 1002 DNA (cytosine-5)-methyltransferase 1; epigenetics, 99.93
3av4_A 1330 DNA (cytosine-5)-methyltransferase 1; CXXC-type zi 99.92
4dov_A163 ORC1, origin recognition complex subunit 1; DNA re 99.91
3swr_A 1002 DNA (cytosine-5)-methyltransferase 1; epigenetics, 99.86
4ft4_B 784 DNA (cytosine-5)-methyltransferase 1; chromodomain 99.82
3av4_A 1330 DNA (cytosine-5)-methyltransferase 1; CXXC-type zi 99.8
1wep_A79 PHF8; structural genomics, PHD domain, riken struc 99.69
2fl7_A232 Regulatory protein SIR3; ORC, silencing, chromatin 99.61
3kqi_A75 GRC5, PHD finger protein 2; metal-binding, zinc-fi 99.61
1m4z_A238 Origin recognition complex subunit 1; DNA replicat 99.61
1we9_A64 PHD finger family protein; structural genomics, PH 99.59
3o70_A68 PHD finger protein 13; PHF13, structural genomics 99.49
3o7a_A52 PHD finger protein 13 variant; PHF13, zinc finger, 99.48
1wee_A72 PHD finger family protein; structural genomics, PH 99.46
2kgg_A52 Histone demethylase jarid1A; PHD finger, histone m 99.45
1wem_A76 Death associated transcription factor 1; structura 99.43
1wew_A78 DNA-binding family protein; structural genomics, P 99.4
2vpb_A65 Hpygo1, pygopus homolog 1; gene regulation, WNT si 99.39
2jmi_A90 Protein YNG1, ING1 homolog 1; PHD, histone, recogn 99.38
1wen_A71 Inhibitor of growth family, member 4; ING1-like pr 99.34
2rsd_A68 E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant 99.32
3c6w_A59 P28ING5, inhibitor of growth protein 5; chromatin, 99.3
2xb1_A105 Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; 99.3
1weu_A91 Inhibitor of growth family, member 4; structural g 99.3
1x4i_A70 Inhibitor of growth protein 3; structural genomics 99.29
3kv4_A 447 PHD finger protein 8; epigenetics, histone CODE, c 99.28
3kv5_D 488 JMJC domain-containing histone demethylation prote 99.28
2g6q_A62 Inhibitor of growth protein 2; protein-peptide com 99.28
2k16_A75 Transcription initiation factor TFIID subunit 3; p 99.24
2vnf_A60 ING 4, P29ING4, inhibitor of growth protein 4; ace 99.23
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 99.22
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 99.16
2lv9_A98 Histone-lysine N-methyltransferase MLL5; zinc fing 99.1
3pur_A 528 Lysine-specific demethylase 7 homolog; oxidoreduct 98.98
3rsn_A177 SET1/ASH2 histone methyltransferase complex subun; 98.55
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 98.42
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 98.38
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 98.36
3ask_A226 E3 ubiquitin-protein ligase UHRF1; histone reader 98.31
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 98.26
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 98.24
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 98.2
3asl_A70 E3 ubiquitin-protein ligase UHRF1; histone reader 98.2
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 98.16
2yt5_A66 Metal-response element-binding transcription facto 98.15
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 98.13
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 98.12
2e6s_A77 E3 ubiquitin-protein ligase UHRF2; PHD domain, str 98.11
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 98.06
3shb_A77 E3 ubiquitin-protein ligase UHRF1; unmodified hist 97.95
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 97.93
4gne_A107 Histone-lysine N-methyltransferase NSD3; zinc fing 97.87
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 97.85
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 97.76
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 97.74
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 97.71
3o36_A 184 Transcription intermediary factor 1-alpha; TRIM24, 97.67
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 97.53
4bbq_A117 Lysine-specific demethylase 2A; oxidoreductase, ub 97.47
3u5n_A 207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 97.42
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 97.01
2ro1_A 189 Transcription intermediary factor 1-beta; KAP, TIF 96.81
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 96.25
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 96.17
3ql9_A129 Transcriptional regulator ATRX; zinc finger, trans 89.9
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 89.44
1wil_A89 KIAA1045 protein; ring finger domain, structural g 83.48
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 81.45
3zzs_A65 Transcription attenuation protein MTRB; transcript 80.22
>3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* Back     alignment and structure
>3av4_A DNA (cytosine-5)-methyltransferase 1; CXXC-type zinc finger/C5-methyltransferase family; HET: DNA; 2.75A {Mus musculus} PDB: 3av5_A* 3av6_A* Back     alignment and structure
>4dov_A ORC1, origin recognition complex subunit 1; DNA replication, replication; 1.70A {Mus musculus} PDB: 4dow_A* Back     alignment and structure
>3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* Back     alignment and structure
>4ft4_B DNA (cytosine-5)-methyltransferase 1; chromodomain, BAH domain, DNA methyltransferase domain, H3K9 binding, methylation, transferase; HET: DNA MLY SAH; 2.70A {Zea mays} PDB: 4ft2_A* 4fsx_A* Back     alignment and structure
>3av4_A DNA (cytosine-5)-methyltransferase 1; CXXC-type zinc finger/C5-methyltransferase family; HET: DNA; 2.75A {Mus musculus} PDB: 3av5_A* 3av6_A* Back     alignment and structure
>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2fl7_A Regulatory protein SIR3; ORC, silencing, chromatin, transcription; 1.85A {Saccharomyces cerevisiae} PDB: 2fvu_A 3tu4_K* Back     alignment and structure
>3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>1m4z_A Origin recognition complex subunit 1; DNA replication, transcriptional silencing, chromatin, BAH D gene regulation; 2.20A {Saccharomyces cerevisiae} SCOP: b.34.12.1 PDB: 1zhi_A 1zbx_A Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} Back     alignment and structure
>3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} Back     alignment and structure
>1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* Back     alignment and structure
>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* Back     alignment and structure
>2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* Back     alignment and structure
>1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Back     alignment and structure
>2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} Back     alignment and structure
>3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* Back     alignment and structure
>2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Back     alignment and structure
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} Back     alignment and structure
>3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* Back     alignment and structure
>2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Back     alignment and structure
>2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} Back     alignment and structure
>3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* Back     alignment and structure
>3rsn_A SET1/ASH2 histone methyltransferase complex subun; PHD domain, winged helix domain, binding, transcription; 2.10A {Homo sapiens} PDB: 3s32_A Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure
>4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>4bbq_A Lysine-specific demethylase 2A; oxidoreductase, ubiquitin, ligase, ubiquitination, demethyla ZF-CXXC DNA binding domain, CPG island, chromatin; 2.24A {Homo sapiens} Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>3zzs_A Transcription attenuation protein MTRB; transcription regulation, protein engineering; HET: TRP; 1.49A {Geobacillus stearothermophilus} SCOP: b.82.5.1 PDB: 3zzq_A* 3zzl_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 216
d1m4za_217 b.34.12.1 (A:) Origin-recognition complex protein 1e-23
d1wepa_79 g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus mus 2e-19
d1we9a_64 g.50.1.2 (A:) PHD finger protein At5g26210 {Thale 9e-12
d1weea_72 g.50.1.2 (A:) PHD finger protein At1g33420 {Thale 1e-11
d1wema_76 g.50.1.2 (A:) Death associated transcription facto 1e-10
d1wewa_78 g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale c 1e-07
d2pnxa151 g.50.1.2 (A:195-245) Inhibitor of growth protein 4 1e-07
d1wesa_71 g.50.1.2 (A:) PHD Inhibitor of growth protein 2, I 2e-06
d1weva_88 g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus mu 5e-05
d1mm2a_61 g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens 7e-05
d1f62a_51 g.50.1.2 (A:) Williams-Beuren syndrome transcripti 0.003
>d1m4za_ b.34.12.1 (A:) Origin-recognition complex protein 120kDa subunit, Orc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 217 Back     information, alignment and structure

class: All beta proteins
fold: SH3-like barrel
superfamily: BAH domain
family: BAH domain
domain: Origin-recognition complex protein 120kDa subunit, Orc1p
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score = 91.9 bits (228), Expect = 1e-23
 Identities = 18/157 (11%), Positives = 31/157 (19%), Gaps = 26/157 (16%)

Query: 22  TIKPGDCVLMRPSEPSKPSYVAKIERI----------------------ESDARGANVKV 59
            +  GD V+M          V  I+ +                         A       
Sbjct: 52  KLGRGDSVVMHNEAAGTY-SVYMIQELRLNTLNNVVELWALTYLRWFEVNPLAHYRQFNP 110

Query: 60  HVRWYYRPEESIGGRRQFH-GSKEVFLSDHHDIQSADTIEGKCTVHSFKSY--TKLDAVG 116
                 RP               E++L+                V     +   K +   
Sbjct: 111 DANILNRPLNYYNKLFSETANKNELYLTAELAELQLFNFIRVANVMDGSKWEVLKGNVDP 170

Query: 117 NDDFFCRFEYNSSSGAFNPDRVAVYCKCEMPYNPDDL 153
             DF  R+    +   F    +           P + 
Sbjct: 171 ERDFTVRYICEPTGEKFVDINIEDVKAYIKKVEPREA 207
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 72 Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 76 Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 Back     information, alignment and structure
>d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 71 Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Length = 88 Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Length = 61 Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query216
d1m4za_217 Origin-recognition complex protein 120kDa subunit, 99.81
d1wepa_79 PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 99.62
d1weea_72 PHD finger protein At1g33420 {Thale cress (Arabido 99.32
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 99.23
d2pnxa151 Inhibitor of growth protein 4, Ing4 {Homo sapiens 99.23
d1wesa_71 PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu 99.18
d1wema_76 Death associated transcription factor 1, Datf1 (DI 99.09
d1wewa_78 Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop 99.05
d1weva_88 PHD finger protein 22 {Mouse (Mus musculus) [TaxId 98.85
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 98.71
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 98.62
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 98.35
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 90.69
d1nppa258 N-utilization substance G protein NusG, C-terminal 83.32
d2v89a174 V(D)J recombination-activating protein 2, Rag2 {Mo 81.65
>d1m4za_ b.34.12.1 (A:) Origin-recognition complex protein 120kDa subunit, Orc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All beta proteins
fold: SH3-like barrel
superfamily: BAH domain
family: BAH domain
domain: Origin-recognition complex protein 120kDa subunit, Orc1p
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.81  E-value=8.5e-21  Score=152.03  Aligned_cols=143  Identities=15%  Similarity=0.082  Sum_probs=108.4

Q ss_pred             CceeeeeEEEecCCcEEccCCEEEEecCCCCCCCeEEEEEEEEecCCCCeEEEEEEEEeecCCCC---------------
Q 027973            7 PRRTLESYTVKSISKTIKPGDCVLMRPSEPSKPSYVAKIERIESDARGANVKVHVRWYYRPEESI---------------   71 (216)
Q Consensus         7 ~~~~y~~~~v~g~~~~~~vGD~V~v~~~~~~~~~~IarI~~i~~~~~~~~~~v~v~WfyRp~d~~---------------   71 (216)
                      +++...++....+|..+++||+|+|.++++ +++|||+|.+|.....+....+-+.||+|..|..               
T Consensus        37 ~~~~~~~~~r~~D~~e~~~GD~Vlvk~~~~-~~~~v~iI~ei~~~~~~~~~e~~~~~~lr~~e~~~~~~~~~~~~~~~w~  115 (217)
T d1m4za_          37 GAKTEHYLKRSSDGIKLGRGDSVVMHNEAA-GTYSVYMIQELRLNTLNNVVELWALTYLRWFEVNPLAHYRQFNPDANIL  115 (217)
T ss_dssp             ---CEEEEEETTTCCEECTTCEEEEEETTT-TEEEEEEEEEEEEETTTTEEEEEEEEEECGGGSCHHHHHHHHCHHHHHS
T ss_pred             CCCCcEEEEEecCCeEEecCCEEEEeCCCC-CCceEEEEeeeccCcccchheeeeecccchhhhccchhhhhcccceeee
Confidence            333334444555678999999999998774 6899999999998776645667777777776642               


Q ss_pred             -------CC-cccccCCCeEEEeCcccccccccEeeeeEEeecccccccc--CCCCCceEEeeeecCCCCCCCCCCceeE
Q 027973           72 -------GG-RRQFHGSKEVFLSDHHDIQSADTIEGKCTVHSFKSYTKLD--AVGNDDFFCRFEYNSSSGAFNPDRVAVY  141 (216)
Q Consensus        72 -------~~-~~~~~~~~ELf~s~~~d~~~~~~I~gkc~V~~~~~~~~~~--~~~~~~ff~r~~yd~~~~~f~p~~~~~~  141 (216)
                             .. .+....+||||+|++.+.+|+++|+|||+|+..++|..+.  ....++||||+.||+..+.|++......
T Consensus       116 ~~p~e~~~~k~r~~~~~~ElflT~~~d~i~~~~I~~k~~V~s~~ef~~~~~~~~~~~~F~cr~~~D~~~~~f~~id~~~~  195 (217)
T d1m4za_         116 NRPLNYYNKLFSETANKNELYLTAELAELQLFNFIRVANVMDGSKWEVLKGNVDPERDFTVRYICEPTGEKFVDINIEDV  195 (217)
T ss_dssp             CCCHHHHHHHHHHHSCTTEEEEEEEEEEECGGGEEEEEEEECHHHHHHHGGGCCTTTEEEEEEECCTTSCCCEECCHHHH
T ss_pred             cCchhhhhhccccccCcceeEecCccceeehhheeeeEEEecHHHhcchhhccCCCCeEEEEEEEcCCCCceeeccHHHh
Confidence                   11 1223678999999999999999999999999999996543  2467899999999999999997555666


Q ss_pred             EEecCCCCC
Q 027973          142 CKCEMPYNP  150 (216)
Q Consensus       142 C~C~~~~~~  150 (216)
                      |.+-..++|
T Consensus       196 ~~~~~~~np  204 (217)
T d1m4za_         196 KAYIKKVEP  204 (217)
T ss_dssp             HHHHTTSCH
T ss_pred             hhhccccCh
Confidence            666555554
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1nppa2 b.34.5.4 (A:191-248) N-utilization substance G protein NusG, C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2v89a1 g.50.1.2 (A:1414-1487) V(D)J recombination-activating protein 2, Rag2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure